ELF(@43K4 (@@``PM!P"\\@0 6QQ O@@@( @0 fH!@P@Q?H3tР -L(/PMP]main() returned_   ! X(@@T @@ 0/aaT (/// P-Lxv@-@PL00S @0080 0 0 0 (Ѝv``^^P/00S 000/v3@-@iMprP @iߍ0s dPP B00 0s`RV & h#&@ '  0R)0R OoB}u_edA3^^\ 4S/0!8 00 (   !/Hzhzlz@-뱁kP|'0 !!X0T0P0H000, !  !d^d^^HzhzlzG-aM0SJpP  -@T  - pP9  P@1 P P hP5 DP@ }P%{   P PP 00 B4R 0 @a0C0 P e(ЍG \@P|Pl}PP GPD 8A%$ 0@ G}u_xGu^^^^A_^^^^^@-<@\P+$VPP@ `^^^_U_^^@-l00: SAT 88S!~L0Yw@嗋 00 廋]@B@-0@0PS@!@.個 4Sʀ0! 0    !B? SSRl0 !! H$D$<$8Q0$̀3-Hzhzlz^^_^(_^@B6_^ P00  /$@$0P  000/dPd<0 P0/S/0CQ/]s@-@0S7`P`P) P' P P0000 8PЍp@較dPX0` P0RЍp@a @P8P0ЍpH_^O_^V_^p@4]_^]` @ @O-Mb$pPt ?WLT!7GR  EP00l'0d'd7!`' \7PX7+RJL7尤ᴴḔἄ e U `P& 6  ::Sf0匆A6cP X "01%6PQ P!! *!& 1儆 !&f0|6#6$1  1" @P *L%H&H6HfUTS$1)0C$10!10C0PU0S 9#9S  @P :$1I)0C*$1,1,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1lt*0C$10! 10C01 @ Pl:$1*0C$1o1! 10C11 @ PZ:$1)0C$1]P#Gq㰃 uGW#G#Gx#xGp#pG$p`3`` \3!XT3 0C 0p 0G! 0I 0I G": zG": rGt: kG\: dG0p09 \G 0p0 :RGXp!'H!p0 G<J$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xE[+ 1\H0WHSH010! ,1,! (1(!h$'딴! 1"E Ѝc_^@x\@0 DSBO]3ﾭH_^0`AiP]_^??,/li`?w_^)i` _^@ihaaTaa^^ _ _@4_H_\iP@`:__ _o @ @`@@- @0 PЍO-`p㨱LM P 1 0LЍ001!4 S6AT1S1S1S* o@ TTW    ,00< @0p08X @P\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/]` p@-dLPTHU@ $ ``06/Tp0`$ p@//p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ]p)@A-0PST@ Sq | _Bu 00 `0*b6/`P k  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@`^a^p@-P0 ` T@003/U U ,  p 003/'a^~@-00 ~ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-0`@TP Vp V h|00 3/P0T00 T0 `@4/A0T0 `@3Ga^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~=ha^ 0o/x_/0@-0M P@ 0P 000 Ѝ0T.@p@-0@Tp@ttz$0dP 5/0 dP5/0~0~ 0p@~x_T\a^A-(MP4@D1P<240100: S# 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0P (ЍA05p`WV ||t cPd  0 0@0 0((Ѝx_&_^]a^pA1@a^\.@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@:A-1@TAH0P`dp 7/U ~~ 0dP5/~0dP 5/0 4P5/}U} A} }U A}x_^\a^p@-0@TxxPpPP0 4P5/ 0 4P5/P} }}x_l\a^C-1M@TЍp_0` dP5/ 0dP5/P }}}ppPP p d09/0 49/ [0 49/ 0 49/PU k}i}g}0 dP5/0?<#x_a^y\A-1@T  oPP0` dp7/ 0dp7/ 0}.}6}0dp 7/0 4P5/ 0 4P5/ 0 4P5/P}x_\a^O-,1P@`()|,&|0#|4 |0p,|(|0|4||| | @P0 | (| (| [P0| | ({| ,x|0u|4r|OO|x_0S@- S S@@Wa^00@o/]` @-b@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ G2RS 3C7CR008#8S800 0⳵ &⯵1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011>P008#8S308#8S0x`0 p\ h(`8p<V151``5008#8Sy308#8SsSW HdHd&b^|_ @b^@-@`KP@h `0 0X 0P0 P0H00004 4D`P$Ѝp\J\L;@;@a^@-#{@-@o0 0R/  ^]` \lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f@-@/4/@-@/@-@/@-@/@-@/@-@/@-@/A-Pp\`0@ 2/ p 0S0@0 @0000@A-P M@`:0 0 0  p7/0P * * p7/0P  "( p7/ Px 000 00@0L1 R `   P $ Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  H|000040J> 0 0000Ȅ 8/0$@0\0` 6w,]b^&_^~b^b^b^|_b^ ^ 0 /|_/$ R/P//C-p0MS @*`  3@P" Pd@ 001Q0000!T0    40 00 d6/00P@@Ѝ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0" //@- xoc^@-@(00 S@@]\c^A-QP@ 0S @T`V pl`V @@DT@S 0S T@ O|` 00 p@-@P@70`000```0P0 `P~0| ~`Pdt0X t`P<j04 j`Ppp@_&_^\_F@Cc^E@HF@F@@-@A@-@~@-@y u0 0@-x0 0@k0 0@e0P/__@-<0@TP T0 0 @L_0P/QC_p@-0@T/ 0S S* S& P 0 0 P PU% Pp 0D0P0000C00 0P  pp_RW SW 0o/_///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2Slx@P@hxP,@ @T,@ tpG-M`@P2`0p븂0XP养 ܻ0* Rq "Sl ph2h P00 000!h<" p-P\P_0A0$;P(0SIP㴑ġ0SKP 1@]wP 1@UwP l1@MwP L1@EwD10S h 000h0 01@0`0!dЍ0!p P_ a` P0p 0wP0qw {w0* R 0 @wP S T0@_&_^](L@` \L@a^P@H@ L@hH@ l~J<\O@@-//G- s@dVʀ 0! $"0""   !P 0x {wwP0S DzP0SP0SDP0SK( ]0T Q0S001R0 P "00 S^0 ?0y >w Ow z0S Fw zP0p wP ,0S -0S (05#0x w&wP0p 4wP Q 0R(0l0S$00SPXX0S`P\ d$0Y0 0 0?c/ 0!D d08 0   !#Hzhzlz_X?gfffA-X0P@0`0\00`P @  @jЍ P@- R PP_0/_p@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p<_Hzhzlzp@-HP0PSp P@ `6/;0  0p@/_p@-p`0SpdPP@0 S 000p0CS0p0 `6/Tp@QA_G-pP`̐P@ P% P# PV `FPEK @P P #P P00Z0S P 8 P`42  `@- &_^|d^d^^/@-0,\ @T 4/Ѝ_00S/ R//_00S/ R//_p@-@P4`|/ v/0p@80/_ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/A-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 i@i@ 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (q |d^d^d^d^d^0@-LP$M@m 000 0$Ѝ0&_^j@0@- 0@ ,MPr           0 040$0P 000 ,Ѝ0i@/0/!//A-pQ`.0  P@ x0ELP Hpp`@tT:80]+0 'J x>@&\@- d^@- d^///1/8#81/1/ W  R/ R/ d 0s S40@o//0@3S0/o/ d^p@-@0PT3/.p`R0p@8/4! $$#  p@/d^d^`\d^d^Q0 Q Q // ^d^e^W8_O-P`M 0 3/Ѝ03/@zQ [0$  3/0 0Sp "R 3/ 0A0CS000l 3/u0d 0Q 0H 3/, $.!4 3/!0AYS}p@ly@w@ly@ly@@y@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@q@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@w@w@r@ly@8w@ly@ly@Tv@ly@ly@w@ly@4v@ly@w@r@w@w@ly@@v@ly@x@tv@v@v@ly@ly@ly@ly@ly@ly@s@u@v@\r@s@lu@u@u@u@u@v@t@r@r@r@v@r@u@r@v@pr@ x@r@x@x@x@0c0C S+q@q@q@q@q@q@q@q@q@q@q@x   0\3/ 0L3/@ 0<3/W  0$3/ 03/W07 1p 2/0 30 r#03/0A CR@S> 000 0R8L3/4$$(0". (:$ 03/$&0$0$3/0 0 &6z R'zppF0$0x3/p60S `6`&0S T&ZP0H3/083/ jZ0 03/$r0p0pO8OS $03/50S 5Z 2/%5 0|| 3/Zc 0L3/0X3/p0! 'R0,3/0 nK RS 0 3/  BR03/Z  03/R$0Y$0 t$tO0J$80 0C2/ $0!?3?3 2/!;?#00@q 0s0 0$* "0  : 0#$90"? :$#: \0LH#0$"<0,,7S0 S003/ 03/ 03/ 03/0000$3 0$2 p0$0`$40S$HH 2/$03/!t03/0t3/0h3/W_ 0~0$03/$($0p 7/0z0l3/200p\$($0 7/6$8$&$p(0 0[ e^p\\e^^'e^&_^"e^j^_v_j^+e^`\)e^/e^ve^^d^(0000]ߍ`@P X@P0`(0 0APN@ @0 4/@ AT@P @> 4/@@G8H1 !0R$04$0/o/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ __p@-A0S! 0S\X l\0_03/UA 00<000S: #: " ! 3\ #30 00C 300%& %6 " ! \ #30 00C 300000C0[$00pBB_Ai!i "i^1?/ //?0 0!0S 0@o/ //0/////?  22//-P/6  N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N 1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  (00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h`_03 /0@-$@4 < 4 @ 8 L < @ 0 < /p@-P$@4 40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/@-1$ 400 001!00<p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0lZp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@⑷0` 1017800sh?` !.p?W #t0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X2>101101> 0\! 6 SSO-0p@`0M 46CSЍO-t 000 0$00 L04`0C0C00 qЍp!```Q 0 Z0cQ 70 J<!PP81\Z 0  7PP  P0< 0  3/ ZPu U  u L0 0C0CL00" 0 0 0P0P20@-0t 0@@$!0   80$ &08@1011@2/L00C 02/ᔬ@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$!6  P p@-ZCU0 lPC^ 1 0 L00L06&0 6&p/ppP 0@- @ |M l Q \\ QQSH0t S0  !0 @p|Ѝ00!R 10/`p@-@P XPp `0 S   G0@-4 0S$ @ ` G-82p&xM &  , ! L   PALPRcF0@!104C T*0FPALPRc0^S t v0  !0 PoxЍH03!0%@ 0 :/P> 0t R0 !0 P$@soxЍG~0@ T03:0 H@      "RD$  H0XY ,S@ Y `i^^@L@@|@ @@BO-`P|T&Pi^@ j^h`@j^ j^`'j^3j^Aj^Nj^Vj^^j^ej^mj^zj^j^j^j^G-`pMP `  @k000P00p 0@R 0 p0 00 00000 0G?o2P0S0 SЍS0h`_@A-xM@P`` p3P0H0X 00 000000xЍ C-0|MT@T 0S P`p` H@0X 00 000000|Ѝ-`G-锐xMZ- @P`` p %H"0X 00 000000xЍGp@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/ጵ@p@__@- @p03/_@-@0 @T  0 !! @Z j^A- ! 1M03/J0P `X@P pX0 J T@/Xn@@@ K9@&p`p0 /l~]0pL p4ر0$p00 Ѝx_&\`p_x>o /@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00~P 0S#020 0qP 0S"020 0dP 0S"010 0WP 0S|"010 0J Pd 0Sh d0@ Pf 0Sj @06 Ph 0Sl 0, Pj 0SnЍ0!Ppr!000m0 Pn0Phj`!0@00e0Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070u^3j^j^j^j^ k^u^Zv^cv^k^;_^ k^j^j^j^j^k^k^k^k^k^'k^@-H00S<00S0 00000}Ѝ^^00/G-Sp@` @ S( S11P0 @D`Fp@03/ L03/X(@`pGP@@0P3/ L0G/RdP@03/L0 D03/ P03/ZPH03/T0``_d`O- 0@4`lTD r0P\qX pX>  R7: R3* P N Y  L\!TWX# D p(p W*Y ) p 0S p    0@[ ЍpWr P@@- ^ 0P \0 B^0S\*k^A-Pp4`@P 0Pp 0<0`@P00 (@0 0,0 r4G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0:P  `FP@VU0,00,0000,000000/O-0p `0 W W WP2d0 ЍO/@08"0 S )4S 04PSz@@t@(@@V @D P T*O0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!)0 0 A3A3C?o20 0c @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0: @ `FJ$$U Q Ѝ_&\\Gk^dk^C-@Pp T ᠸ Ѝb2"0S@0j0O-M 0S0>W:W: 0(% "S  R 0 [0!> zJD x>&\k^p@-PN@N@M 0> p@0&\x>@-0 PS@0S 0#G-p`@00hTЍ PZe 0 YUP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍrO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR ODD P P P;/ \H0H00HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 0 0  0 P PE\ 0 H0P0 B$0 00007 rO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T նP%@Ⴉ P @[H0@@ t:S P%0:0PD0@S ᡶ Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xPA-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R ` (0+0  PVV0P00 0 Ѝ R B *0PVV0P00  0 | $ R ( (0+0 PVV0P0 0 0\k^k^l^//@-M`@pPT#T,'H}0'<yUH/, 2?0Rr pB```@Q```CPPP T@%PP `1l p< 000T0 4 @Ѝ@.ЍDl^Ql^^l^``$a(a,aaakl^l^l^A-HCM`PTYЍARI  !pŸ *Q   0"D3S 0P 0Sl  X!\1- L < W,  WT3W0pW0! 1 1  G R#T3T3@T3  tpl1l!0S `1*B0S P1F@T,,T3   !1@TT 0 0 0 0  |W P01GT :Ѝ5 {l^ _\^m^^"[_2m^;m^Hm^Lm^Zm^m^ \^m^m^m^m^m^&_^AXVgm^tm^m^m^`A`A4`l`^^m^m^,n^C-pP@P03/bTD03/0L30HP30?,7?07@s)2C 0002  00"d2  00H2  00,2  00 2  001  001  001  001J 001N 00h1R 00L1V 0001Z 001^ 000b 000f 000  000j 0004S ЍC)d` ЍC_Zn^gn^tn^n^n^n^n^n^o^?o^So^go^}o^o^o^o^o^o^o^p^p^ P-`@P p!c pЗ!P  R $L#LpL 4D:  4/!`@S`!W , ,`! !oDЍReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! R!oDЍN  0O   ! "`"Рo+ T R2 RLDLOoB@   P 4(S0" [04W  P P P  P A@!T@@@0 (0 x0P(W XW [ 0(0L0Ѝ 0 0\t  0垦 0 S{ S S 0, (0A`pPzO0@ 0 x< 0(0 8< 0\ '_%\$y^_x>Qy^y^y^O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 -xP/ t -0 [0 0a`Pzo`0 0  0 0 0t  0 0 0$  00@4@@0  P0 @TL@0* R @)Ѝ_y^O-p1pd0P@3/tXXaWTʀ 0! $ 0    !U U+ U5 r?oT20S00 0!t!0   , ! Ѝ f?oT20S00 j?oT20S00 &_Hzhzlz'&\y^00P (031000Co// !:!P/ 0  P/@0. 04S/Q0 /0  @-IC.@-BG-08M@pl00 00,(p$@ @@ @`Py0,0L0 0D000000(p$@@ @`~y8Ѝ;_a_{^0S;0;0 / 0 R/<0P/0*4S/0S0 0 /000/_*4S/@-0@03/0BN0_Q(QP0\0 /)Q/R0 S 0@0D0/S/0H0_Q@-@ (4S80BNX03/00)4S0<03/0)4_p@-@0Do A("(RP p$$Ph$! ,$" \%R 8A00CS0p0 p@  bd@-@|0T0S$D 0SX , 0S@@G,<0QD$   D$ @@DD @a0 04Ē Q884/0H4S/ aT H$R @-@@8P 084 $ 00;}4a x>@0P/@-    B B  P^^ $ B$ ( Q !! B B!! 0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%*1QP \ : 0010?0@03/@X0PhS%!1XLP L0뚟@03/@Za_ g{^p@-0PXdT4S N@l $60L0V L0?4`003/03/+wpa _p@-D@[P\y_0``003/03/`p\4P_pa_0O-P` @P\Q pQ00؁U00SG R㼑= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᤠT ``  U [  R`` `s!& 1!T0L  @ _aA-P @`pTQ 0 "A9P 0`PR  V`p@V0A3100A-`P@pC*<@}*[dP_\[_P`h003/`003/03/`hMd4P\4P__耮a_G-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`PQ 0 ^ ` 0S 0PR! S YY S 0h0hS 1S 0h  PU0S0`0004&\ P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B   /O-P64M@0$0p o6`H4S 0  000 \0(0X0勱2jJ) 6T&0P0 '6000 0 01,0 0Z P 0P P P0S  0S<`#)X00 000(0S X00 000X05`5T4 0 0S0U0S 0 00C)4S ( `00 4H03/$)Pd$0ST Z 0 X000404. 0 皯,-0?T 4x4ST$0S  $4,'$ 0020P 10? 0S ( 0 <((kU h@.''PU LPP P 0 0000Q@  0P 0R  X0  ( @_kYU TQ 张OU(06 <j  (0  00 ` 0  P0 0000 0000 1T!R110011 0404<Y|^(\(X0 |   @k4ЍR 0000 00(0$ S000T0R0SX0 0T4U <`' P  !(` 0 QX0 @0`5 X+ 0 1?  _a0f _db{^{^O-@4M` h' TU2T 2x4ST B>0PS0 4pp0V :'jRW @p&: :6S1!f0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z%  P <00N'  (T'[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0 4P00? 4Sf0(4S   0t S4Ѝ 0fO-@p@7P`g4& ( *60Q000  谟 @03/00 3/03/'  0X4% 0?UW 0<0bOicPP <`T00  S  S80d5 ,0T42 S0`5 _a`0@-0@D0PSMℚPЍ00 0|P 40 U0*0$@O-@pIga&T:&003/OMi$ZZVUP!2`$5ᔠ?`T:0 0C0P @0  <@0H 00?@03/003/J` _aA-p@`Pg&$4$*$00SR&i(DF0@00V@U($<01S  2# R5&h$60-&hX 0S(H$HJ$J@L W000  00 p@- 0$@0P000Sp`H4S d0)$4$倲H P4h5hE000D40@@DDpa {^O-`MlP@}f%0I 0000 T : 0 S:0SM%ЍOuh$jjf V `!ZP@ p$5?pT*. , 0  ᚯ뚯R0 0>00' 7mD h@t1q $4!*$010D,$020 0@01 0(1C0 0@@ @@@1 0000 @@0 0000@@ @@@+000@0@0 @@@s <0,ЍO/ a|^|^|^'}^_i}^8a@f_@}^@g(}^0f|@}^dL@}^b@-鶣0@ 嬣 @G0H4踁aO-$M,=($: 1@`RPQPcP(PEܐ(Vᖨ(:$Ѝ0 2p@P0 0000009  Ppp@W T:`ṓ 00JpbdH?^x>}^^}^@0!S@0L4 S00P4 S$0;00;010?/ap@-0`S0@TT!* Sp0XT S`0dUP0SHVP,Q$EO0?pa}^~^@-@ !:0? 00$ 0D O-n0PP04 -`nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  M /FVH0Q   P  |($"(XR#  UB뚿HXH :/JZHD~^at&\i~^~^ !:!/ " A- p@P` X0 X000 0pmЍ p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p踁a !i8@@G-`@0匀pB00>0>0PT0?0?0000?$:=P(8$5?[J ~^O-@ᨐ娀zT:00ЍO/ 06Sx`1`! P$5?PT:0?L0 HS @03/003/ qJ_ 0$4 / 0  ")//0 !Р!/0 ! !/p@-PM>P# @,`5~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍpʈ^P002'0 S#3/^ 0P/^d0qp/@-龪P P8@ 0BS B 00PO-`2`BM<03/ sr DR0S0,,"S  & PЍO@yῧ`Pp 0Sm {@mtЍOgjP;0Q@1į0 00S|F0p00 I06SP<14A@ 0 @1:0 0 0 0^%_^J^k^v^s@-P `0R18A\8At8Ah8A x@P1 00 @Ѝpt0d03/00 `40P0  \@P0000400040@@_/0 `G-p `P /Voj~M0@:0$@P $KU 00<0 0@0$000 0 00@D@4@//C-H0M00p0Z00LP@0` 0%&lx00@`@TЍ p0 00 Z^H# &\A- t!0P0>0\ @X0`@Dp@ f00 jlL0000L0^&\ O-p1MpR00P `PH0 P@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@TSP S0  003/03/Y 803/`J$JQJd$Ѝ00?&\_^0/\0/x0/xT0@-@0 @RS ,0 Ѝ0000x\l0P/0 S/@- ^@LS:0 0CS(0 Sxl0P/0 S/@- ^@LS:0 0CS(0 Sx@- @ =00@0p@-`!P @P$P`000̇@p@i@A-餀`@"0PU | p R0P R 0L  C0$A ܽ@^^7@-Pd000@T T 0PE0%VE$ @ Ѝ00S 0ES:@@0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLdЍ0  00R( 0   0B^&\U^p@-P!@0PS ?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P1 4 X3P S9@A WT00 00p}Ѝ\p@-L(0H@P#043X3 @t3$0S$@p@K\@-`MtP;pở@ḟT 10'*"*0*00(00,00 $0$00Ѝ&\A-PP@00$00u0P1G 0P$P 0P1@ 0009SaSh" 0C023 0tQP0S 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P1c0m' #p  *  P1 00AstaS_S<00SS #l     P1 p `p , * " # -  "$.* P1 `0P1 0\^^11@@p@-l0( h@"6 0T2X300$00p@tPP p@H\G-@t2PY P1ЍGi D0T`R0L0SqRA RA@RAQARARAHRAQA r0 00000 R!Y 0S<00L0S,3d00!C=ryЍGhq 0 P1 UP *0P P1M qP R  qqpx3 d00xC0x00 2@0S *"*0S 0S$00P1 p40Cp4X)ЍGP`k^^^^&_^JA^\^^O^s^\JAX?^p@-PT1P @0`3/P P P2pT1 0P3/T1 0P3/P` PpPP10S( L6m@00;000000 e66P1 뷁^^0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RP!     8@-M` PpP`-*0B8#8S) ' Q#P17 0,00@400300r2T10P3/P184 P1` ߍ-`0u'\@-@8  ➌t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@p@-PT1@0P3/PPX3V P DT1PP03/pX30X3X3;X3^O-MpP'`@ HQ 0pdT10VP1 P1% P1  xccw=wwm PE  p`^%ᵣj̣h P1   858P( PF~D00,(P$  `N`0P 0$ЍcH0 p moQ Q P\  PeL t<Q7L1S /0T t$t L1 H0P!00P16 ?0 X3<X3n?0 X3@0X3X3l "> 1sp3t oP0L1@o 8z"1S0!p3`3`?0) R<pt3 , - p( jt# 0s?`9 Si&i `t`Y!<#ĠhlÄ t⃭X3@W?<0 0? !t3,t 000W?000W tV  0t#n0pS   Sz*0Sw 〵<0 O00000 00,0 :601 00:60 00X0P0S`  9`S nBJQ ,@( X00X0 `@帔0YP P!!0S`ЍJ80 ,,ĠჁ ~R`0ЍOxЍOЍO 0000100000` 080,041 P0`` `\vdndQLAMAA-`0MX@p `P\ $0H`P 40 000p0`0.Ѝ`\R/00S  00s  @o///p@-P`P10@,0`02X0!40T10P3/P1  &P1p@n ^@@0ut'\O-pԙ@ 0 廠`P[xp3Pᘙ1 !)0  圓 0 P▓UR yT1߿P 03/  t =st  t 鿄mt  t ht $ ᏠហtTU ՙ*0t4F_ =0P!0P!0 ЍBA&\'\@-gT1@0P3/P WT1P03/p@-PQT1@0P3/P00>p^0   " ""   00H00D000h0'\p@-2RP0@`2 R0 RL00P0L00P0<0, 6#p@ /0 $^N^p@-P@`Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@pDMT(h0P00 `<0 $0z [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ 2@ a`8@7彐P C2@ @P7寐P80!0d R2  R00p + 2\ h0<(,0040 000$0$ 6哂" 010000S 2< 2p`(岙`X002 p  2( t x@0'x 00 S0!< 80 S( 2@ ŠĠt0S $3/,0( 4_0 $2\ 0 0,! ,1Q 0 @FX?Mb@-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A:G-`@_PP@  ,pX~0S S8 @۩@ D1. 尓 ,/ 408p<003/3 3@ ᝒ0#S0RR00R0S @ 00R80KS 40\ $$\ 0& $$ S ,@ "44Q0y NEFXPi'TDG-p`P@PP 0,00202?Sb40003/S3 PP;yO-P0M M @0NpP00SV000S/=,hPo E000B0岧bS00x2Z4 2  R+00\ [^d R  POW bd R  Q@000 0# = R8*X0 @00R X@000S0S00ąp 0p0p00S ۍ ЍO;Cp[*Wۍ ЍS)`S'pW*p W W| Wt W h0#  8 `@Wzꙶ^]^S^&_^K^x^^^^^^O-|@4MPp80S<0:l=S8z08(QD`V< #" R=~D`08 R){80 S-d0S 3/ `80SOhpR 0pR00 RD $byq< #"0^0<` `00SQ  00  `0q|0 00 00|< `V 7<0 0` <0 0Q Q<0` 0 xΈ^^ytA^p@-P@` PU$p0S \P0 P/ 0 /p@-@P@ pp@-@`P0 @Tp0S \@ Pp@-P1 P#UDP30 P0 0 00(005@$ ,00⹸$嶸4峸<尸p^%^*^1^@-@⨸⦸4⤸<⢸@D^@-@ p,A⓸eg0S8^p@-@P 00P`^g^gQAp@rA- a@TpUʀ 0! $ 0    !g 0  @ 0! T0t l   ! 00 0h0 03/@T \p P HzhzlzD/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-@ZU0` P ^pp z=,z0帢,<zpsL!DH1003/b#-  Ѝ_?0Q R 0h100100100 0-/@@@>^l^G-@p`Nzmf1 0 : 0h0 0$3/UP0V/R $0Sh0 03/P@ h0  03/0V0 ЍG@-MP`@@8u`0000 0 00000000 $ 0S882     㮸 P Ѝ@P04P800@PD00P0t2 X0l2t0G\@`PdPP H p(Lⰶᛊ"p0  ϖᑊ!0  Ɩሊ!0 F ὖ!0 N ᴖv!0 V ᫖mt!0 ^ ᢖdT!0 f ᙖ[4!0 n ᐖR!0 v ᇖI 0 ~ ~@ 0  u$0 Pe0 )e0 _Pp 00 0uTЍ@v&_^^AdA؉^^^^^^^^^(^3^B^X?Aa^|AO-`00@0Q0z P_ PppJ R/U? T2L SARD 420r,, pWp Sp0SpU ׽ QD pW? Ͻ Q!C0S ŽýU 彽 PR  PⴽU p2T SR@PR( 4垽Q ЍPR 叽0Q 0W  兽傽P|0|`tpJO PRS \pSt<j PR @b0T @@"e^j^^^_M^Q^t^H_^e^^^@-ɋo@-Pjd0`@= P0@@d0<0 000`P Ѝp@ЍpX]^`A^p@-@PH` 0S 000 P0D0L0@@D@ p@@A-@pH`P 0S Q D 0 0 00@(U "LT0S U[P @ G-`PHp@0L0<0S7{P,$0 Ḷᠶ$0 Pcc t Xᵴp~oP PݔUٔ ឴@-魈 0X@[A-@ppo0 03/` PYV 0ArcX?0   Q @-0 03/P0S/A-P(Ms@P0@(Ѝ0`P0$0(0 `0 03/ 0 $0 0008q/   0P: p 0 `p*08/0P*0=0 888/P< 8!P r? 8 ߵP (<03/ 403/ҵϊ^p@-P@ 0 $0 ӵ(<03/400 43/寵p@S"@-d}P0.X X%,à1 0")!0 <"#1o\Q @:"@$?MbX?C̀^@-XM@X  v 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X v701H0T@9C>H0 @H0P  0$ 0 0 XЍp@-XM@X  v< H0XЍ0@-P$@\M h咼\Ѝ0X v 0 010408020H0P 020^2p@-$0PXM m`XЍp,0@S Q S 0R,@`X Kv010 H0nTP`  HHX  7v0108020P,@2^\^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P v `PU 09 0PA-@p`0 03/ 0PY4 9 0U 09 00<0S 3/ P0p03/7/PP 0 4pW  7/PP PU$0 0Lc9 0U} ЍA03/$0 EPP$0 0 C4PU# PP$0 0 0 $ 0  dP  0 P PU4P0S ppU 0 9 0 0 9 0ЍA#0 0S $0p p00 00 PRu PЍy^^^ŋ^݋^^^^AA-@`)HqLp@PU  0R0D0 0 TP03/T娲0Sṱ 0P  P0S(0 0TP P0 3/ `PP, PP ꠆z^^A-@00PP 0000P80P0800 03/pP` H̹`0p`0808(0S輎^Ҏ^@-000 00<Ѝ@-1 0 /ЍA-@00pP0 3/$`Q\@    0 03/P t~"`P Xv0001k  1\1\1 R004`V 6/P` P 喹@T :0  03/twyPp`P^^P^1^Mb?^M^A-00P0S@S 0# YPP`Pp0S 00B0P30PU*< 9X?u_0S/p@-0@0P) 0# p@.@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ<@P@@@0 P0`HC-Pp`"Q P 1  0 Ѝ@P@@@0 P0`HC-@P`pQ P 3  0 Ѝ@P@0 }P0 P ` GC-@P`#pQ P !3  0b ЍȂ@P@0 UP0 P ` G@-0000  0Ѝp@-0@0P< 0# p@Ap@-0@0P- 0# p@2G-p0(0S P@P _P`@Q `QP 0S00(0 3/0000@00p@-P0(0Sp@` 0R000 Q0 (03/0`p@]@-麀0(0St@gp@-@`{PU0 p@,0/0 3/Pp@-0@Q0Pp ` 2/P D$ @p 0`( "4`#/ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00@P8p0 X (Co0 Xd000p0$00(h`X0l`射\@P$0 00 0 啃P@P $0 ͭ <03/ 403/Ѝ rZp@- P@@@4X`TQpC-@$0\MPp`x( X  n< YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"QP \Ѝ@ 0b0?o0cS2   $ $0` 1011SX n 010 80t0H0P X  n 01$0 080H`P 0  rr2 6$G-@$0XMPp`x+ 0/X  \n X00,10D <11@`H0$0d`0 0p0 0 jP% 2"0 2"P XЍ?0 SX  ᣤ*'n0$n0141 H0WP @ 0b0?o0cS2   $ $0` 1011SX m 01|0 H0P X  m 01$0 080H`P 0  2222 6$21BP31 a1/G-0M01S`P`1  V~$0] p00 pp0@0*@4/@P PUЍ00p8@@0 4/@PQp1@ 0@0.@PCp@0 =X (}m0od0@0h0l0041(0D00p0$00X0@P$0 00 @0`@ ˁV $0@PG@$0 @ <03/ 403/T@ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB,1P 0<㩫PP4< ḫX (l0$d01S\1 R0 Q0Sj 04PUX  5/PPZ %`1  00PP VU  0o 0$0  p  00lPP 0 T̰YPP< 08 0$0        ppp Go57#0娂\1NX0 3/P 5堀7# 000$ 0T p  pp0P*@5/PP/00p8P@0 5/PP14P 0@0tPP#p@0 ყX ph00@00040 08$0p 00PPx P $0 b@ <03/ 403/U  @P0 0 n0 pc0 0 0 R0WPt# شґXpU XI W01PoL{ <Z ,Y  0S W= X U5 PP5  $0 00 @0p@ 0|W $0yW01,%HάW㴁 X U U$1S  p0P p Y#t帱ZW W:1S 1S !p0pPt1<1p!A?pP0  <ڭ 0Gp00p  0 !020'> !RR p0,  )|0 S01"90 1!(pp00p  0 !0r媭000O^^ r^0^g^K^(\^^ϑ^^^^^^^^&_^^Ǒ^^^1^a^R^p@-P`@v  0 DS P: PJ0 0(0L  rPH TXX~ `[y1ap P0!?A1c L\1j`0P!2 SOp 6^ `'Y`` HLaQ®pP  rD 6H? `':`` HLa2P. T)XX% `[ <0ap P0( ?A1c\1L!4L1(\gfffx^^p@- `P`@0  p `l XpPtHu@v8w`0xya | pH!R0BS2l@p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w}0xy yzasǒ^C-lM@d p$X 5f02XYP*00 0`40 ` 0 0 `h0&hS} `Pbz$0xP 4娭$0 p4P0`UlЍ00S00P080P$0P8PX0 0 3/$X er08,00X0P  NP 000P0 F bP Cߒ^@-0000000cЍ^C-@`Pdpܐ܀\MX  e$0H010 0 )0 1P$  U   `\Ѝ0 1?o2?hpW<UG'p@-XMP`@X _eL0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0a PPPE_oR_0]dЍ$0 X  e:020U0?$0;P0,P,000 03/ `DP0`$0 0Q pH zP0SQ0 03/T +P 00 X d20P0 02PP 08 00@-\M@PX d010 PH0\Ѝ02p@-$0P@ ,Pp 0 .P000pP pO-@`pMP0 0&$0 p0 x 0 pP`\Y GЍ2 0 P00SF$00C 08 S"00 Zf 281 000 0آP00 00 /P ’+0ѢϢ 00 0Ȣâd P00 0廢0 P00  0᭢00 0奢0 P00  0ᖢ HxO-P0M@ 0p`s 0 0 03/P 婫 Ѝ$0 P0 80 0Ppl W 2 0 7P00SF$00C 08 S"00 Zf 281 000 0P00 0$0 P ’+0 00 0t `00 00 P00  0 w00 00 P00 0ѡ4^C-P@$\M@>R`>:pX  b 0@ #0 01020D@H0@P X b 0` $0!01020d`H0@P X b&0160 H0@\Ѝ@A-@M@! `Ppe 0 1pA?!0@P !0x@P 1 4嫨ߍ0 w@E^!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-Bs O-P;s@r9P)m_01naV!n1SK3q9U~o p\`MV v:~86Adsṍ$p>NP MpPW $009[ Ÿ)NPM1 P ǞC-MPprpQ@101Uo0|1 0p!]?lĩ% 0t 0p1l!vr!0 v~}r|!0 ~~tr\!0 ~ mV4ny010ȁ1ԁ @CM01$ F40 00\` V10㨁 t10 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/` PE(_CSewm(/C#b?0E,olmPႢ1  P !  0P00 P(00 000 000\P 000 P (00 000p000\P  \0 0l0 0X4Ѝ@&\@-彡ė^@-幡^p@-@PVPpH0. `@@@DL$0= p@03&\x>00! $0 /Hz 0(0S 0@o/Hz@0 !!/@-0 !@@-0 !@p@-Px@x(P婢 $0dP$0 ,0KO R0(Z,04S00!pHz^B@-@DY0DS 0 ! 0$ 040)^Hz0$/HzG-`0p$0PUGU !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pk10, TP2/Hz @- 0 ! 0^ Q    D $ 10@X@@@HzQ@-0DPTp@-$0D0P !@8pA-@@TT屠@pP!@@aQ00, ,$041 0,=^Hz` @-,00@10CS@厠0@!,1!,0,@Hza^B $0 0!0 00 /Hzhzlz,0P 0 Qp00//{@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S -{^P0@-  d@/  R 0{^@-P`Oj@`00@M00  p 07/PP70q 2/U/,SY 0 4 8 < @ D H L P0 L P< Ѝ@Ơ,P P@ Ѝ@Ϙ^^{%B^^0@- !3 0 !0@- !& 0 !O-rP`Q@U@Tp  q[0p@ 01@U0 0000TX Ѝ  0 @[T m≐<0  Pڸ 2/p[ :^p@-P @@@p0/{A-`0@P0c  p   021   0 0Q000S$ SA{]^^A-p0p` R0P0Q0C 0@ E@s @{G-x1TP@Php L̞X 0HS4,0S 忞㨃 0 p0@,0T`0,0 BX!0q10 X X@ T0 t  @AL ]@AB S @D{Ù^^!^K^!B!BG-0@pPp0  R( & 0 b ` a.`%RP  Q! 0`@&F @{@-(0@0@{ 0#0{ 0#0 {A-P@0B@`Ap0S  A{ 0#0{G-0Pp0XI@0RPQC E` Z +B,B,B,B,B,B,B @ G  @ {^p@-@@0SpP:0 PpA-`Pg8` `p00p 81@ Y0P   8/P 兞Ѝ0t M x0Q  6CQ@ 6AoV0,  0Ao4^p@ ~C`A@-@ 0@!S &BS &S; `Ѝp !S0SP 0SP0SP`p' 0P0  X0P` ` 6/P@0 \` 6/ M0` 3/0S8P 0P  p@`A4/!/!`!//` `! /!!!!! 1/c 8!0/c#c4 4#1/! !!!#!+@-`P g@ P0@00 p0 7/0P fP岜 d`6/0d` 6/ Ѝ@&_^ɚ^^@-2io 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-1p@ 0dP5/0 N ` P0d8/0 48/V *V``U`3V  PΑV010!SV0`4P 5/ P0d 8/X?A-0p@ 0dP5/`P Pd08/0 48/V *V``U`3V PV010!SVk0`4P 5/ P0d 8/Ap@-D00@ !0 4P5/0 , !pp@-T0 @ON04P 5/0 00dp@/@-@ (1(a(q <@Q0 ݜ +N 'NP0 00P 0 00P0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/ Ѝ@04X?4^1B2B7@-Pf *x0Àp0F0FS0 iPg0@T :PE@d0 0S B @DT Ѝ0'YA-0P@`0!0 4p7/9dp 7/0 dp7/0 !!@B@-0 4 0@/@-0d @/40P 0S/0S<0//|0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LpT P\LX` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPpLpITP,Z`N `Y  \ X B`\  ::0:0 & SA-@Pqbp`::S!QL2ML8PpD01 .O-P P4 pჟ0  A ` !@T `pW㊠   Ѝ0' 0R S 2/< RJSQ LMLrD q @00P `RA \ R> SJ @  f r > R"4AQ43 Q!, 8\, ,0@8 @8   ** * 0P0 z @  f rS 2/ma0S8080001@bq^C-M`p~c@p0000z 00 P0 5/PP `ЍC+pL2傟@   p@W ("(000 00 $(0,0 0S?3 XR0Un0" nU]]PLRPLP*00 PPp008/P  1 000:88/P ˜)>0:! 廐P!: 幐P<: R? p@ P 0j=0:* 00 ЍO^^|a^^^^:B0A-SPp @ሀW@0000W0Sbv000S00 0@H 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzh }h }A-1P 0(0C*s`Ѝ0 d0@ L`P pWQ cQ ,Xs`P,XQ cQ0<00D00 87 H0R0 R1 WH01H0XH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 Z2H02,00@008000@@0 0S%40040|A-@P2PXD`q@pWA60@008SQp 0sK 80SQ88   x븁DjXDf< :R!D01 "0D20LML q @T0@0 0s S#4AQ48 ** * S#4 BR4 0R", W S#,@ 0S#,8Q, 0 ,0000001  @ 08 08 @@0 0R", W| ^/@-0*T00@/@-0 T00@///@- $00@/$00/@-@$00 3/$0@0//@-@$0 03/s@->0`@ P  B` 0ŒQΌ Q @寖0T00 P05/P  0 ЍpF^p@-0P L嗖00T0@4`X 6/TX0d` 6/p@b^O-,M`x0@ d0SS0 p(а d0S ,ЍS CS 0C$0P;L(0``03/Pi` 0PP0  (0`P  Dpꅜ^LB^p@-@$0 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ IO0 0T @ ` BT0 0p@/0@-@ .O T A-0@KDqDDa`PU P P0  R00 C1$003/P00P$003/P0` 00p(d0 U T0X 4P5/T0 dPX5/P걜^X?^/O-@,M d1!Q єzd0S TX00 P0H 5/pP X,ЍORd0T 0C?odP2X5/x0d0SS0pd0S @K,ЍS CS 0C0(P` 0pPP3/0 0 0 $Na h p@0 p# h00ꙶ^^Ŝ^Ҝ^^x IB^GBGBp@- R 0@P5/00 \p Wp@-@9dP8 5/0dP 5/{p@ A@-@@s@-@00 P0 5/PP \巕00Ѝp000(` 6/ 0000^O-p0 bԂ009 d;/d0";/0 d;/)`0 d;/d0\";/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/б 403/@C @0 d;/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/ 403/ 0d` 6/40 3/=d` 6/ Ѝ[ [ Yf9d`T 6/d`0D 6/0d`( 6/=d` 6/'O-0 c0 09 dp7/ dp07/@0 dp7/g`0 dp7/dp0"7/ 403/ 0dp7/ 403/ 0dp7/ 403/dp0 7/r 403/@Q 403/T@0 dp7/ 403/ 0dp7/ 403/ 0dp7/dp0L!7/ 403/dp0 7/q 403/@ 403/p@0d` 6/=d` 6/ ЍpW pW ZX9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0  q009 d`6/ d`06/@0 d`6/`0 d`6/d`0x!6/ 403/ 0d`6/ 403/ 0d`6/ 403/a 403/@ 403/`@0dp 7/=dp 7/ Ѝ`V NY9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0 0@d@t0"409 d8/d0$8/@0 d8/ `0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX ;ZX 6X 1[ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`pW 0;@@ 0<@@0dp 7/@-0d@ 04/d@-0d@ 04/dQp@-@P00d`@ 6/0d`( 06/ p@@/A-@P0  00 `0dpH 07/ PP0 4p7/p@-@P0d`D 6/ 000d` 06/ p@`bO-00pS&Z)d`0\#6/40L#3/d`B?4#6/`$0HSC 403/CBPi XASZ` ` Ѝ0d`"6/d`="6/ `㈲ 403/P `V <d`D"6/400"3/`I  40"3/C0@S Z=d!8/00d!`:/Xd0|!:/ 403/ B?d:/@0d@!8/`,,40 3/0S: XZV40 3/0d 8/3/?d :/ᔠ唰40 3/0S vZ4H 0:/d`00 6/ `d 8/'G-P400!3/o>`d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <e000( 0"([)\^&^p@-@ 04P5/0 0p@-0 d@4/s@-`PqY@`00o00 ` 0 6/P 6YЍp@$ wH@0`<S'YHP8008080(040,0Ѝp@@6 0 00$0B^U^q^TiBphBeB,fB@-@[P0S00 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-P 0 3&*?=0 `p?x0@xp.A x0@J4 F@".PpP0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0 0%3?0 00 02000%VP4 P0d/// QX0S/X0@0/@-0d$ @/7ꗝ^ Q/00ɝ^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PEU AڎX?^^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P@`U 0p U ό0S X勎@x0tdP 5/0dP 5/@p^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPpY7Q  ؍0L0GP΍0 d:/ 0dp 7/1 dp7/P0<0#!H 00`@00  00004040P  <埍0L0H00H00X0( $00040(0(@ P T0`^T0XP0T0@`0dp 7/ d`x06/0d` 6/@``p`X0V0C?o20SX0S<0 0 `F:^[^j^X?^O-0@4P, 5/0P( 4`6/P  PX0S   P0_ X0@0S X0<0X0H0@(x X0L U l X` H04p+ <0p 0< 4:/04< ;/ 0 'W0L00 4p7/H0  <0! 0L0+ < 8/04< 9/04< :/H2$p 4 < (p,pLpL0S@0SP0<0aP [PX0S  `  X0L P0 X0<0X0H0@(S?V\n \8PhV C/P` XpP X` `0HP0H0@% V P0S+9`P I YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPhU@Phɋ 0P 0 P05/`P  `4Ѝ0p"GP `0P P5/N02p0ltNP000DXQ01 01 Ѝ虶^"e^j^^p@- 0PQ@ `M ` 8܆U < 0 ц܍p^^G-`@ pX@ 0sP<WP@ @H S0s  SPW/QP QP P Q QPP Q QPP Q QP W U QPP 7/P@-@lO0@00/X0 @-(/^@-[O<1 S  x [V [ [C Y fY @Y 0$000000[   ,03/   ,03/   ,03/0    ,03/P   ,03/P   ,03/   ,03/PY   ,03/   ,03/   ,03/0    ,03/Pi   ,03/P\   ,03/   ,03/PC0 01P000P:00 0 00,p7/ 0p 00,8/0P000} 0Sz 0 00,p7/ 0,, +  P1+ _ 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/Pꠂ  10 01>  0P 00 R0So  ,0   \73/0PP1>  X  X,0   L3/P0S  ,0   \c3/0P 0,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( G8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0 P%6R0P0$0(P3/0P 04 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P0T CRHBBBBBBBBBBBBBBB\04@\p0\08 043/UP 0 S000 ;@p9/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0QP/0C?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0h }`X d,0B"3/PXp\ @G@Q` ,0d3/ 0 T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P0[[n <1QU! !,@p!;!  9/U\0 0\00 00ݣ^@-@M. 4 010K/0  $!(! 111 1014!, p1>  ލ\BO-PYELWy  Q&R4 R(Ly@HEFyQAy>E(1$!:y0aVKO0S0E O,yŴ)y&y`s圃0S y`yVE `y0 S3ꔷBȷBзBطBBBB BBB$B,Bx  x@T`x\0SxD0 x0S  S xxx 0SQ0S \xpP R]Q 8x4x0 $x0 x0 x0 x0 x0  x0@ x0 x0  x0  |x0  wx0  trxpxAv\kxpP QbxQ A Zx$p TxQ ALxQ Gxp,^^^^&_^^A^"^:^^j^^X^^S^h^d^U_s^^^^^^^ۤ^^^^*^_^z^^^^_ƥ^֥^^^^^^^^%^0^:^^^^O-p@Pa崱$!0r0C?o20S (!0r0C?o20SP@ Q= oFP:P7 Q4 fFP1X0S CwQ)woX hvPh G0041P041CgpC/sG0pBpp Y ` ЍLw0 R 80w$w00S*\Th^&_^^j^ 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q E`P 1S PEP(㕀 0S|8\p@-@ 0P` P@HTppA-`PaCX4S @Ttq'Pp@-0@@ TCPPP T5PP PT\0P4p@C@-@TPTP0P4C-@Q4MT4P 0p`  8/P y4ЍT4  0   p  09/@PE |yPT4 0  2/0 , 9/@ TT4 0  2/궦^զ^A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-MpB@h#yp \T P HЍOuy 0(0  RC> 0800P 5/P ^y @ 8$D0<4>`P2帢42 4HVIyG 0 P Q CPP`P$0- PP ,2 ,4$2<0424242$42(484,;/P00@4$0 0S( R !0R "0R 00  1, 04|1<4t14p1$4l1(484,;/P00@4U@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4$0Pv Px0 Px0X4Ѝ&_^@B^^BCHB,^CCCCCtCCCCCdCC,CC(C[CL[CN^m^ 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0C\p@-P`A2S @](Pp᝽pp@-a@0 sP9xPp`PP 011D 0(1S5Q   ~Cl^b@-@h01p@-`PCA@P z P p@w 0t(0 &P p@|0H1x0p0p0@1l0D1@` xL0P0P P%P@w0H102p@B^ (BB^CCCa^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-P`@|4S @᧼g8Pptp@- 0 R\0S 0 000P00 ЍC\p@-Pn@00S PpU@t 0  tOPP xQ tt0x4< 0IPxxQ tcxTPZ(CO-M`p;@@v` tpP  k P ЍOv 0A(P0000h0 00S0404РE>L00 8/P ЍOY04 04 0S E> L00 8/PB4X 00 0| \6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3: 8t `#8;/T=X \S< x `0;/X=opT=``S> 0| \8/~0@-01 0P ЍXE\p@-@T=X PS0@  ``\6/0  mT-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 RT=X \S`PA0@  5/p@0  B^G-BMPpI>U@a 0h#8P$  +PP $R0$=1S 0 # PP t PԢԒb0 T-X=\R ( 08/ PX͔\T=' S  ` 08/T=X \S  `08/T=X \S  `(28/T=X \S ( `98/PUS  `P05/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/PUT=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=\@PT=S0> | 005/0 SW0l l 0.POBߍ$Q $]1CC]ǫ^^#EI\G-`@U=Phs@ X P G@ t 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}<p 0\ R`0P xs G^ P ℻01s&_^B^BHm^߫^a^G-p@ `APCQR  U010! A-P@` 0$ pE\:p X0 A\ ^G- P$`(p,00 N\:p AY Y@0 G V @ AT/C-@P@@0$M,)c 0`Ѝ\P p@-PH0 & @4) P t1  0p@3p\@-@xPt`$0M\p)P t1 0040 000p`00MЍ\G-p0P 6 0`0_)x0@U  Z40 0 0Ѝ0 00:/p \vd@-@( $0$$"6 03)@Y\@-@`Pp<<0$M()(0 00zЍ\@-@dP`p$0MH`)P t1 (0 001Ѝ\0@-P$0M 0 0 Ѝ0BB@-(0 0600ֳЍBB@-@; 1R0@-80( 4@"6 0 ($p@ߴ\A-pP`@|;^ T 0pA/@-j;@s@-P@c;aV 0@ (6/@P@ЍppvdJ^@-o/@-p@->;@R_t1`>p@-P@RoᗰQ԰pt! @-0@( @P/Bt1/G-R@w`PST1S  eP smᥰ1;;`a9P1QY 0 e3`0 _3VP {@@况 ZeG3X?ѭ^U]U]p@-@R_C-T1!0CST1S.fcp@_p@\0S$00v0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P lDЍ0^f^V]^A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 to9<l=D=S3  80 ,l9l=hml]衆3^P^O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P DoT-X=\R6 l 0;/ 0P4xVp^@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+yXT-X=\R0P  5/x0PX0 `n<T=X \S4 h `08/ 0 n蠆^^000 ͓0\SsRp@-Ph@Y1 01  hp@YG-@}`Jᄮ1吀011S #S3P11011S cPP 10CS1hdᡮPp@-@mPV 10CS11Rdp@芮=  @-0=X T=\`S4 @0h /D A-@P`}X= 0\8/  D=S1pWn<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/^p@-]p@1-P Xm= S-<<j=0=G0>03p ^&V] ^ 0!< 04 0 (   !/HzhzlzO-P@`0ȐpW # R Lj` V %0000@@ T Ѝ(^\ P/0 !8 00 (  , !/Hzhzlzp@-@P Tǖ9S 9S 404 0@a 0 (Yp@BX?gfffBD=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0 &=@S蠆A-@p !P`P  0P Q- 0T  \lЍ0A S  ,l 0  ]^^@-@00PPЍ7@-P@@=S 0 7 00009Sd=000 PH=SQ  UZ09S8B@B@B4B@B@BHB@BPBQ Q   Ѝ0  DG-0Q@pPxh0MQ w0ЍQ o 4=3/|7S (~h70?0?h70?|7S 0 0@a 0 (|7S H/ox""0 \  R # 80Yq 8B^X?gfffBAp@-PMM@x#cP00C0S0ۍЍp S;0#0Q0e  Q  QH @=SA a"Q{  Q: @-RX"QN ["Q[  Q* BQ@-\ RE"Q 2Q*2Q-0S00?600 {@2QQ 0CQ0Q 5>8#8So b|T` 480SS`  /  ("(  d@=S d= 0 CP6M0000@=S d= NR d= 6M0@=S d=N0@=S d= N09S >S$Q:0SKL  S* 0C#1L 00 7@=SH0QN0 N P%F*+:iA-όp` 0P@aP 0 `YP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S( S S@@n R 3 0ttg h@Ѝp@S@ S S@ S@@S@@Ѝp5V]Я^O-@lM@=S D=Sd?`< ,0"=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 06 p 0 P 4 0 03/039Sb.030@]  \P303TEW ?9SPOU PU 0S000000C0=_ Z0T(P 0 S30 03/OpPG2 0 נ1t +PP'\"(0傿)R d- 03\ʔ#G   0 崦D9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0(0 501=0,0P(  0\!XGir.d=  P 0 H0 0YXZ Z!0  b 0   0 P?D10=   =0C== S-0u>0>p荂EV]^A-0=@S 3/`pD]U  PP `V|hPT=X \Sd 2 0``6/T=X \S4 h `` 06/  N^A-S@\`M 3` <3 !`0 `ЍP婨 bVpP ;0E?o2P0S Pը   U5W00`pPVPŨ3<30A-MM@p$`PPq`l$A0Vn  V7* V  V @-R ,zx $VG ? V Vr  V@=S0 S0N0D Sg*$AS0N0; S06M05 AS0N0/|#VP+  V* BV X RVd=B @#V  ;0#VV  BVd= 1A 40 E0 ۍЍ \ R\P@-R 6  -4 P Pd= 4S0N0 S0N0 VAS06M00 PrP 0C. P 0SP@-:R .0?T0:@=S >P@=S 9S H=S S S!Y0>0P30 00PPz0 00@=S2Po 9S#Pk 0P Pd P9S9  09Z gPP S9i*F%-? S/@-@pP`,M  @3"0 @,ЍC-3@@DM > H=S  CR)N <G a3@ > d=;d=9)"" 2PP 3@. >DЍC> P@ >[0 l U C3@PV0@0 TP3@ > U DЍSP- 1R >  =H=  S9S `P^ PP0 S 30| Q ;S3 #d`P{0 PP` V@p * !(#~]$ 0d- /p7/@=S/D=S/=G-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> P=0 .:^^XW3XR=3 ,=3/@]G`O-@P@MY,=3/`P0@= !/c*H=S989d=0d=9SCCCCCCCCC`P  ?< ?989H-R9  ;S ږo #}> p ;mQ("( ;px0} 0}20 @9  )%$ ~  d=   d=  d=6   d=  :S0?ӥ=t /9S H=S)> L <H=S $> CN0\ ; ~9S 3   s9 : 00 x0======H=Sp3iYh3f 0>>0.>0R 3;@030)9R3S2T=X \S2 d `P05/Y 9S HQ  9S9tR:k@+R0 0m`Ѝ  H=S ?  00C0S0020ӕ fڮ۾=-  P  d `dT-X \R0 ` 003/ AT1XHd<`T-X \R" D 003/T=X \S4 0h `8/= [0=S0- 0=1@Q PH=S 0 yV^  -%3V]2D 1{]8 ^9^'^p@-P`S4P@@MT @:p0p@-@2@=Sp>PS 0CS>02l,ap@>S 0CS>H=S >S02p@Pq^C-PpM-P@ n`h@P $Ѝ1Y0CYD1Ye 1Y 9 - 09 tx94P@4 =#@=S M\1Y7 1Y. @P#@= S7 9S    @N S 6 4P@3@ @S0 @0 0U@P4P@3@ WH=S@2iii9iO-@=@SdM  ,P #X=\@T͔ \4 h ` <dЍO/0 000T-X=\R0 ` 0P5/P  . T-X=\R @ 0`6/<00p  0P 0t+t%c2 9S2"ἴ'804;[:9S { T-X=`R" D 0p\7/=-0C==0=1 o .& nT-X R$ H 00\3/00` (0P㖯! 0@*4b= 0.#3 ;3& ET-X R$ H 00\3/<0 0` 0 P▯4 0)b= 0.3 ;3 T-X=\R  0P5/` 0p`1)S q S  BS T=X \S=4 8h `P#85/= /3  d=0S P 0=00 S0( 0=T=X \S`02 d `P#  ./0< 01(320@@00` P! (ǟ:|"!(.$΃$ *00! " ( (.@70 p07/0)0RSЪ  5P 3 5*8S00C8u7 ᫇*0 0 0iX"tt^@  `P [ 0_ 8ⷽP 0/9)` V0%.F'K+~Qp  ⬟0H(མ=[)0@%\a= -JZ %,a=0= 0F&>=~)0 S$biP maX }^ y^ u^ Tt l^Vtg^pe^ )pXG&n` K+Q 0 /w0H(མ=[)0#/a= -JZx#"a=0= ဆ0G'>=np S0 0 02_0CS񟗃@#C#Cd#C#C#C#Cd=0d=9S9Stv `43/+jd=0d=fH=S >Sl"PZ 0>W9STd=0S9`S 4Q`PEUP#D뎄 U >^pP>P L 0$ 0 0$ pL-00 02` S02́"0000H-Q0R RJ RD2G  0> hP``:g>  L0>YP 1>#F&U   0e1  ?& 9-22?2 ?"LP0C.>2>2?5?# R #.!-tO`oDcV]^V]V]荂nV]^^^װ^48|^^^5^I^o^&_^}^O- @ $MP( 9] $Ѝ] -)=UT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D= P0D=U_}0 4"P   3PXB  ,ᜬ\0p 00 pp(\H}0wQ R*\0H=H=S10S"t\0H=0 000X0 0d1!42# 0L= \( S0(=v p\0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000 j P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=`(H=S% S% V\H=帥帕S L}dd:9"a0@gt@\Pd :9ȏ"a@h 00.\+( + )+5),|04p@04\r0404043099!= 0 &P ;_:0㠠 0I10S S2 ԊJ베YH0D PG0  SBQQ Q"< 1=0:H=S0 d=  0 P0 d0מ0d= d-H-R' R R;P d-Qb?)d= lQژ0d=\3Q8<9 9<9< !S:S^/d-P-R2R9;998<9 9<9<  : (0 P0S909 0 0x 0 RPl 0SiڴyX +>02 t=$2(x=6=⾀ᰀ:aK὚44=4!8=141:1:141=1=1=1 =|M@p1X 0>9/  k>pp1a  8b>p0T8<;Kj>0d=$1R| xH0P-d= 1R9 <9 p@-@&P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002帟ᚙ`ὧp$: d0@0005C<4CEC4C`5C`7C - 2X>00`V  -P 3<300 UHGO-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S 귵^@JCKCLCKC`9Cϵ^C(CC,Cp@-7@P&pp@-*@4P PDp$0 0!0 00 /Hzhzlz@-0 ,0@/@-0\ @/@-00l@ 4/Ѝ@-0 4@4/@-0d @/A-Pp@`T d08/< S   S Co    / 0 /8$@- ? \p@-d0@#0?HnPe0 0110  00p@蘒\hp@- T?P@H1`S fP 0 p@0/p\hp@- T?P@H1`S HP 0 p@ 0/p\hp@- T?P@yH1`S *P 0 p@40/p\G-,0P#0?[H1S@ P0#`:Phnב0tp000!1-1-10-1-!03/0 P1UP!؀0!8/10C1101G\@-~M@ᦑ P` ޑ880U VA0bOЍ虶^^ݵ^@-<0DT 0 !0  !0@- ! 0 !G-L1@pT`,A- (\0@ R'3/# \03/\0P$3/00S "YZ x0| 00++R4Sx00x00 1 PxPh\0@3/ PU`0 83/00 (P 05/ЍG̀H|8_I0 0 0L \00P00T0\C(\CW]P\Cp@-@P 0X %S  05 0pp@-@`P 0X &S  0U6 0pU 0\00`00d0p O|\C\C\C^ B/o P" RA-P`P@& p@" p@=@OP@ 0 ??00??CS0cS@@-@`08 3/ `0$3/\083/P\0$3/8-lM 0 f lЍp@-81@S@00tP-1-!03/03/81SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p0-181S-1P0 0CS-10-1-!03/*10*1*!0p@/A-P`(0p9@@ 4D1S H!R 3/0H10@ 0 0 0y`P 0'0 P藅zښi ⵏpH|_HX] *08'1Q0@   D-1/p@-@x`tP03/ `V81 0CSp03/ 0 3/p@d03/Pp@-@tP81S@  03/81S 03/0 03/1!03/81SS/10!tx4``8 #86/,!03/*! 0+!3/0.!3/81S t#0\` 6/t \`616/81S*!0@ 3/ 03// 03/*!03/0`1 S 03/-!0p@/,!0 3//!03/0!03/,1Q@00,1&10/!!R !10!&1/d21S/*!Q00*1&10/!!R !10!&1/O0| 00Q  Q  BQ*!0 &10/!!R !10!&1/*! *!*!0*1,ltG-@ p?p(,`PP H1SPЍP  0$P 05/pP 0  ۟pP1T 0@PPf00ᢎ^1TJ t1T0CT 1 P 1?A3c0@\\t]t@{t I1@Xt@jt@mt1(@1(Mb31S/ !t       000 `0/p@-@^`׍ 10 1@1  ``0d 0 `0d 08!@0 0-10BRS-10-1R-1@0-10-!t3/D1Sp3/0H1pp@- ?`P0@ @003/'H1S P 0@0Sp\G-P0`#0?H1S@P 8!(pR' pP⨏YȀ6$0( S S00@ 0990`1S @1S bpP,@ %,0B 00351 p"  4!  *!?   *! +m R*!4 1!4!0)1(0S`1kS*12!0k8!0GtpR/1v00q R0 00 (0KS0ږ S~0A0R.1.10.1(0\1`10@1&10!!RF !10!&108A00 1 10 10%1t 1 10 181S'000003/08m#!Rj #1fR*!1!4 *!*!*!  }S*12!0*1 0 0 0\8O-t0 vpTM`? @PpTЍ0  1S P P0 pxP 0>P0@0S`̐@1S 3/P ,0Lp40H1`0d 0h0S  ܂0` dQShP0 h00&0-1@1 -10-181S-1P0 0CS-10-1t-!03/03/'(> E !, *0$@=L0K<1h t0L L ,0H 9,0,08,0,06,00`1V1810<1t1D1ے  111@1 01 10 1  6 0 +pP0  03/pP3 0@00S-*ⓋaSt Rh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34WJ\U^MbIH|+8X?^p@-0 `"6 0?H1Sp@sP 31S ^JV 1  10 ။p 10 10%1 1 10 1<\O-H!R EP %!PR %! A(0q 01pBR0  R<" 0"  @W`0@S @DWc AN!  BR!V: !K !  !-! -!8!R:-! -!90@`FS AV    R<1! 0 03/p !  !  !0@`S @D` BR-!`t6/ ! !  !ъ$!R ~$削'a(A(Ċ5!@ 0 2/4!  #! #! , 2/"!R "! $  h0A౧0,0 ЍO/ Ѝ8X?`CO-H1S~ @kPy  tPD03/81` SP4f03/\,!03/03/`81 S 0S @0P 3/10u03/ 5 R $ Q Px |  Q $R0x0 x 8!R0 !e `V03/03/`h0Sd`VI  Ѝ3/0>  3/,!0 3//!03/0!03/,!03/ 03/t03/ pW03/0p3/ 0I0 3/0k,! 3//!03/0!03/,!03/W0 03/  &1S 0!&11!aV 0V`!p0!7/10C110103/`1 ᅉ%1$"!0 o 2/<20S  $0 R Q x0| 00 P04S x00IS 0x003/ Y 10%1 10 S 10 1 Y 10 181S3 0CS-100-1-!03/03/'at!`&`'  و)! (! (!)! 0110$1-1-1 -10-1-!03/!1S0!10"1^ej'H|_$^Z^I@-@M<4@A-p@ `0S @S0C0\0@3/\03/\0P$3/l00S "SRH x0|00Q4Sx00x08H|_ H|A-`0@P0 p0 7/pP pzVB `0H3/ cpPKP 8 `8/ `0<3/V `0(  (3/V`0MC <3/ `043// `0,3/ `0<3/ U `0H3/ `0 3 %pP V8 `#88/0FS `083/ `003/`08 3/`0 3/E$`0 3/V@  3/ЍC-`ph@(h z0 `PP 404 x (lpph`t ЍH|_H^C-@0`pMtP0 0``(G     4pol  i081@0f-10-!3/tF>P0 | Q S*  S  h LH60S t0h,0P PD81 0CSt,0Sت 0S0@00000810C S񟗽@CCCCtCCȌCCCC(C000|e00 㸪0K  XHG0  0D0KG֑454eAl1,5Pp1$5t1 | 0 1ᖑ *10*1@ 6d#::d`0l$  $00Gt 4@1S0H1T0< 0Q0 Ѝ000d00@000d00000c00000 0003/c000 0003/ct FPt0 4`x6/  `R006/(cZ0 006/ cR0 003/d03/Pb03/Pb`0`0081 S= b81 Sx03/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ > < @000;0a>03/ 03/ 03/03/P0,, 03/03/0P 0     0 03/0S` S`0 3/0@S` 03/E&_^~^^^܄CH|_^'^Է^^t_C8qCyCHX]^zC^^(^5^@^̷^a^M^ֶ^^^^^^^^0@-@PtM0 0 00tЍ0p@-HP0S p`@f<P 0ST00pH|@-0 0 t3/p@-@tP 03/03/pp@-@^Xᔅp@-A-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0 E03 \P05/2 ,P5/2P,` 6/ `A 0@S! A P03\` &N6/0 巛`xp0 `ʛVAHA$P@ 4A0P,A#P^'^8^2C2CX]>^G^#T^O-P \h ( ` ,@,4/ R@ Wd0 0 ,P5/0D(0@0O-P\h@RpC$Mx102c000`0 00Y PP 00$10 0S[Ѝt0S 3/0 \$8/ 㪧 ,0,3/[ t0S 3/0 \`$6/ 㒧 ,0,3/ 0`S  d0 u}0X?]^\0O-M0Q05ph` @/ t0S  3/0 \$9/ T0 ,,9/t0S  3/0 $\:/ > ,0,3/H XPPYYP 00ЍY t0PS  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PP t0S  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PXO |0 3/}t0 ,9/p +40\89/  |0 000 l0 X0+ $0\p 7/0 ,P,5/p0 r 0S84 t0S  3/_0 2 \$0:/ + ,03/ ,03/ ,03/ ,0 3/<0S ZP 2"0   X?$0$P 0#! !0 1/X?MbG-P\ `@0h0p@$S T @@p@0 4/Ѝ  \`8V@0\t$1D 00:/P@\' S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`G-P\ `@0h0p@OST 00@0 9/0P@T 0 ,@ 4/Ѝ  Q`4VIX0P@PT`E0 0 8/ 40@DQ T$1@00DD9/0P@T@$10 0DQ& S `VI0P@PT`E0 0 8/ 40@D@0 4D:/ `FS `@0 4D:/ `F@-@pPa}`P> 0 , Ѝ@A6 0P A Ѝd^o^R0 R R#+ H@- >@@#+## #/#+## #&w}^^O-\0@@hpLwP3P p@K O ㍤  P |0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ <"0 , ;/"( 8"0 ,$;/3- R p  34 8\ 0 08/0 ,8/2 420,8/", 4"0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 03 v3 p0  Ovu 0 0 0@40 \`86/ TG-P`hp7}|03/8 R@ <0@@T@R 40S0@ T` ,  l @ XN@ DH@@F@p +\0x!40\8G/Ὸ^߸^^&_^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@`> 0p@{P,vP\s 0T L0D< 0 0 0 00 0h0 03/^ ^^^/^O-\0`pQh@P t0S 3/ 0\$;/ p +40\8;/}0 ,8/p +4 0\88/ Wx0S 3/ OT(0,0000/@-@0\thA-`p#P#@{X0VP`|`hp(|V`$|{##C0 RD   R8  | R, |  R  X R X RsC CC'\C@-@30Q !@\0@00A-`"P@0S P 0q@P XP?sPp@-P@sp@p@-0`@hPP 0 \00 ,@,4/pzP 0 0 0 0h0 03/P 00 0pp@-@P{p@0,uO-Pp@-04{Y 0 S0 0 ЍO 0 `P` Ѝr@P`  T0 P  0@@T^O-@MphPG{ls`P ߍO@{lP! \0W%p  P@<0 R80S@p<0$Rt {š80SOʅߍr80S<0Qt0S 3/0 \p$7/ 㨡 ,0,3/p<00St0S 3/0 \$9/ ㎡ ,0,3/<0 R@ 8 R4S@0 jw0|r0Sz<00  z<0S( 0 wP z0"Ewz < wP z<00 Rp    z`mt0S 3/_02 \$0:/ "X0\ :/0 \:/ ,03/XP<00 ,03/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 073<3$Ѝ 4à@  P ^8pP pP#8 㱞MbX?DCA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`w 00 0wPP 0S  0  0` it08 _tU P 0,q p@bqk^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/@-2 \#9@0/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@(@Đ0A\ py ЍX]@-P`p@(@Đ0A\ pky ЍX]p@-@P0 \`6/ݝ 0 \`6/ԝU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&x 0!d!0    !0G HzhzlzX?7@-@ &^80202020 DR2|0@4S0000 v2S " " Ѝ0@,ȾCCCC2C2C@-@ &@1w@-&wPp@-@P&w2020p@-@4@SS&w 0@X?@-@&@w/@-00 x ЍX]@-@8Đ<0\ @/@-84< ,@4/@-00 x ЍX]G-p@d尐PV㬀ʀ 0! $ 0    !&Sw 0!d!0    !0GJHzhzlzX?7@-@&^ w0202x02p0p DR2h070000 u2S " B" Ѝ0@pCC0C,C2C2C@-@ &@uv@-&vPp@-@P& w2020p@-@&v 0@X?@-@&@ wP/ 0\R/@-@ 0^   \R@-@0U. V? 6 Ѝ@<5r^^A-PQ+ t@pT'+P &P s`0d 5\0 @P 0t000 5^Ѝ@ֹ^ڹ^^ ^^ 0`( "4`#/p@-PϠ ,@ / p0@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0Y]@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .( ߍ      0 (p @0p@-@MP `y  @ @@ @@ K }zw t.   ܍p@- Q Ѝ@-@ DЍO-MHR@`L @, B?<00p (008 <040,0$01 @L +!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@ ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00! X ( S 0 N 0 p$008,0040< H @L B8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@  x  .   ܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.` @ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.`F @BߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

*P0&4#000#0PeU1! 0< <0  P `F@0HV@0 00o`V 0  @02 4" i0<0 Ѝb+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0 `pPU 0  %$- @00 

0  >2  >2  >2     ލ0 0 000 00pG0  |0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:[OTPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/L00 0/LG-@`pP0@M 0a800,($@ @@ @屸008 <0a,($@ @@ @墸T00L00000 000 $0S !&.LqPP &> 0S !&> @&>ş 0S " &> 1P0p0 58/5 0S !%t;P p5 0S !P5<< $ş45 0S " 5 P0p04 8/؄0 X " $P P0 PU " 0\\ ҵ0@ğ 0S " (  õP0p04 :/0 Z "  P P0 P U " 0xx ♵0\ß 0S " D< ⊵P0p0 $3?:/ 0 ?R !P 0 0?S ! c"0?X0#00tl VP0`B0&.088/&.hP &>0 @&>/;P&.00!08/!JP 1 "1!P&.w00l!0p8/T!8,P <1@$ (1 ! P&.Y00 08/ P 0 0 P&.;00? 0@4/? HP ?0P4 ȴ?0 $ôP'ލg]j]^TS^g]_^g] 0@-ALM0 P0`5/(@ @P @0 ❴@ 0P00 (p7/@ 8P @0 ∴@0xP0 (P0 p7/8 PP 0@, sPLЍtl]Tg]п^Tl]޿^Dm]^p@-`@pMP嗻 ♼ ╼`a R ⍼@Tؼh <pЍp07@-7P|@~ Q@00#47 b0 P Q0" Ѝ0r00#4p@-@P`\08M 00 00 P  8Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-pp0MMPSrX@`P `ߺ0 (`(0߻7 `ۻ `׻`% N 7 (XpWIKp ⹺7 (⻻  C h7 (dh ``⟺0 `0埻7 `⛻`p 0b"!4b4# 0(0 7  (p0h 0p0`7 3Mߍo7 (qΏ ( pG 0O-MP$0?0AP (0p00l  07 00010D \n D0Q`l7D\` R 婰@hR 0T ``Z0  ( l7 ? 0 , l)0l P0Y R ``Z0   l7 v0 , l Y  07\S0lpS WPUZO*ЍIn]x]p@-l@P  c ,ap0@-,M@P0$4\0  s _ 000Z?,Ѝ0<^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pP`4A#T , LaT@! PU,QP N  0 0  0< 00M  ,QЍG\\@-$M#`||p0 J;@P D0!4a000l<  $Ѝ<\0@- $N@ 45D\d7D@- Ѝ@- { Ѝ@- Q@W 0 0C 0> p@vW }p@-@P0W 00 0p@jW$}G-Ѐ`  FRp@0PP03/PPV0$0pPW`'SP p@V(0$ 00 }4}X?FDp@-\@VPU 00S @P@Wp  }(}^LG-RP 0$ R\ AAR3 RA @ 2RW _2C6CR00U0P@  00c@e 00C`P 00@|V j@`VJPAV@T &000@0V< AxVPU 03/@P$01`0$0@00S $00ꠐ_VX@D` `@|0 pD0S0W0T0SP`@`  p@@ww w(} }\$}@-00@T P@2 }^/@-S 0p@-PK@,P^[0 0&ph}p@-P7@P 0,`000<00@ h>7@P P+0 @'[Ppp@,$p@ݹ PDRD`QD^NDa^:^@-0 ,0S s<00,ҹX?@-qO- Ppp`0DM$  0<00,(Pp`@Z <0400,0<0 0400(P0$p P`EDЍl^^p@-P<@L0,`P@00 00}V$_  p@V&X?l^s^^h}P/P0/h}@- 0,dX?@-0 @  00%P *P `sPP |%Ѝp0 P 004P0 PP$y%h}^PD^^4/0|'RI032dX 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P(0@Tp0S @p@-@P 0T 00Q 1S 0<1g2$L2:1S!!1! 6mfT(0003/p@a^}^荂 0P 0CP@@d #/  N @@<0P 0CP,0P @#// ̇?0S@- c. QAAL0QD80Q Q 0  )2$2{]^>^ P P/  N /P PP0// p@-`(P80@Tp P @p@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P8P 0"pC-wn0@S!p !R 0h"0d ЍQPLLR厏10! R W  0 S1S 0! e 0! R W%!V V0 S|QV& K  R 1V6S1 !/ |(|Q=|$c V| X Q VXXW} WyNxP qG pMNv V|X{]V^}^{]^^O-p@0_2 0iP>05/cw^ `0do00`0S PX 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8R0S00d0Q00@Sg/1!t1153J`!01\A  1ES  0310@0/1S01 ЍO16&!6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,g01 荂^{]}SD^0.R  "-" R   wP/P/////R^DX^D^D^D^DX^D^D0X 4\ !8/P x7S0S/{]O-`@0u_0Pw>0S4 0!0p'눐到0S| @TP Ѝ P @  0 0W   p_ ^^^&_^^p@-`@PPp@0!0/00007wnS000q 20|7S S S0< 00CS`D`D`D`D`DaD|7Sx8D!0 0<00;080p0808070B;0;}]$^O-@`p0TM^ 0=0 h  qw>pWzp{ 3 a0 hp7  0 hp7  0 hp7  0 hp7 0 hZK0   0P> 0p nhp7  0 ehp7  0 \hp7  0 Rhp7 0 Ih0 0RP 70A \ 0Y0 SZpp0S (DShY 0 0PT TЍ `P( 0 S0 `` hp7  0 gp7  0 gp7  0 gp7 0 gp}]@B00 S   P 01@/{]A-P@P"y.\8 8S+ S! S w~ⴀXa` 0 SD200S020R  ?PbS S    00P Qu?0XP `V0P/ P^P2q?0^ P! PQ000 P` X#0SP`h78h7JK400   ` ``0S 'P48S|74XS 00|g6 h78}]$^J0000 000/s@-X 0@^! S R 0 0S0A:1D!0CR< 0 D10D1! 0!0 0 0 00 0n\ SЍp D!R 0S00 000 R 0D10CD1! 0!,0 0  00 Z^^΀\Q: / AA!  ////p@-@8 MQO1P 00#!" 0 0000 `0V :3/P 1 0l t 10 18003/@ D08003/0<000 Ѝp^}]^^~]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::~]}liDiDiDiD0S 00 , QQ  /}] ^}N^0S 88 4!RR    !/}] ^}N^P0P//}QG-@p ڐ1 0" $10$1Ѝd`PX$1Q2S(10(1("Sh 0O }-X 1 0! Б p7岠`71 0! `W p71 P!l `80S0S `03/P 1 0  베,10,18003/ 0`R ᤚ0 9/P 120!S 0! 0X x W㲠`0`4!S 4!n 0 Hi h0000~]^}}]^^u^^^%^[^{^^p@-@P:3/P:3/p@-@:3/~:@/G-8p(MW 1@P` ᴐᲠZ0 0#!"!0  03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/^^D~] ^D^C-`@ 1RP~P1US^1 $Z0 0p1p 000P Ѝ08 R<<N  0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*yx@P  # 0 3/P Cx@~]\~]j^s~]^C-Pp(0`S!R# S 0@ Ut0 0R@@@N@80S*4xPU 00 0@ Ѝ (0 S*!R $ $ $03/P~]^~]/A-`P@HM px&40%WV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`MO 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p +P`Ѝ~]^@-0<S !  4 0 \ Ѝ0^~]<@-@ P0@00~]/O-P0 @$N$aA$P 0[ CpG  _ pGW `U |O v0 G$@$N$aA$0PK 0Z  KS%P%G$P$@!@d!@!@0!>#`1# $ ( #$0  #(#< 0$Ѝp0R@-P@0  <0`101(0 0C`  &ЍpG-R@P<M0 % `1 01(ppG0G  0fn P 80R %Ѝn$"P//O-<`@ P1IM 01p 0  0 0 000 S0 0_>1Q X 0 0>0SC Dd(0HL@@00C pTS0!@D0\pW)T* `1  FS0 :Y  ZIJY ^ ..!.0@P^ ΂ a\aNL^Q !^UIߍ脅]^A-0@`1Q X 0 0>0SC0 (@ B@D0R !@D ^P+T, P1  R0 &IߍP(PQ !%^QY00 ZIQJY PP^PQU(   PU@T00q^qENQUQ!$^]p@-.0( 4?L00L0S 40040Ѝ, T(0d0252 5n$YX0Zp0S1 <>4.Fb0|>!\D00D00J S*1 =-Fb0(>!GL00L00S SꨝDD̝DTDPDDDĝD2St *Sp 0S ! 0D=D-HP00P0S0Pk xl00phQ1 <,Fb0 =!L00L0yx7S 0450!0P0C2X00Z0Q1 <<<,Fb0<!L00L0Wx7S0X0Q1 ;+Fb0(<!L00L0@0`0H5Q0[0 1 ;+H00H0Q  04 8 <0,S0S P |0S! *0Fb:!H00H0l0S1 :*Fb0:!wD00D0 R1 T*Fbd:!eH00H0X VY1  )Fb:!OT00T0YQ xQ 1  )Fb9!:X00X0A=P:1  `)Fbx9!'d10d1xW !/ A&V101<00<0101|7hwSpm2Sj W   kPd d7![0R 1  @M[ 71pw. h7R7!66h7[071?%0#  1  @M ?qw>0S㺟)  ;5?|Q 2  Pq<`0S ;!0:1h7 0 000T0 )08W l7 U#l78l70 000T0(5   P! T $P 0P`00 0P  x8Xh'* 13/?S pT0D$ dh|g V 7S 40040 0 RY-1 6\%05 'D00D0BP*1 5 %0X5 L00L0P 2P P00S ! $0L5 H00H0pZ1 5X$04 D00D0_0 S ! $04 H00H0NS x R6P 1 3  6`00`07h7 1 3p#03 `00`0%x8W` V , #`pW 1  TL, ;0 00 00E 1 2"02 yV )% P   I#p0P Q5/1 HR  2"0, T2SL00L0㸑aἡ  @5L 0 `:S  0 3/P1  101"-000|7S0 Q85/h7 1A T10T1!l00l0|7S0 Q5/Y 1 000! 0 C c ! 00 000 0|Qy`h0` UA^Z^^^^^^^/^H^X^p^^^^^4^Z^o^^^^^^1^^>^i^^^v^^^^^^^ ^^ ^S^@^J^@@m^^E^^^^ ^^$^^^^^^^^^P^P^^%^^*^^U^0S20HQ! 00C000  10000FP Q1 d10h18!Q S ! 010FS|7SD8DDDDDDDD! 01!7S !P 0$28V V㐁C  $2$"`0000P  30#L3ih00h0L3  TJ bm 7S-V) V7,P 30,0Z 1,$  TJ 0 x@x8W<10<1h00h0 1 3/zP  ,0 Q5/1 5%`k000Q7S 13/Y 0S! 0|5x%000|7S` h0` |7S񟗹8D(DD8DDD`DD8D! 0 6 &7VS 000x8W   pP 2 020Q5/1&  TI  0S} z2 7VSZ 1&  TI 0 x8 W<10<1h00h013/S 1 3/L1S 7'd00d0|7S=0 Q 85/5|'R7S 40040* V0 0,IS1 (8(Fb08!L00L0xP 1S 8p(Fb0`8!p00p01$01400S"0  0000$0(0( 0A S*1 9 )Fb08!YL00L000S0 S  S  (000Q0S!1 9)Fb09!5D00D02S0 S ?P MP 0 0 0 00S! 0*0FbP:!H00H0Y1 |:x*Fb0h:!D00D0w0 S! *0Fb:!H00H0eS RNP 1 $;Fb  M`00`0NW1 PS  TH xx;P0j 0 00t00t00Zh7 1+  TH N 0 Q5/%000 @ D )$ `0R !$0d< 0 Q5/n%000 V 1x, <`,0 4S !0< A(0@ (0P 1  =8-p  F  Q (1X d=D<08 k( <0H ( 8  XB ( 3i`F1  0`=> 0>  C  !``$VH,> X> `0N 4P 8P < Sጾ0 0C?o20^3baE0`0>_ >!0>U i V1.N ?`/`0 4S !$0L00000h 0 0[ DD DD D DD 㠅  P 1 4oD$> >000c $P$Z 1 =  0 =  0SG Q1Sx=X 00 0 0S8x 0 $0P 0 P 1 $ 4D0P HD< <P0[0Z0S  P   PPj 0000I|7S0C00S0S !R 0;0X909!5# ȫ" ##Z#\Q ^ Rʐ 0  0 Ph;h+j000101%0S S S;`4pl!0 l! 1*  :*00 0~4p00p 00(00`P 4bP 000 04 00|7S.D(DDDDD4DY 1 :*l000 03  0   P1 909R0000pY0@ h71 \909L);$00$0101Yx8U1 90@9(%000 00 0 2S1 808|( 0 a6/ 2" p0 S!-0002021 HB!= 0S!-00C02021  HB!= 0{PQ1S} 3/z1  HBP1 `f HQ 0SH1L1 P10CP1S0 900S000000 0P0101B 000 @  0c0p0  |00q0궱0 $000SG X`050倀05X 0! [  ,0P,0  P `$0S 101`0009](^(0Y0 0(00嶱 pY p|W0p 0S 0080 R ,03/P1 40$4101000t0p0S*`pP0pz  H0SX0SU0SR0SO0SLXIF\I0 0S`B SE SLX R00 4(40$0[46B` pY (  B8#<40W0p2 2z08#S ! (  0"3F000101F\L XX `Z8 \`P`000(00@S. 1 l20,"|200000101Q\0 KfR0 , [0, H0\00Z000CC@0 [`P_ 0 KfR00S 0 [0$0$``n0h'?o2< 41R (00(0101 h10p!0h1(10/1!|7`S h7 0d bP8Wi 2S30602_꠰^^^t^^^Z_^^^^^^^0^^^?^K^W^^^^^^^/^A^^^x^Z^^^@^^^+^^X^@p0<0(4*R5A_0 0 0 Q44_@hQ004 p0/004 h[ u0P " x(S OW@lЍ  ! !B000Sp0p0p04 R S 1! 00 0. @X Xh'0@)4t0 0 0040a6/4^|'R42 H(p7@ 0  l0@ X 1 2"02(!.40040h7 1 202"$00$0{04 \Pq 40 0@00p10p180080|7SA00S<2S1# 30#3D10D10 a6/% S   03#H10H1HaV1 H?, q L10L11S 3/0SL1H100PHPX1  H? M1S 3/   H?0 ;09000000 0S``0` 0001S 0 0x5q -0@-@PM0 0 PO? 0Ѝ0@Ѝ/l^0000S0004 R 0 000u/@-0@|7S2S 000ЍA-`|7@S2Sg 0!1Rc 0pS\:P020100010020 0083/ ? 071 0!!GR # D1"022222221 " 8, " ZN292S988-#87 0C2c70r0Q   0   04Q   0PP0C0Ѝ3254{]A-P L0R8pL `@W|'R"þ(R# #0 83/G?G/ @0?@D00Q0000L00 ⟾00 R  ◾001H0G-PpaFđMT> 0 Xi (  00 4S! Q0 000Q0 S0#+   "0 000083/? 0? 071 0U!GR # M0S/S10C1ߍ (>0( 0" R 0Q   10   0" R 4Q   # P0p`F@{]p@-1BMS@BߍpP` @P  `P 0,ቩ0Q  R ,!0 R1Ł!@p@-2@SP 0aS 0 6/p@03A0AS@-@e ɽ/C-@p Ax8TMBRUDDDDDDDDDDDDhDDD8DDDDtDDDD(DDDDTD\DDdDlDDDDD D(D|DDDDDDDDDDDDDDDDDDDDDDDDDDDDDh'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍC)7h7#20h70#8S >!0R1ā!!@RPPa|4V@  PP` 8. 0000000Q<<0u 0 0000P P'""#"0 μ0S00 ż000U T@ PFVQxc n⯼ 0 ""0 4xW %_o`/R χ166S1 000P U0!01S 1|P% TЍC`TЍC1S  PPP  `P 1ZS01ā! BWP2괁X 1PP  `P 2 01 SP0} p l01 R0PUQ % `,0PE("(!p7 0/A0S 0(( %=>000Q|DDDDD00000r"N90r":9?o2|N8z?xh728s"}0p:S| (0TЍC/]D$ Ѝ@#Sq$#$y ޷7S 0Nx800x  x800008#0(80?7Sx 3  ~0+wx7?o2!V&R! !!!F" 0 S`|``8x3/`3C40|70Y ⾺(r w>02010?0x8D!0100"]00 k"]0h78h75^0x8?00h7#2^0n^0`P V C Vჺ@`U0"0u"]0h7=$`C000i;0X 0  gL 000Y*-OH$DG- M@h`?#\(P-`P  0<R&!S ((Sp1>: S  Sp&A#`'S p, BSp'S?;C0CSLDD4DlDpB!Sps HS:Sf S p'SW0S p7 h70h7? S* S}  S|7S pG  }x'W/o"  6R| PX?;CS񟗧DDDDDDDDDDDDhDDDdS[ *,AS\S#R @0SC00P0S Q>⪎0pⲐWC嶠C 5 ᤹@0Xp8%S BS6 BS  S / BSZ|7SQ cP> 13/8L%S r SE`=0W SQ`4#=0   (f03A0ASW)0S&!V&R! 1?0|8|7S3A0AS13/4P` W 3   R< G" ЍR <3W0SDDDDDD(Dp'  |'S|7 x'Rp' p' W0S08 w~0S 㴀u?0X  R0\ Y "q?0Q  \ W "= s W "= m W0S p7  h78h7|7S7S03A0AS7S|7S4`xh7u  8h7q  h7 A ^RD0Sx( 0•>h75 0oR70S.0‘J1W/ W?B0CS)"= >W1n00S0 ‘V1PP6P 00 S C  RP0-% EOO-?@Q`|M? p3C>6CQ m3>6Q  ?QK 70Q4  |ЍO9h?Q0 00 0p0tPPFx0@FS8DhDhDhDDhDhDhDhDDDpDDhDDDD(DEhEEEhD<EdExEEEEE\E|EE,ELE`ElEhDhDEhDhDDEhDEEEEEE E EEE EhDhDhDhDhDhDhDhDhDhDhDhDhDhDhD E$ E=Q  =Q F0Q0 0CS34PP=Q7S|'R h7   h=Q \ Qa T=P=QL=|ЍOWa0.|ЍOSB=0SVSSp E E@D@D@D@D@D@D@D@D@D@DEE@D@DEE1S S Sh740 03A0AS]7SZ4Ph740h7h740@S+"P( 10CS D(D(D8DDh70h701!x8 h750h7h750h75!0B8#8S"= Ñ PO1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P.!h7R00h7!h7R44!@R8PP<0 SP:XM=0S|7Sxx⦿ >P J1P|Ѝ > _ pP[ :3/ 0= 8 PP < `R # $"0 # < XጶW >  PP 3S>ñ:3/W Xop᚞!Rh8NPP8Q|7SxHJ 9⬼Ppo 9  @PPQD}`!*R<8"PPi80SS*1|7S.9 iR B0<yPP# P?0CS|7S < @P 80S$ < |'R R0<T0 S < @P 81#3/ 88  |7S PpP P, !PP x!> 4U !h7R 331Sh75h7!R R R5p|4z5x1S p7h7:ph7:l!h7R33f!h7R22p'P 502 10h7EP!0B8#8S ȕzpt1S7 Wp7 WP pP W [ pUPY1SU$ "0pN!0B8#8S ȕhF!18p7b1019q W8 PPd 8 x7 ?o2x`QQ 6P  x@Q @A0 S |Q80 Q_P|X x0@`P|V` e 803A0AS7SP U x01@0S S2|7S cPP  13/P!zR8PPW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U PP 03/P Z0U 03/!R8kPP 8 5 0P> "'wp7t  d1/@0SX1X  &%-  Pp E E< Ed E| E.  P E ET Ed E| E B"P9 919"d B"0i9790 9100000 910000iiii9ii:ii87ii8i(o?) D]]B^* *]{]ɀu^hzlziHz0 9100000 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201:!h7R 0 0h7w>0S108p'10!S"-08H#8,C("(R! 8PP 8` V#=0 B h9ⰳo! 897S (#8 9⡳! 8Px 8  0BS !R r39S0S0 p Q ARQs0W@ 88 R>Wp:3/Pᚾ0S 0H pH0P,PpW@:3/U0S {@ X0 0CR00h'4PS4400Rh7{ PP u0 0H80"-HxP h7~N#2000@000S@@W`" 0yPPK0T0 TPP B > 0S p7  h7 ;h7h7 ; h7N50000> 0 Բ $!h7P:: xȲ1T%SX58 S!V&R! 1?08|87Sq|'R8%S x(0!Sf|8R8a x(0!R7S|7S|q|ЍO!0 00 0p0PP |ЍO$tx4##P   03/P#|ЍO`Yʀ 0! $&0    ! @aRa/#D07PPWa/͝ 0!`'0 !    !y0C-DM,00 `p\(00 00a00$  P<0@ rP0(0`0$  0T00<0 a ,qP<  ?DЍ^l_^^^]@- mЍO-QM 0|RЍOpQL 0PS0 000p 0p@?o2?; 4S0ʀ0 !0, !0(80@"(0040#,@TS,@lU01l0#T 0  00,` 02S-  Z  0- R QQ S=,@ 00000SxH@4@Q Si>,@0xQ S,@0AZn Xx( Ri x(Ri. Q - Q UTX P$0.$0 3?>4L嗰 D⓰01"S o`% 0CC1%50 V00XW0~71G y027=02c|000oD1 9?9g3 :5<:M?0:610<10TPb00000C0zJ0 R@40c@,04@T \FP,0I iRF9 RxH5 V' \P,0 0! 0     ! 0S 0ЍP4@ ,00 1S\,40G  P4@,00 p0QpHzhzlz{]0S/EO-@TMP8 <1#>0p`0c_80$   ,p(`oP0$02 0200,p0(` @408 oP'> 0H2$,p(`0/0,2  0408 oPv 0 00졟!18 $ 0,p(`40noP`0 00!18 $ 0,p(`40ZoPL 0!X18 $ 0,p(` 40GoP9> 0 00!18 $ 0,p(`402oP$w> 00$ 0,p(`408 oP0N@$ 0,p(` @408 oP  <<TTЍ^Ea_^E^^*^5^@^L^^L]cq@-@P޷p@-@`PUp0S00`00C0 v `?M-@-0 0 #Ѝ Ѝ/V^p@-PP UlU`&I@P I0000 ( J@P@p[^z^'A-1P@`p x(0Qᔀ. 0!x8 S ጮVed0 @\%Ѝ }V0 lg1\ꙶ^^^@-1@P` x(0Q|ppP. 0lx8S 0 f\ Ѝ@$ N0 h\ Ѝ虶^^^@-1@  0@ i[^^O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍA]}^{]~] ) @0) 8408008,08089!= 01/L&E &EKEp$Ex$E2 029 0/202/@-8 040#Q0l78l7 0.  ( ( #- x Ѝ1@-@ h70 0 ,00( h7=h7l78l7^^^]p@-@P83/p@@-PP @Q9U5xw w> G" !`  Br 0 0# Ѝ B7SD10 1  ㋆`0< <`eGG?0L Q^^^-] ^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 )0 . ✩x ◩00x822x80!L0003/090020T100`Ѝp@]<^~]A-P`8p3/@P\00\0  x8 0 0x822x822xZx80!x8 99p@-@P`X@pp@-P@P xG G21S 3/pA-P@p`000   0?0?x80101 M? 061071 N? (Q 4s$Q 0n 0 1SA/@-P ` pk@P 00 0s ЍA-|7PSS` h7M @ iN@p0 R0S P@xH❱+A-|7`SSp@ h7] P i^P0S TAT10 R0S P@xHm0S i V1Sp1 _(0D D0 0PRAЍJS]G^A-@y}`|7 pS 0 xX6U |7SS@P 'PLP1 (0 000q]o^C-P@@@`pUAT ݐ  cP01SP1 '0, , 0w Ѝ@ꇋ]^G-`X  pR 0S R@3OoB@PUR@  P 0R01 S  R 0S R P0 P0T@`C-p`@P P@T Ѝ0S Pz1 w'0t t 0    AT  ɭP0S P @ꨋ]]^A-P@U+ pbP ЍA0S0S i V1S1 0'0D @ 0!-:P ЍAЍ̋]^@-@xP 0x8i  <P )0<8HP#0H8p@-|7@SP yn<@089,8zxxXP 0 022220000990w>018|7 S13/p^A-1@` !^y~|7]S11 P8889,89PPp ᵦ(# ⮦x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGtQ SAR]^^^@-@xQ `P ⦬P P 1  <10<1Ѝp**P 1 "&h\ \0   D@  ,h70SU? #~Q A1 "0 `l0Sp7  |7S 1 $!$\2+~Q A1 "0 E0S1  ;h76h7p7  1 l |.h767h7vV @AA!@^^^^e]!^G^f^^^O-P`|7MSS00 0ppp1 p0"0W  ЍO @T 00Ѝ0W p|7S2  0S 4"|0 0P@00x8S| 0 0C8C80Q Rn P1S: 00! 0"0 00HP 0SH1L100P10CP1e@H1S 0 R B0 Y 1 ! 0 |1P 0Q113/0Sʐ1  0 J Q2S 0 ᬑ9/000a)Sʐ1\  T0T ,⣪ 1NS@]~]^{^X?^^D^$^^C-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< ` 92<2<! !000w>0SB !T20S` W!` 42hǔ00 㲒 Ÿ  @1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? n0001 !0 0GP+n0001 0 7S 1  h76h7?!   }h776h7v202r1 ``V ` 00r@^^,^^^^t^^]^^^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3ᇞ@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,P00:p@걌]I^p@-PiN@ @P`xhNVxHp 0^ 022220000990?p@[^s@-!]1 @R0Ł1 <* >HP1 00|!|1| yGZ V07D180$881m`Ug,884X  P10X 00 0in  F2 . 0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝp̌]^|^|PE^'E A-pʀjPk|Q` 0ES  B2U U U ,U UPPH$H@`Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ }s000 0t u"    @v w 0  " @x 0S @@p]A-0 0SP@0p `.|'R]E`]E]E]E]E]E]E0 0A  = 9003213030 0*  &  0   t0/C-@`Mt9PP000 Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ώ X0P   D b00L7SPP7HWLW0P7^_^@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R!  R  (R  B/o"S0|'Rt@ R R  R R  1 0S "N)R]O-0LM SP@` 8]h7 |7S 808 8Rp>0pS s39S~p$H8R.p㲢 $$8Rh7 4@W80 & #RH L0S0P !0 >0'S s3)7R1 8>0 0\7\0000H  0C IRO[8@P000S Yڸ 4 90W 000040  B    04@ 014@T7 8U 0      $D"$  (0 0' #RH L0S0P " <@P$000 W 0 04;P 4;@;@q 0H   CX0C00000(00(00000|'RfEdEdEfEdEdE4fEdEdE0 0i > e 8a0 0 00ZT 060S  S  S#:9S00w0 00#"!# #"0( R:W $4RN 0@0080 Rm1 !0110/1!LЍ 08 > x 0 08    >32130300W7? o#嫲Qh' |'R8"Q S* h7 |7S8 2 R 0@0080 R (03/P1 8h P81081%[ 80S 000徠S (Z !%*0$@00 00 0J(0(0 0C 00 0J00 00  Y ! Y: $pY  8PpPG6 I70 0p 0 010 1 00 00 I0, 06, 00(0080$0p0 C0000 000 000((0C70 8000000C00 Pp:^~]]j^^^)^?^P^O-0S h7 #  000   0  8H(#8CQ,[SSSx Jo᪢R  0 0PP 0< [㰠岀  T%0 @, 0S 1 4 l0:0(101R(101 |7S  #RH L0S0P  "7PP 0 T;PP 0ᰀ00(0101@8S>HHPP |7h'S000 (  0/  p' ; W00  . x m000G h7  40S  Q N0 00 00C0(0x3rPP h'00  0  ;X00  岀0  " 101Gs~h7  40S0 0C0(0o 1010H   CRB0C00000 `(0 0(00000=000  , R :01 1 e0@001 PW|'R  0Grpq瞶 0 1 0100L7SPP7HWX0P7080LW2@$Ѝ蠰^]^^^3i^^]^!^A-`p1@P 00(0K0P 000p  {p@-`P1@P 0; 0(0 `  dpG-!=⼐p7# 50`Gp@- PP 1S 0(#(000Ѝ ǂ0/ |'hR    0  + h  000 fw0S 00000   0ܵ0  00|'RI00 0 ! h7   Vh72h7h7 M0S5 ) 00@10 @( #RH LQP  5PP    N  0 00H   CR0C00(0 0(00㲐0№  ‖ |붑9ҍ]=^Z^O-@fMP |7h'S000 0 0  ;0h7  9)* S09h7  h72h7|7Sxhgpe\ !PUP00!  ! 90 9O9S!  d!h 90 9?PSH(Q PU$<Q0CS*e!0 R` `!  0ʔ ``` 0 Ⱑ PH!h75h71 0l xr08 S0R 0C00 S 0S00K Ѝ0`]v^^^^@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@61 0 6Ѝ@3. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 l0 4`V1Ѝ@/Ѝ^6^@-0@ /2S/p@-@Pa0 6/p@/ 06 08880 8077090(10101/* * ElDrE@-:@0S 3/ D:S@0/p@-`@0SP0P    00T ,P1S 01Bpp}]P0/}P 0!/}@-@ F0@b^0 R  9^p@-<@P0S,@T ᩓP@p^ QA-0@P PS t`lp0FUAT B^R D ` 9 ^ Qc0@ x~l{d!wWTrU@m<kVP,,qbP^VGYU P ID = P8 t3d`0 1T(Lo^w^J_^^^^^^&_^_'^|^^^/_^^^O-@Pp$M 8sP0Ꮃ q?00 00G` A0 Q R V R?o20 $ЍP,^5^F Y [.P6|^' P3 AGQ#G Q [55^0aD! h7Q;;h71S//p@-h7w^6h70@S S|7Sp!0Sh7 p' 76 67h7p0S/R@-,0 @ TPD]A-P\0 B\0C P0\`00 VpW00`]@-0@M 60b1c2d3eI{J|K}L~S|7ST 9 h7  w>0d!!p740!h  i j9k9 0 g901!\0)|7S!=0S* 9'w>0 01 9i9 00\0 |7S 93/1  |7X `S499Ѝ@x829009h72h7Ѝ]]^^(^p7/p@-@f_qp@p7/G-P`q夁夑Mw>@VAM VQ V!I|10@|'RJ 5) 6) 7) 8)099!  089 079 069 059000N9 O)PQ R   0 0`VPpx8S   19ЍGd 0: 0@P 0590690790890Ѝ<]O^8]"]^X]ȏ]@-h7"1 @ S|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@^^O-pM`0`  P呐0@0 00P 000 0_o`@oLRPPU!R:"R :"R:0ЍC-MP 0`p` @U0 0 00  00P 0 0@7L?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`PPJ<1$ 0<0  A,p(PP91$ 0<0  A,p(OP)0'00弐$00 00A,p( < OP0$00 0l0 0`0A00,p0(0< OP  ,,@Ѝl_^A^E^EJ^^Ð]G-SP Lo `0@4p8à St# 00000SW 0` 01`P1 0 P P 0 ⊠001*  0,k 0  d忾000! PA0 F0S2 P 0``ᠾ0S# {P `:` G厾㤰@J ᆾGo`!0R p| X@Ѝp0 p 0j 0 (i}^ ^3^J^&_^R^@-@@]@- ,4 4 8 #8v Ѝk^p@-@0M SЍp@P` 00 0]Ѝpt^-$M840, (  0 '"$Ѝİ@-`plM4(@P@ !0 0  ( 0  P0000C0 p0!0WH0 0C0000 0d@S2 001 00@0 (H0L 0 H0L lЍ,İO-0@!DM 0 0 (kPԬ@`p\ 0  a0,@($  PSM 0  a 40@,@($  BM 4 l 0 d    a 80@,@($ P,M 0DЍ|^İ^^آE{_O-`F,MPp 填0 0 0 嬫0#ddh&hV *叫0 0 0 嚫,ЍOc+0 0S 0S*+PP s0 0 0 ,ЍO|00C0FGP \0 0 0 00C0000`P' 0S S SBA 0$ 0 0$ L350ZT$S -(0, 0 (0, 8+%@ P!$P 0 01`S0300 000 c P@k  s1,Ѝ0V 0S0S 04S գ26 @ + 0Sʠ= 3 @ T 0S 4S 0 SR00CS꘩EEEةEE0 S奣 "@ @00妪004 0 004 屪30 R S 咪80< 0 80< c 0S =P`0 0Y Pu 00s@0D 0 @0D ~0S 0CSc00`0 0S0X004 0 004 c3 &I0 R S A80< 0 80< L  0SP`0 0  >P" 00 @0D 0 @0D +0SS Sİ0p@-00@4S 3P1 00'R0 0S0StP 000 01S0H00``Ǣ2(@ap p耯  BR/ $R/ #/0 0S/c@-P@1S `pi 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S:00 @ꀯ@- 801S@ R  R 0ꀯ@-@ D0Q  0TS   @ ꀯ03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P *v!>000pp@-@`˾P@P pP/p@-@PP &p@-@P %@-@ 0Dp@-@P;&%p@QeO-$M`@Pu mpP u0$ЍT@ @ ` X0@00S @T k [00S 000S00 0T 00B0P` ` @Z 0 [0 TB0P0T B0P ` 00 0`0/G-pP@/`P g%T 4 06 S H0S 4 R30 PP@P8 0x00PPH0:%`Zv 05 0ઉ6 065(%`SH0Y 0S 0C @\  " 呺E^!>00000 0/6 0@-MP@ 0Ѝ0/,0/@- 0MP3p0pp`hP@ᬽ 03  !C+,0 , @ 0  Ѝ@2, 0#000W2 0,0-PpႽ 03  !+,00,0 03  +P,00,0,0 0 0:,z-Ѝ8}E0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@将|`pP1hSl l0p 奆AD塆0P1p00`0101S0@@iq}@-@Td$,d,lH,l $. O-@pHRH2DM p00 @@八0A10bA ᆕ喼>  ~ EF? t`pP#1 00a0,P($@ @@ @RH000D1 0<1 00a4,P($@ @ @?H1  00a40@,P($@ @@ @.H0'40张0  00a80@,P($@@ @PH040p0 00a80@,P($@ @ @PHDЍ}^^E^^^^@-@30 0S (P@\0X0S@DP d0`0S }p@-P@0 0DS P@ 00S \0X0S@pDP 00Sd0`0S D0S 00P0#///0  S /0C\ B /p@-鷻 @dPPRL0$!p@λ 0S  Q@D0R0 1}p@-P@ r0!S <S21pp@-@Pfp@ p@-@ PxJ00p @-@l s9@4E0@s3p@-3@ PVD Od@Pqp00S0S 0S h0S 0S d0S `0S X0STpD//80S/@-3`A0ASM=pDPP@5Ѝ@00S%Z(0 00:P0 R00K40 0003/P>DЍp@-M@`պDPP@Ѝp@00S0S 3/0000 4밺PD@-@$1@ Qvp@-@P 43001Pp0S 0Sp}B# p@- @P8!@P@"p@P@A-`@Q!pP000Ⱚ@P"Ѝ0 000 ` P !5Pp փ1S0 d ΃1@0Hp ƃA0, (10(1!}1i0@-@M`!00CS0 pЍ0@! J L 0@PS   (10C(1!Ѝ02i}C-0@SM 3/C 0`# P 53$P 00ЍC ʹp PPXU%ܹ (  0 \  PS U R X ṹU U ' }p@-@,0P `0,0ETt x0Rx0t 1x0 0S  0 00g 000"p@} O-@,MR||`SpPp踰 0S YP R R0 00R0P0 008Y kPK80SC00004Zʀ !  , ! ,p !|3x3 t3l300  !ḠW㸠 00踰,ЍY 30S00ø0Ŭ 0SP0 0 00Y00帰X `P帠3 00 0S|24d\0Q\d00\00X0d00`0H04038 $d0S00 0` 00\0X 00h0` 0# 0 1P0PP P,᥸ 03 6 =&pPR,00,0,P0S  ` 0S{0S  S u& 000 0U$ ",0 jpD3S0S00lvYL 0I kPE 03/A)WHzhzlzd} O-<>PQtM 7 .0S@ >Q Y= @Q==X"26XG0SW`T 0.p ᅁ=0P@8Vp=X @`\=Q 3C5CQYK RC4 張YE U -Q60S=`V:7p4@ T1<X0 0CX#0X 1CX0`0 0iA  00R 0`㕷DpP@8ᱷ1`Q -`0 @ T` Pn 0< @8[  P2!>d6 00 H`;X 0 00 RV  00 S DK n@:S00S P0 @n 0| @3 P P A 0`0 Y 0  tЍOJ0 0000 7@P 6060X`\00` H```nY @ 09@X9X&Tp 90S񟗛EHE,EPEdEPEE90 S񟗤EE EEEEEXEEEEEEHE0S`9X6C 0CX0S T80Spi8X0S 0 S0Z T`0`V``Y T` YY P8((XX T8800L ڥ0 0 0嵧pP T"&@P7`9 0| 000?8p93 p!>8000000 `7Xn /1CX @70 S`^ꜥ47`00 0 `0vpPJT1`$p` SEPEEPEPEPEPEEPEPEEPEPEE60S1| W `93! \ 3 D 00  03  P  `P p'TppWp`,0,Wp  <E0t01ؠx0@pt01Wؐp pW0 ؐ 0VboV w i# d#3 PW`W0  &`WZ V[ 44 &PP0Wd00 P`00S 000d00  !QR ` `R` `W00 0 `3 !0S P 0SM  ql000T2 (W+ ` @0p0S 0S000S 0 aܠ>pspYp/` p`p`0"X00p003 P R00V 1X0S00}0S`V|00S1X"0SY$Tr0|`Xk| eS  ^ 0QN R0`10`嬴tЍi iii i}'i i^ii@i%iߖo?oi@oi!i#i"i Ki ^P08 P R/ !  /} !  }O-MP@Dp x`0@0@@PW.'P@%J1003f 0 `P H03HD P@.L0S( D 03 0  110@0 Ѝ 80S 3/@P 2.0Z00C?o20S 0S dzP @P}0Q(@- 0@R0S 0 R S  `Pų 03 0Qṳ/}p@-`gP 0@0L0`0D00@0 0<0(080,040D00040,000/@plEȲEEEEE԰EE@-@w@=0O-,00pS@(,M@P 0 0 0"d1d00hS&h@P  00 ")a! 1 00 $a$" 1040  0PP  0 !H 0 (",0 $  2 .(,(  P! ! 0"8S00 000080BЍ8@- <0b",4b4#  #$  #(  #< Ѝ&^p@-@0M SЍp@P` "448 #800ѧЍp2^R=dd!Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # B}PpEp@-40 R@  000     Ѝ@-40@ R  000  x  ЍX0 0&-$M840, (  0b9 $Ѝ0C-M 0P`` @vxp0 P 00 00 0 0@2?o2P0S B~Q Ѝ`C-PMp@ 0` v`0 P  00 000 0@2?o2P0SP @TP@P Tn@P0ЍcT `O-@`Pp3DM ,@0P 0 0p(`$  S63ᄃ 0P,@0P 0 4p(`$  @6 0 0 0'!,3 4P0P,@0@ 0 8p(`$ )60 400!2 02 0P,@0@ 0 8p(`$ 60 0 0!2 0P,@0@ 0 8p4`(`$ 50400 0 0!(2 0P,@0@ 0 8p(`$ 50 0 0!1 0140P ,@0@ 0 8p(`$ 50 400!1 0x1 000P,@0 08p(`$ 50400 0 0! 1 0P,@0@ 0 8p(`$ 5 0400 0 0!00PP ,@0 0  8p(`$ 5 #1ߔT@T=4DЍ^B^`G^EP^`^l^Ex^E{_^^0 Fp@-P s@lh 0S Q 0P @@@040p@Pp@ Y0`0 40O-PMdv0@0100C0#21 2 P  0S {# 2!12Ѝ 0䥟0D`r01 0 [аK \O XA 0$0$0S аC[  R R  H0,0,0SJ DC[F[ P PM !>800( p<0@D\Y`0 0p08p6X 0 0Lr01000[аK P V H 0S V[ 04040S аC[V H`308080S ذC[٨_ # 0p0p0 \˨S Y\  Z  Z RTDSS  S R 0   s0 00 IY <>0s0 cR0 R0001 ᓨ \ ፨|Hg  \0S`3a `P `P 0 "00 0S0  "44 0C(",400 000 0 B0  B(00C(00r0P,0,00  !B P0#$$("(B.0 0C00 000PP;# V2!12 q \C  \BH/oP" R` 3 ק2(0([DK ~},@- 4:04 ^,0?A`"b8"#b ЍQMbO-p`PLM @ ^ *p`^0(p)`#ttx'xpGW Vܑ 0$ 0 0$ $W$0S 0 3SH0L0S@P xE庑 0$ 0 0$ őLЍ00C0-P U墑(0, 0 (0, 00000C00(Sqd发090! !嗑00CS]F|FFFFFFFFlFFFFF<FP@4Ѐ i0 0 0 t?P#W 00S00 R0S N004 0 004 pPP0SA@P`   0Q ,DD(00830#0S  $3/ h20S 0  H0L 0 H0L 0080< 0 80< 00! ! >@W004 0 004 ,20S 0  ߐP0T 0 P0T t00 1 0S W0 Cr 00|pzP b ᕦZᑦ Ꭶ   R # 0 0{P10S #W  R1  0S R 0$,00 00(000(000<3P 0S  l `P  8Z0H8 4]P $Z <0]`0]E^p@-0P@O1 01  p@X0C-ᶐ`,M @P 400   0 P  Ѝ PP XXq  @1 p W ЍC )T TX%XU d"44` 8#8R** 1S0!PU:pWPX0\p JU:H @D P *0X0\T _ 0 @TЍCS0RH0@0`0d 0S S :\Ï@0D 0 @0D Ώ`Pdp03/@EВ]`00 h\ 0SQ HP/P %/QS  1 //В]]@- 4,o`8O-QpP00P Bs0 0 0 ~02"0`0S 0XA0C?o20S  0R:!R\2S2 HBM0 0 0 X ЍO!  `P "44!8 #80CS@@0SV:V`!P U[èa PU@ 0 P(P2(X2 h弢 0`P(Q1 01  0 XP00 0 X0 XZ[ 8#< 410  0 000!"440000 0 0 000PP   v0`^-$M840, (  0)s$ЍDC-MP@p 0` p`0 00  00P 0 0@ +?o2P@@TPQPP ЍG-M 0P` @po`0 00  P 0 0 p@+?o2P0S  0000 08P00Ѝ0O-,M@S ,0 /X0\ 0 X0\ : ,ЍOP 0S(1,!0 (1,!$0  ,Ѝ!>00 $020 00&pP20 0 0 0 p0#$$ (0"(DRD `P  `0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00p ! 0S0!0 pp P X0\ 0 X0\ 姍V+ 1墍@ @ ꆍH0L 0 [H0L  `0d 0 `0d 前V 0 ~V G (Y 7Y@ @ 0P H0@9 T0 0 0 ^@D@@-!>@tPM `0@@:p0 a 0PCЍL000 9@O-=Mm {@P=ЍO XP   1$!0 1$! X=8@0<0<0S S  1$!0 1$!8  0 0 0 80 <   88Pӌ0 0 0 0S P@0@S 忌0 0 0 @AT岌 0$ 0 0$ 0T PP8 0S圌0 0 0 ;`( "$`$"",R a(!"4a4##<S3 81, @000@S Sx0 0 0 3 ;0S (P "448#8T](0, 0 (0, d8(SP0 0 0 W Q0(0 C8 80;00 ,00L0P 08P 080,1!0 1!30S* P8G 80 0001S0_0 R P08 0T 00000S 80 @p0(P0$400010C00STy 90S@r 0lPPl  l080Z Z[ 0S@100 0SRQDZ Z 0 0C0PZ Z nX0l00m080Sz $0S @E0S [@@D 0p0M$l0P0$0iZ.@0 lG0傋0 0 0 卋S 0R* +Z 4b0P $0l$0J* c0$0@K@ plZl0P0  l p00000@@@T@ pDP Dl @ n4X0l00m0(0Sz0SL Z| 0R: plȠl0PJ0   l 0000(0? ؠpDP@k D plYH00C $RYHY0 #"  02R0= 0IS  S< SU@ @@k000 nW0l00m00 0S40p0ki0yP ᆠ0S ၠlH0 l u000 nW0l00m00 0S  pl:l0P0 W@E@)S@T 30S@CA@$@ 0pi201H0H0S 0CS # 2 P0P0SD0CS/ % 00SI pPk>X0\ 0 X0\ E W T  X     L #I0L0L0Q  R W7 hW4 `W1 XW. Q+ H0T0T0S D0C@p#@10S 08S 0 0iX0\ 0 X0\ X,00 S ᯟ 000S 8 P80S 0 00010p0t 0 p0t ˉ, 0 @0<01# 083/D}~0]O- LM @P`pp8 nh8 (p000`,P$@ @@ @*' 8 (p0@04`0@,P$@ @@ @*4 0 07(p008`0@,P$@@ @P* 0 07 (p008`4P0@,P$@@ @P*0 0@7 4(p008`0@,P$@@ @P*0 064 06(p008`0@,P$@ @P*0400 06 (p008`0@,P$@@ @P{*0400 0L6 (p008`0@,P$@@ @Pf* 040 0 05 (p008`0@,P$@@ @PQ* 0405 05(p008`0@,P$@ @P;* 040h5\ 0\5(p008`0@,P$@ @P%* 0405 05(p008`0@,P$@ @P*44 04 (p008`0@,P$@ @P)040|4X 0p4(p008`0@,P$@ @P)040 0 04(p008`0@,P$@@ @P)0@ 040$0 03 (p008`0@,P$@@ @P)040p3 0h3(p008`0@,P$@@ @P)040$303 0<(p008`0@,P$@ @ @)0402 02(p008`0@,P$@@ @Pr) (p||24  0pD08`0@,P$@ @@ @\),2($0 200pD ,` @ @H)p1$01D 00,`(p @ @4)1010D 0,`(p$@ @ @#) \!\\0@S50@ T08!0@TB . 1/d@Rj0LЍ RPP CB! ,0FD^^^^^F^^$^/^dOG7^C^FO^^^i^t^^^F{_d^^LG^ĠGݺ^G^0].H@@-@) @9 A-po@PP0S PP 0 0100a10 `0 0 0eg 0V *0HHQ0C00 00@-@0S 00H 0 /H@-P(0dp`LM @ -@ 0 !P@  0 !P@qPP"   0 (02,0(0!P@ `"0  ````( 0 ((!fLЍp@-0P@妆1 01  p@识D03!"/03" /p@-@`=P@P Xpl00S @-e P3D8#8 ("(P "00 /HP/k0P7@- Ѝ0P @R R00P0S0!> 000BS@-`Q00pPg8'#TgT%%< @P@ ЍVPlpeh00100S 0CS W @#RP 000~A-@M`p  X@hPP"0 RP00S)T@$ ( R@P@P 00@ЍHP PTPwTPᑛ1PP mP009მA-p0PS@0S0 P0S 0\ Q g0 0!0;08`IPV1P 00L{R 0!A-PS@`  pPl0 A/4@T8!< 8!<_*DhP/A-p`0PPQPEU `f @ T T@ @T@  f0PEpO-,0,M00@010 44PQ : 01 $000pBpWS0 0 0 (,Ѝ0000 000000#![ 0C7 0 (08#<400 00000@U``Pb„0 0 0 ̈́U7`PT70`0000x20 00 0$() 000S O000 0-0"> 00$ 000K1 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400P 0( 000@  $aS0 0 0 ^000], ,0@ 0,0 00800e ,0@0,0e*0C SV "ql`&0 0 0 10 0 0 VF Z`P@UDO-QM00ذ(0 p@ `G"448#80SZ:0P0(P(00000NC10@00x0| 0 x0| X( P눀,Y 0S 0R &$@Pu@Pp,`P,j ]寃0 0 0 広(0X$Ѝ0S003 3SH0L RP0.kPP "0 0C00 0000 =@0d(0@ 0(0d 00"440(",40mH0 00@V0g0 0 0cP0010m0r `pP$\<0 0 0 G(0X 3` 0LPPk0 0 0 3`((P``@0000\`0TP 0 @0 R s(0, 0S80S 0S `80,3/pP `0 00 0 00S<Z؂0 0 0 0 sR 0 M [K PH LaPP @0`000p sR `P3 `SPT@P H0S i囂0 0 0 如(qA`P{@0D P0@040 D 0`g0 0X000 0zTS@PXr0 0 0 }(HH0XUA``0HP4`S0@0D Lp0@00 0@000D g 0 0` 00,(0 [   U X3`20 0 0 =(v0  #R  3 0S#t`P xW014!0 014!1`80S t80,3/`P t0 0t P* [ 0S% (`P 00S`P ,0 k,00,0000, o0S 3\ V`庁0 0 0 Ł( 0S0X0S LXV6 3 U喁@1D!0 @1D!0  XU `刁@1D!0 @1D!品T @"44D 8#8Q ( %0%<#*To@1D!0 @1D!z(`:( 0<00 (0(DQ ,   40#0 @0A`W 0S0 0 0 ,("50 @000K`P( RSp,1 !0 1 !7r`0< 0  00` <pP 0`  R 01P/0 03 $30S ( ,0@0,0(!!448,`#8S9 7i04z 0R0  ـ0 0 0 hP|" R  t`23X"X1`00t0K$开0 0 0 ǀUu(00,0` @ ( ,0@0,0 3  10S 10S ($( ,00,0(0 , 0  `3  10S 10S ( ,00,0 (B`P(3(Q VPV0 0 0 aV '(0  0, `(1`%(1`DH`\]^ C-Pp@p0M00S0TЍ0S  S` BS0S 0 00000 000B00SQ QR ja0 >P R 000*A-PpU@(M \xPP7@4 000,30P0 0CSUFTVFlVFxVFWF +@P0S@ i`x0P #Rვ1@0S  2R`V\ x`(Ѝ20m0S0@0 .@ 0 00S"00 0 tP@* Q& 3S#`0VV;@ aP 0007@00 0  ^ R `1@ 0@ 0S 0 0P@`0  V1@ 1 0 `aR0C000 0⧝S S Q ` -@Vs@-0@ SP& S) S- T 0S000 Ѝp0S`P ^0P0@000嬔P00P 0  0,0O-,M00P`Sd@ p&S d6Rh *5P Pa00CSTZFYF[F[F[F[F[FYF]F]F]F]F]FYFYFYFYF]F]F[FYFYF[F[F]F[F[FhP 0h0[8 <GpP7,Ѝ`  ~K[`#0Z)[# `V [ZZV0 _ `F` ,R 0 _`hpd@(Vx` _pP00CS(\F4\FX\Fl\F\F\[F\[F\[F\[F\[F\[F\[F\[F\[F\[F\[F\[F\F\[F\[F\F@\F\[F]F\F00000 CR0ŕ0S@@0S@@0S@@0S@@0SKK0 00+0 0p0ބPk0SJJ[P0SJJ  DPV$0S 00 `$P៓1GEP 00啓npP9h-P30SSe @\S @Y _P#P0 CR^FYF^F^F^F^F^F^F_F_F_F_F_FYFYFYFYF`F`F^F^FYF^F^F_F^F^FhP, 0 P 0CS@_FX_Fp_F_F_FH_FH_FH_FH_FH_FH_FH_FH_FH_FH_FH_FH_F_Fh_FH_F_F`_FH_Fx_F_F000000D600D1356 R R D0$00  0np$j  0$ p@-@PP`p0Sp@\uPp@-@0x`S   !00C000C0PUp@ R0 0  *PO- PI`pG@T`@V <00CS @p S0Sĕ0C0S0 |@0D 0 @0D | @1!  \PDP 0O-@pDMP!0l 0 00,@(p$   0!0 0 040,@(p$  0 400!X0_ 0'> 0 080,@(p$ P @DЍP^^^p@-@`M0P0@@ @0 㲇dP  <@@T 0200 R00C1 2"Ѝp@^0?P,?@- eP98@XA-@.0"0R S  B! "2 2R2S0p`P"0#Q00S qPP@UP#00C?o2PAP,?XO-Mp "44 8"#8!`ǟ C\4LG{0 0 0 6CS 0C:W 0i  0!"  "? !AT,fT< 0pR4 {0 0 0 { Q :lF{0 0 0 {; 0C S   !R  Q \  \ @ Q 0a{0 4崥 0 4k{ hpP 0O{0 0 0 Z{\= Ѝ   1T! 0 !A  Y"RR$0@P       !<  0 00! 0 0 !000 11S0@0AH4000S0p0 pp0 pWa   R^  !Rbz0 0 0 z0p101X 0 !1R!AQ ڴ! Q Ƞ,Ƞ B!  R00 Q   ! B!  B XY 0R p pp! R p0 0!p DR  B   B k `  p嫇W+ p 1(",400 000 0 10 0 1C00S,00V(p`o Cz0 0 0 Nzd0  0v [ p 0p00Y !!AQڴ!Q o!! !! B! Rn10C100C0z80< 0 80< z( 7 fDPXP-//-/-/@-@-@-p00d0@ ` P (d0 (00  0 ( 0P( Ѝ1M  @-P^@-L!^!p@-@P0S 0S 0Pp0Pp*P pd!>C-@pPM0 0@@ 0 !44 1C 0"440X1`V T, 0p Ѝ0S0S S0S  S0S ST@`dP 0 ^, 0  02# |0R0@l@ 'yh0l 0 h0p0l t 0Sp0 t ,yd0]pnFD-/ 0!< 04 0 (   !/HzhzlzT0M000S ~S 0S/0S001Ѝ/\ P/0 !8 0 0 (  , !/Hzhzlz0@-S@ @p0`000S ~S 0S/@`P-0P d0  0S x1@ Ѝ0m0@0A-@pP`@PoA-@P@`@p,bYdp@-P`@Kpp@-P`v@?pp@-@`jP0001p,p@-P\@&pO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P| 4 p 0 h (d  00 0 a8,$ Pd DЍO*^u_G,^dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ]tEd@-p`( PSQMp $ @D0P \PdUd (0F0S* 10H   CR30C0000Tr 0(00(0 0 !$$   R  h 00` 08 ?PЍ#RH L0S0P   @SASC 0 #RH L R    D@P+ 0 (Q((",$ !$$ 0S(0DS 00 0 0`P0 0w0 0 0 w7P(P PPDO-`@P(Vq p8@ @P  0 4@T000 P 9@ 0 @,s@-aPU0@ QPd B% / P  P d0R0;;d0ЍpU   Ѝp@P P\ P d0R00\d       0`( "4`#/@- "44!0"441@- W Ѝ 0<P   /  .G1S0C 0!0ղ/0M/ X; 1M/ 5 p@-P`8P@Pp0Sp@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@@-@0 :0@@-0 00   00/zЍ4^p@-P{@p萂p@-P@ L}p@ꐂO- MQ( P '    pWS   RK 000 + 0R010 0! R010q0;Sx@Tu 1 Rq00 1`@ 0`R00 0R010 00C 0 01 = 'i Ѝ HR@T  R 00 000 0R010 p RJ C\aC^L&\d u! ! !$ !$u ' T G`^Lu\CQ B C90 00000 SE0 000u 0R00 0R010 T@ 00C 0 2 b0R`t1 !0 1 !t   C0 0H  000CSp`V 000 R a 00 00!0 R00 0R010 T@ 00C 0 p`@0p0 @p0T@P 202Ct8!< 8!@!<D @![D (!, (!0!,4 0!408t0W0 p0S0@@@p 00 00S0@@@ 0c G- P@$p峉`0P= Y YH ͉,  Q. Q Q 3 ,10S  0PR00P 0P ,(#(P0 8#<48#80#Q0P @ᒉs0 0 0 s,0 Q Q 0@ 00S  0miO-@PDMhppUXDЍ`0V V X `XV0CS̆FFPFF F ḞFV  0 ;S0000 "440HPV 0 ;S0@000Sg1 0#2S S . (". *g!0g. it V0 0T T 0 ;S0<00h1d00l1V 0 ;S800S0 <00 0>^H^ą@-00SJ@ R  a``  B B'S00C0@0CT|u^p@-@a@Pr80< 0 < 80rP!R< 11c TR S0cA1C0S0T10P!0S 00S 00S0`1S *08PaPT1P 1XC1H!UP1S01S0#+0N p2P11T1d\lX?O-CM0M00nr0 0 0 yr Xn?0 <<0f0`0SP%0%* h0P h0 QP%*p PU Cr1!0 1!NrCߍ  XPP0P 0#2S S1 00S) qP"0#dd0h&h`F0L00,0000 0#21V$000$ R0S& q1!0 1! r0S 0S0S0S 0S 0(``Fr 0L00,0(0$ R`F 00 RP0 $ 0P 0$  QwPPUx $00C<0040<0 S  0SX :P  0@0X0N\K4@` 0 T0$00,0`0P(0(@,0 SȰ0 00 P&0Kyq1!0 1!q $ P07h ff 0h00zoP  R0Q]:@(pT@400Hq1!0 1!Sq 0 H(qP0V 0 0@0 @DT 0 0  @D0V R/H00q! ! !$ !$q@000 `FV GpX1\!0 X1\!p0# 000 0  p1!0 1!p60S T00SZhp"   p"44!$$8(<"( #8 >G6 QP  y u00000000 0nP00Uup1!0 1!p 0  HipP0@up1!0 1!p50S T00SZhp . q .q p"44!$$8("( #8 . . R  0Rpt8p(!, (!0!,4 0!4=p'-0 p0pGW/0DpH1L!0 H1L!(pp$p0 0 0CS0S& 0R"p`1d!`g0 `1d! pL0 000  0R17Y 0000 0000092 lP000`00;S T0d1R0 d 420S h0  h0 0᱀0 00 S.+0P20  h< <,0SG!>6 l 9&0009T0 Re _  h KBLP 00000 u0 3SH L0SP0\ 0 /<  0CS00S0 0000Plp0060^ ^>^^^X?H?ą Rb ` 0 hpPX w6 @TR  d130p00D1;Sڤ0`1'40SI0  0$ T 70L00SE S0701nP2T"0P2 1 T"nT0@ 0!0CS103/XP  `0S 0 1 000Cp!0C 0 1R ^T00SP h!\00CS 18008 0S0Q0S 1 S01\P t AQ\l\hVLQy0LSv41 Sr:;So 0SC H!R L10LS2A0``FSn1x!0| x!!| 1!Rn1!0CS0X110C10    BR901!Va0 BR1011 01R&0S ,0S@P40S0#P ؃T0  000 0 =!]P 0 @ ἃ 0R* $4RkX00<0 04000hP] [ 0R 0@oP XEm1!0 1!mD |UoEm1!0 1!mX0000< 04P$mX2\"0 X2\"8&Pll60G&c0 Q 0zQwSu* Qq0B AS0Vk80 !$!01[m1!0 10! 00 0 00/ Zm%\0S `0S ! 1 2 0 @jP1T! 0/P1T!6040|X;0j0 0 0 ;j=00(0 !0R0000C0000(;S+ 0C8#8SN 0BS@00#V00Sn 1 Sgih1l!0 h1l!i#P 0Q/ 0;`'0  BR0!0CSi0 0 0 i"e0`0`SY/!440 000C1 |&;P 08C8S; 0  10C0CS103/P';S41,041V  1P \1  BR103/0吥0 010BS pip1t!0 p1t!{i0$0$ 0C`ix!| x!!| !ei 0SC H!R 0L0CS4Ao 01R:"1 03/ XY:10C10(00    BR901!Y̑0 CR 10 BR!0 BR1;0CS:F\FFTFF8"P30!!1 0C S011 0C11Y0#$ 500 50C01(0S 1  pQ 30?0! 0;((0S 0;21!P(0S 21w!V!0R1 S *(h1!0 1!h0 10101\1S05\150(0 !$10BS$!8G80 0T00>JT00T080;(0S0  :; S1 ,0S1100S 0S ,1 0 0;Y01!01 h0hh P>00000`0VsąX?@-0  0'S( P L@g1!0 1!h$0 CMq 0`( "4`#/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@p@-P!T1PB1A P \A{X1+8T@1D01@ xSx0 S 0R ; S0Ҳ;p^ܓ]X?O-0pMS@(0I S/`;W= P `( 1H`S= `0d ]  S `3`#Q``VO^hPPC ;0S0S0S m PEU ڼ; 0CS0!0; 0CS0!Z@0 0 0R0100 Xʰ\U 4wF00P4%4158mF00P8%8150<01D00H00S P0S -(`0&T00S 0 0C1!4!R4!480P00L00T00 :04P+  10S0$0|! 0B$00  00!0CS0a-041V`!;p0\00  ;S0J0P 000S V!`0 Spǃ0SH0P @ ;S=1S PC0 PE p3U;8<0S00 08PS]*QU0BAS0U0 $0U.1  D0HS 0 0S *0S\1U*000C?0S2e; 0S1,1 0C?SQ\&0A@SR 0S(0 S<00<0t`0 R P   W :(P30& R0嚿P0S0S0S0s `G1S `僿P`30 R@P1S\PE80P H0Q8SP80P H08(D0H S9D!00C S:P9P0 RFP ,9P0SGUP)0!0S01 P4!UP!S414Q0\0P 0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18S0;!410\ 0C 0C?UPp70Sn$0SX$P gUP!D$0PEU0p080V PF0p3 PE UVD7p0 0k80[PW0S=0800P000S 0  000CspC 0RUP 0010CS B 010CS>P'P98#P5|60S`P0  0 !!R: !B\: \~*  B Rx X0S1 P0;0l0800000S P8P ! 1`P0H&  0z$ &!$$&  @ f1hd40S?0bd 0P `(VA00 00t4p1Hh@1SI  [) 1(00` RA(  `(VA0|   ,0wt,0K |ሁ[%( 6 )X/5`0S 0 00C00 0#Ѝ1 @0 40K, =,  5 4000:g<0U0402 d00S0U0S- 0 0 0 T2d`P 4 00S<07bc024"0 024"c `)X00/0CS202000000 000000 0 Z00400 1S 1! Z!0 01 01 PBw0S0A101QQ0" 3SH L0SP0\ 004]G^,^]<^ąX?p]<  0CU4 00 p0000Zp 0 ST S,(S0( ,0(N0 nPP;c0 0 0 0 0Bc`P@ 4 00S$0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 004000, (0Qv <0Rv< aD+R 8" R   !BRpĠ! U 0 BRU RZ bX"\ X"\b (  p@p 0% 0 0   X  `D  !  p @0 "!R 0,S0e!@QP00S"0("(R"" "! BR ! R !!$! 0SO SX 0Smp000Sp00!0 CR001H1S4刄L0H1Ab004 0 004 LbOPk 0RVUe0Sb 8BP^[Z%p !Je   0r8,P0 000 S$0 40< ,0 000 S $040<, (",$("( R,B B!8P 00!0 CR01P 01R 8P 0;d6040p0(pS S: /`x8( #<40(p0S&0000 00!0Sh R0 05P P`3 7P 2PAP @PM;SJ>`Saf(00, 00Sbf,0 ,0, 000 0S0P 0ⱄ1 XSq5aa0 0 0 0 @0D 0 @0D ca0 S,!0 CR,10t00 0080S: !8RP L00SL0L1`(`@-1D @0C100C0 0R100  hA-@0p0!R蔀0 0RP`| gP 1T010`00 0 R 01 @ @! 1@-0 00   00IeЍH^0 /|10|1/O-4M I F SPPQPU>Q: Q6 @ Q1J0 A\-Pap B B0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qS BPP q*0 GR IQ PUIPGQP0p CR00 0AS0 PP 10CSQ0 CR 00 P 0CS0BS0P 0 BQ000 CR 00p@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/@- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R 9j1M  0MX @p@-PUp@`60P 4 G*0Pp` d H Q1Q44!.010p@p@-PUp@`]0P 4 E] Y\0Pp` d H Q1Q44!,]010p@@-0 6< 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0  :0p@-T0@00SDP@^r sT$3Sp0p@8[S^F@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R J00JPP 00(0 h+ 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S`Z0`p(p0 00 00 0#21Ue1 R30 4R0(",40 00P0 00 Z(  岱  <*ẠᰱV3ᲀ0 U 00 0S S 8 1P0S05TPP,ЍO@,Ѝ0 ""R R2 v` ,    ""!R!3 Q@0Q @@Z0 ; 0p0 0 0 0 j`( @P 1  Q  180 00 0p 0k|`0(p갱( `RUq崠 0Sca000 R)0Q8  Q8 U P0X0TPP0,ЍO0000000S U P 0S8  S8  =U0 00p@-A3???H2S L2P"0S0R201T2!111C1S03S0#00]"0P0S$2$p00S(2(`0`\0P0`1PP1P!UP3,b0R];P!<0824pX?0@-0PMX"@00 0`0 80@0@U` /&\(& Ѝ0\^G-pP<a@P1 /(C=0 0  1! `p1!1尠] (`Z`RW W ^8\`ZXVh=c@`0@00T0P01H0,1@0Cp1e`@0PЄ8]0p@-P@T @p R00 0R010 =G-`0! 1(pP0C 82BJ@-{[0:0>YZ:P l000B:000()[(0, a0 (0, (3[@p(@W@|b@P 00S X@ 0<1P0 PY 0 00T0 PY 0 8P 0 0x0| 0?P0 0y* :P03 ( 00j 0 0? 0 bꘄЄ =zA-0(pW% ;@SP`0;(Z0 0 0 (Z<U>0SPTA/(Z 0$ 0 0$ 蘄 00!/ᘄA-p`+PUAe@T P P (`Z0 0 0 (kZm0:0PP@-@01S001蘄0SrC-0`S,M(P@%0@P S 8FF8FFFFFFFF F F F F\10S UL 0 SpH ( 0R*T ,Ѝ ' 0T0!  00XP@ 00TP00S h00@ C3SR L0Lp 00 T00/֙]@Fd2S01ppa1S10;`U pt00{W *0Ga80 W1Gh"R l2S0qPp2S<0h2S l2S0nHPp2S<0X?]p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 %X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS 'U/ ; 7 3 / 8+R2tЍfQPF@-0S6& ЍS6&ld^0b? S /A-P(p1X`8@@ TL3K@D0S@D0Sd@DV$ '0 R0@1:D70 P1XVL0S*@L0   @T8A%8150S<1*A0S0 S(00 b/ R /0SA-0`S0MYPW2PqS 0@S0@?oR20S@^ P0@S WB <2 PaQbM _M0000 0 P 0 0 0UP! Q 0`0@S010@Sʲ0T#TT1X%XS !0P90DN0Ѝ  10CSa0Tw00000090P W R0( @Q 0p0Q0 0 P|00S @0G3WS "e$!>20 2 0 $0(0 //]@FtEp@-0P@(@$00#.0#A0@.H>@$00#|"4 0 00 PU `0S l<P  <PPЅ%@-0@ 0@00 00@@Y$$00S@ Ѝ^Ѕ%O-4b@=PS}M{Mm0S S8 > t00#.0#8.> p00#`3 p\V 1  xQ6\T1!0 1!gT 7 U00;d1S 0 0A0 0g!P00@0@00=0=3T1!0 1!>T ЍO-0R:!T1 01+T 0SH 0 A SS0!\ 0 Ѕ%A-P`ATAAp@O-P |10S@BPX+ 0S01S0!41010$101 100010c X0 S,!0 CR,10t0R1!0 1!Rn@PP000` 0 0X ]900oX?@-Pp`B@ ZPP Ѝ@0 0CS4`'?R! !JR;@-@p`P 5@P Ѝ@0S; +R0;8`R1!0 1!R O-MpPP0` 0TRXB0F1SB B0CR/T90S  PPB CQ2 "0 2 "QX P 븀1 d0PQ0 0 00 00 Q 30\"PS0000<`20 0PߍW@cTX  *  l2 2[Ḁ000S` Sg `20;0 0Pm1 [XX0100Ch01d00= S;0;0`0`S00 1201 0 SQ?0  d10S;0; 0?SD10S;0;0 0 VPP*"Q0 0 00 00 'Q{w000 a000 00 00`P2"0 2"7Dą@-@b$M呥0  $Ѝ@ʥp P  % Q" 10SJ 0CS1) wO00 00A 00 0h( 1厵垥$Ѝ0Q1;08C8 S; 0;PH0L 0 H0L P>Q<PP0T 0 P0T PPT1X! 1C1S01S01S0# 01 1S ;S \P0 0 0 gP01;S吵P!T11T10P1000110H1;S0;0103/^Fܓ]X?p@-@Q0  p@80 P +PT1 RX` D B R*1C1S014cR :Px0| 0 x0| P<POX0\ 0 X0\ PK00m00ą@-@aM喤0  Ѝ@Ϥ`pP HQO`0d 0 `0d O;S6S00 ( 1( 1S D  B0R#*Oh0l 0 h0l O00  B !  x01aT01Op0t 0 p0t O<ąX?p@-@P.0  p@h`|P 01; S !R D0D00CR:001 ąX?@-T@7HH 04004 0003@0|ąX?x0 R   R-  R   R   R-  R/  / b /X?gfff@- @@0 ꈔTGp@-@TP岣0==09#9S p@P 000i@-@8`@0S-//A-`@Q !.1`pP!P+0B8#8S1|; SQ0A?0oR  0?!0X?C-MP00`0p0 0` @0 P  0`  00 000 0@?o2P0S R0 ЍO-M04@3`rݷXVP 0 S0DS0 0000p20@4@`T0V2|p3/5@DT00`0 S0 00(0 0000UP -($0[@D0 [e 0 S030#X0S -([P 3 ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U  (@,0#( #(0 0&(  t& T0 p Qq0y1x!&^? 0|10 (B}0 0 00$Pu(0 8 00$Pm(0 @ D  H d L 1P0 0T00S0+0X \00U,  (@,0#( #(0dx0 `0(0lq0h00p0670t00T0S_0yx1&^? 0|10Q0 (B0 0 00$P(0 8 00$P0 =00 =C00Hs }@=-$M840, (  0L$Ѝ7@-PQ@ PP #Q R #ZP Ѝ000@-MBc0 40P (P W PU 00 00!0 0S@P5>Ѝ Ѝ@@ꨄO-GM`!XP@D1LqR @Gߍ RP@ S @  R!HoQ 婒Z X 00j 0@Y ,`(p 008P40$@@ @D 0!>4 ,`(p 008P0$@@ @.d> 00!T> 0L>4p,`(p008P0$@ @> 00!> ,`(p008P40$@@ @"040= 00!= ,`(p008P0$@@ @x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @| 0!;0< ,`(p0L08P40$@ @@ @e; 00!x;0<0L 0,P($@@ @P 0 !(;B0 ;L$ 00,P( @ @; 040: 00l!: ,`(p008P0$@ @$: 00 !:4 ,`(p008P0$@ @ 040@: 00!0: ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @o0408 00!7 ,`(p008P0$@@ @Y0407 00!7 ,`(p008P0$@@ @C040`7 00!P7 ,`(p008P0$@@ @-0407 00x!6 ,`(p008P0$@ @0 40D0!6 ,`(p$p008P0 @ @040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @$5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @z4 00!|4 ,`(p008P40$@@ @e@4 00!04 ,`(p008P40$@@ @P3 00!3 ,`(p008P40$@@ @; 0!300T 0a,P($@ @4 0400`S0S=pp0S p@-P%@5p/A-0`SPB@@p0S759@@+0S ;2XR* 0R 001000@07@A-`@pPڗ000S S/@X>1De>4(S 剨@G-p0M0@`0S6@ЍZP V V @{  @  aY`v YHXhIGIGIGLG,JGxJGJGA@P 0R0005@P0S@+S; @P@T 2TA @P@T 2TA @P@T <2TA @P@T 1TAHXmDKG\KGLGLGLGLGLGLGdKG00 0S;  P ; 0= S00 000`0`S0e00d10200q0 000JD1P!@@2T!#3=P022|=T0814X0i!\e!1 l0 1pp|00t00 p x02000020201111*@X?T?@-;@SS8#8S TS0 T @0;t@0;;S0(P Y; S Q 00?0 S0P 0PD00 K P $00 B P X?p@-0(P;Sp@20@ Qp@ v@P p0S p@-P#@p/0S/p@-P@p@p@-0S@ `@Ph@P @pO-QMp 0S SG Ѝ1`11@1P 0` "0 0 00  00P 00 0 00?o2P0S0S* BRPGPGOGOGOGOGQG  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOL   @P]ĖO-,MBP $X 0 C0 0qW `2`P1!0 1!N0000$0VZ0 S: p0*b 0`& 0 0$0  d1d ! 0!!WPPL ,PB  R;#0R7#0R3 Dr!P- 4l!P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍO@   @P]dO-$M@ZPP $ЍO!10 R0 01"0 p Wy 0 b0880000 R V R  Qd:^"p 0&O 6"0VIt 0 0 00 H1 !0!!PP4 vP3 = R$#0R  `  b0 C P 1 90C P 190 Q 35 5Uzw   `    4 P000@`]PO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D}0 P:v qPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880S000%0 0%00S0 0C00000 00 Ѝ0 P:@]\< C-M@pP `؀0S  S*Ѝ% %0 0R q\UP RQ 0RW0 0 0 P0 /@p@-PP@p`0@`TV@@Q> @%0% P 0 0%0P!0%0C0000}>0`0"#0 0 m/01#`00S 0S@@hV=9C =C00 0 0 Mb@BA-P` ֋@|pG L @H(PU@T D0D 0?8cЍ 0@0$@ĖX?gfffO- S @Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0pW:S' '078!800$0#1S<0P%1P%PDЍ00a]p@-@Pt `0D0034 0 0 %0 0%0p@p@-@Pt `080034 W0 n0 f%0 0%0p@p@-@`VPPpP 0V 0 10 V& [p0% 8 4 &#&#( #  % ( %    % (0 @10(0D`04`06% 36 3(00300%0(0% 0 000%0d0% 5 00%0(0@10(0QO-@PlM8 $05 8p%P %!  !  ( 尃Დ P& 4`8p FPP 8<% 0 !0 ! % 0 8p4`岓ᰃ(0:$00$0lЍX +%`p&bPP` 8<DT0 4D0%0 01 0102%00岓ᰃ(0C-MP 0`p` @0 0 00  00P 0 0@?o2P0S 00P PSS00 ЍSP @-@ A101H00H0101p00p0101000 20 2000@0040@][P @wG40!( ( "P @@ /-//-/-/@-$0$@ 3H5(ԗ-$M840, (  0( 㥪$Ѝԗ@-{H~^@-wH^@-@ᨴᦴ-C1M/ A-P0p`0ӷ@P& d0 0  0 ⮭ 0PP@wu(4004 0 004 (4Ѝԗ@-@(0((0M @X@-@0S 0S <P0 0  0 kP ԗ-/ 0!< 04 0 (   !/HzhzlzQA A-@,pP`10 00S S S ,00S PP(0",$( "(0P x@(40 0 0 (4ό3 40 0S 0 P/ԗ\ P/0 !8 0 0 (  , !/HzhzlzA-@P@`@p先E廈lԗA-@pP` |@PWA-@`pP >@Hp@-P@:>pp@-P`@#2pp@-P`@ &pp@-@`P101/ 000/p,1S//G 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  40 0 00'!2 0 08`0p,@(P$ @0 0 0!1 0 08`4@0p,@(P$ @t0400 0 0!l1 0 08`0p,@(P$ @] 0!$1  0 08`4P0p,@(P$ @G0400 00!0 00 0 08`0p,@(P$ . 0!x0 0p0 0 08`40p,@(P$ DЍO9^^^^^^ԗG,^G{_\ 0 \ /IzC-DlM (`}20 0 0 (2 0Sp * 00⤴P  00 Qp%p *T FW ([20 0 0 (f2lЍ  pP p 0S$ "44 8"TT#8X%XU (520 0 0 (@2 S A~0  PP !> 12! P0 P $00S "(P,PHpWh P 0Xp  L03P L0 Qp%p :W 00USx 28 Ⰳt'0 N3T⼄j'04` 0L 0'yp 0(P\j 1(0, 0 (0, ᇊ$P2!0$0PP4(180< 0 80< (1"$T#PP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX [1 0$ 0 0$ (f1 0 Pˡ P,ԗ^@-0S0SP0!0@SP R \\0 00 00ΕЍ 00]|GԗtEA-0p0`@XP X/@0S   P0S  7@ЍW0dS*@`h@P0S S @d0~A;~00C08@<00S 9)(0, 0 (0, D)<LT*)004 0 004 5)D=p؁hف 0 /p؁p@-`T~PpT@TP`@0Sp@4}) 0$ 0 0$ )@ꀱp؁hفp@-,@,P}0S 00p@}p؁ 0`( "4`#/P/p@-@P>ᡁ@P>p@-40 R@  000 ) 寧@ Ѝ@-40@ R  000  嘧) ЍX0 0&C-PMp@L} 0`  `0 P 00 000 0@?o2P0SP QPX@P QϧP,_}ЍƧQ {8-$M840, (  0 $Ѝ؁1M/ SG-PQp`{PW@(0 0U0 p`  P@0P 3SH L0SP0\ 00< 0CVh!` V UD0V SA  .QP VPpX.XBppSI>X p AL\ AL\0A QPV .RP AL\0A-Q \AA\  S^0 B H@-`P@M 8p.( .h`( .( `p0}9Ѝ^0@-ASS0CSꀷGGGSh x'B -Q̶GGG8G\Gm'A 0 0 0 Bd'A 0 0 0"['A 0 0 0 0R'A 0$ 0 0I'A (0, 0 (0, @'A 004 00 00 Q Q2'B 0 0 0 )'B 0 0 0 @2'Q Q Q'B 'B 'B 'B ؁P/<O-PM'U@|50S p50h5h%h0(000}9Ϧ(Uv p0( (E?0/S0@Po ( pX((0K0:00`P\(p)j 2PW 0c`00:0p0PP|1d4p000( :0,PR0 <040 P0#1 PIP0 S$ |!  S |!  W SW pG|!W^hGGG0/S0z@PЍH3xtp0<p|P* 8<340,0( HD]  PH0,(PH: U 20 SM .pu'p"Pp08B0` <k G  RpG|1W2GG(GHGhGGGȽGG  [ |1 000 000 000 000 000x 000p 000h1!0 1!`0!  ! X 000P 000H 000@ 0008 0000 ^]^85^O-M P0(`@P(pPP 060S $60S 0F00V <⭧P 1  Q9YEb% 8$(0 8$(m%Puߍ0`0@@0 wi PriP 0S!00S 50S  .m&$070S 40S  .\&00$07DP5%C 0$ 0 0$ %`40傢P2 0 R 0S 40S 0  G#0w7 k  P! 30S  .&0  *t#0Y7T30S 0  4#0D ?@0S  30S 0  "0| @0w 00S P 20S 0  "0fP 100S0 ((CTTP820S 0  "047P< R 50 00Sၡ  10SH  .%0  5J!0650+000 0VPd[=dqdxӣT10SS8.y f; 7  20086lBύ00d0 ϦP 塣务xxH0Bύ1@0^؁ ]g^^^?^^^ ^R^w^8@GO-(PWM@PE{}P |1 00U0# 8$(0 8$(#|1 0 00  0'S(㽣@P# 8$(0 8$(#|1 0 00 @0000 0 0S0% %` * D0ƥP D0 Q`%` *+7@V   圣@P 0 0`0: C0P,0 8>0S 0P. `$,00.0P5T#(8,(0 (8,(J#0尝B?! !Q#X:0HS,l=0S 0p. f$0J. `$200- 50SW0H S񟗖G G GGlGGGdGG GGG|1H X1GG\G800S 000 R0  0%P 0 Q`:Y 0<0fPPn 000[ 2xGGxG0GG/Up" 8$(0 8$("ᔢ|1 000 0040004 0$0[ 0$C [C "8(0 8("(0,0[(0, |1 80<0[80<㒥PPP @ 0 R 0 3SH0L0S 0 Ꭴ`P`@P40 R0  H0⃤P H 0Q:00S U  8"88<(0 88 4<($$0 4 $$="T(|1 @0D0@0D[ U%|1X0p t p t+P Mdx | x |M|1 000U!084(0 084(ZD80S U9 UP 0P0 S0%0 * L0 P L0 QD: 000S 70Pn7`;xP+0S00S$ 7`~0S[ ᅝPP 0  3S H0L RPp\0p0pG4pGW὞`700$0$ #44 8#80(00C(0C0S0CS"`p0<000SX SX  0t {`P  eP( B00S S5PP `V0S0`Jy 6$0 SXp\5```P Ppt$0 S 00CS50i 0S񟗞58100d0dY~I0 $0)8 Y "h hpWDpG00&5000S 0$0 S0S 00H0l0lpW DpGWV0`1p0p0S~?C0S`040bP P P0  0 80S 0S2<20 5Jw,0800z0 0 0 400 < V40< P0040M40CP10! ((0 0`|c(00(000C0,00,0$  "S  R  0$ ppEpW3( 0WpY (U 0 4M204pp(p2a|1 H0L0H0L0S|1 P0T0[P0T0US ˡP 0-[+[|1 X0\0[X0\UᲡP eXcX|1 `0d0[`0dUᚡP SSs|1 h0l0[h0l'UrႡP\[Ub00`0S0% % *0 t0}P t 00Q:00S6 8$(0 8$(A IWߍPp00,W0{ AWC +W_ p0V`0 0 0LP 00 Q:``V %PK H帰 00   "bP 0  bP W (3W <W R00  x0 P x 0QF:00S  3W Q  Qp R00  |0Px | 0Q(:00So  [00  0֟Pa 0Q:00SX ,R P ,00l{0@`:0000 00000PpS00,9  92#0Sl  3/g9`V!U d 90S(00  0 `.奙( 0^P(g 0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U %pPP`d D;0S(00  0 .G( 0P(.œ00K嶜P0T 0S P0T [ 2 0O-@P`DM!$7 ,@0 0 0`(P$  $ 0:p!6 ,@0 04`0p(P$   0!6 06 004,@0 0 8`0p(P$ H6 00'!06 ,@0 08`40p(P$ 0405 00!5 05 ,@0 08`0p(P$ ɽ0405 00!5 ,@0 08`0p(P$ 岽0 4008!45 ,@ 0 08`0p(P$ 国 0400 0 0!4 ,@0 08`0p(P$ 儽 0400 0 0!4 ,@0 08`0p(P$ m0400 0 0!(4 ,@0 08`0p(P$ V3 4@,@ 0 08`0p(P$ @ 0403 00!3 ,@0 08`0p(P$ ) 040<3 00!,3 ,@0 08`0p(P$ 0402 00!2 ,@0 08`0p(P$ 0㘢40 0 00!2 ,@0 08`0p(P$ 040 0 0 0!(2 ,@0 08`0p(P$ ̼0401 00!1 ,@0 08`0p(P$ 嵼0400 0 0!|1 00 ,@0 08`0p(P$ 坼0400 0 0! 1,@A00 0 08`0p(P$ 儼&F oo0 T0o@6DЍj^^ G{_l^Gx^ ^ ^^-^;^J^ V^f^`^8o^}^ ^^^؁Gp@-P `@loh 0S Q0P@@@040p@oPop@ F08PG-S@`p0 0 0  0  0 0 0 gX 'R 3SH0L0S(ず@PG  0  RV WV R R R R 0S 00) 0,P,0:S) 0R% * 0~P 0 Q% *D-Q 5 8$(0 8$(@Ѝ0 #0C?o231 ĊP (MQMao  #RH L0S0P  0@0 0 0 o0H   C/R00C00000T 10S q?!p,0( 0 (  /R 3SH0L0S0ٙ@P  M^ K^(`)p0, 0`1 01  ({؁^Tف ؕ]^O-0p'S(,`(㠙@P  P ] P ]P  0 ЍO@ЍOXЍ@-0  ?؁C-0@p4M|d2`PP Q7P1HnD2DR420( nV 0SS*4ЍC;n9n I1`1 V@P  ]]P  4Ѝ⥖@Ph 400   0 |P ᔖ m@T> npP XX႖@m ᐘpmWT 40 Xpp` dU0030# 0S H0$U0*`B 004 0 004 `Pdp03/@8G؁O-ppPX00S . 0` `0000#[ QI ]^H^^فY"I0]]^X?HHف@-p@`]0P p@3 Ѝ@-@e @5fp@-dP@e0SA?C p@@(f!R1S A?CSP فف@-@D P0QQ  00S 0R  4Q DA-@p`&P@P e&A-Pp&A``P@  `P UIe&p0S Aفp@-`DP@Tp0S  PUP $4RPD@A-@p`Z&P@P eu&D@-`P0 R R 00SDXp@-@`5&P@P eQ&pp@-0PS0S0S 0S, 0S00S% &A &P@0&p`00#d00#h00# l 00#&pAفp@-P%A`h@PT&p `P0 %pA@ف 0 S 0#/00P/Qp@-@p@ L"P 0 SRp00k01p^]SRG-M#p4QP@ $Q !BQ -Pg  `VP_ R R RRQQ`V\$U9  BUU 84U 09  ` $$0 0$0 (0$0(0 ,00,0 000 00PP4%DFP`o1PO%.0P9` $ kP(1PЍ`0@V$( R, R $2p HV 8H X0  SX \  d 0t0 0x0 $S d 00 00008 900 P!U   $0S DZ  wS0 $00 000 000 00 0P1XU p H 8S X HO/ d Hd D00$08 0 X 7RPP?#0  ,RP P2 900' d^iiikii G-9PQ@`Ma V9Q] ; 6C0CQX 5CjuPio iJi( i i Vi?Pi ߖ>Ni0iKiǯ> ~$ni i ixji >Ki Ii %i Qi >!i O-pTODP@`UT D P5TX@@0S0 00SDP&O PT v ` Z` `$4R@@00S0 800S DgT@ 4Q@80S/A-3`A0ASHM:p2!DPD@$TM!4HЍ00S1r`@!0 000S)OjP% 00000S .`   00 003d0!G PJ`D @0? X]!^X?@-@9@A-HM`p DP@T  |1S  00 0HЍ00S! ` oG00S .` + P P0x0000 P_D@ g]:^@-@|1@~sQCp@-@P P oppp@-`#UPUU:N r0@0L0`0D00@0 0<0(080,040D00040,000s@p0G`GGGGGTGGp@-P@Ms0@`02_s;m_TT Mp@T0008C00 0/p@- @Ph!>00000pp@-@P Z00000000p@-@ M Ѝp@-@TPTPp@-@0Q$MG 'R`l P'RX("($( 0t0  0 \ *P- R00S"!10!0!0!0!0 0$Ѝ@\@P R000CS1R^~^A-`pP@p200SD0CSX 40GS* S( #S_ KS% Ѝ o\Q\ X ^ QPQ `P H000S D0CV`#0F0 GP  AP V 00#S0  .o`%S000 00 00 00 00 00000V0S  L0000X`QRI p@-`@M 0 C.^^ P?R1  000 C0PU'X !X X XX `0 0<000x $MP`ЍpA ER PPC/C-40@SOM S $ R0#*50S %0OߍC\ R |1 0 0 0|1 00 0Oߍ@D  Q :S S #3R t40S h$l0|1 0 0; HT, `P2 p o4Bύa`a`001411 0``1P t30S 0t#t|10 0(0 ST#2q12L [PP `] *2P<2034P09}P 20S 0"XT lPOX20S 0h"l,20S 0008"@000000 00000000 2LP1B110 0141P /P d10S 0!q3"p'qr\10$0$PU ~_EUX ``e1` p`<<0@ 0000 0S 0 |T P0 L00S P0\ P*wy1(0(PL\ ]^^]]]^']F^t^^]0];^z^HH^^@-@ :[4X @b8H0O-,00( S@(M k@P 0<Sc@P 0b 0 0bx"#2't1040bt' 0ՅPP 0 K0( 0",$ h((Q"dhd& @ Q         R/ R !! ,P 2 0!&Ȍ 00 #8SP 0Spi@(`00pY000W 0Spi(0Yp"`Q  Vp0 ,20`0SV0`!2piWp@-P@Tp0S 8`ᅄ0P H R}y@vO-`\M@8T#80$0p0$00 #44 8 #80  QU T 0$ RP\Ѝ Rg&0RcQ R rd  WR[ RS RP r6dD RA R> r;Q R r[ Q R Y  R% ZA[ RY Z R Q R R R R rd   PR R R rd   PR R [m ;/000$ R  2/P [Y P"0R R; R8 R5 ppWp Q0Q-Q*Q'R R R R p W Y  "Z  R W  pR R r $  8P R RG-(@Pp,`PM00pxxp'p0S.0S0く RF 0S 0S 0s 0hP' (00 0 P" (00%0PЍ#  ! Q#3 P 0 P 40 X 40 X 0S2 P0S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 06i0SA-6PS0M0S  0Ѝ0S0Ss0SQ@p) 0S0S/1;FPH0S@ 0S=0s  RE`0Z P1(0@00Ld-0S  n!> 000S XPd0*10S d0XP 0 S0S / ]0SE0@-@8P<$MP 0S$ 0R PP0S0S0s!.0  P $Ѝ0 PS0S ,0 @@ǁ/8ȁO-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! * ! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  UP! R R R R  CP0  {R 0  0sRd   @0O-M000S `Ѝ0PS0S/`0S. 0@Sp(00S% 4DP`0SK 0SH0sEd0 0S0S0S0S090sP3#21208S, 00P0<0 P 0 PPQXD XEP Y*0S0S0s0S0sPU n!>6d0刐 p0(0l 0004bP0S100 0 8,P0PS3/ U,PQ <]Y |0,%S 0S0S0S0 0XPm0j0S0S 0sS0SQP 56l0S (0l00L0t0 l6P5g 00000S 70`( "4`4# :000QX  X 0S100`P6Uy ~ aP `1`0` O-hp&h &TT$M 0X ' "%X " A  TpzWpp) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @ 018E 0AT 0S0S d0 6S 6Sd0  uP @0S0S d0 6S 6S W d0  YP @0S 0S   0S0@@H]0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "A-0@SPM0S0s  0 0h!0ЍP0:taUP1\ Q: 0 CT0C2T* S 5 A%CPU^\Q:ࠃÅ0S:3P50\Q0ࠃÅQ:0CPRQp Å0P0RS5W0P0R^#05W0P0RS5W0^P05^^p@-@08M S8Ѝp@vP`.q "448 #8008Ѝp^ 0 /Ŝ@@- O@(]Fӣ4EDN>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00فG-@Q MPp@`I YF 0S A`0d 0 `0d /@ Ѝ  0}P 4@@ V } }pA0 0 0 A@ H.PH0S |1 X0\0X0\0S/ 0S,0s)  0 }P T @T  R H0C@Q S``V |1 X0\0X0\?}00@hفO-x8M#2尀崰1(20[H`00p00DlpSX00Z 0S P V@PA [@pPUXHT0\00C?o20S, V@P' [@ZXp00 .ApP00$0,7 0@00000@P0 0UA_E0UY 1p@ @l0D pP [BZWX* @0S0S0S 0S pplPHvH0[V40@p 3pApD|[(ZXT`UL0 T ]PPUUL0 @&YZ@pX5(#2!12ЍZ@aXTzPU @X0S0S0S 0SM  nu4t`T6 lRP 51p @pP [pp`[@ `< Hi@PA<0$ R=`0l3t 00x0S/ 8 lQ@P)4 lK@P#8 40R030S `0 H,0P` 0s 70@0P1D0DPU A_EY `T?`X0H` 0 00SHD?`A? 0`S  SVX`5?` 0P0P 0  0S0s 0s 0@0P S0@0P0s ݢ0@0P0s Ԣ0@0P 0R)T0Ss0<0s0 Xk 0<< R<RZ | r%! !Q$ RnTR  V` 0>` 0SX>0 Rg0 `T R QRM  #  RC H`,0&0P,0;R ف| P P/Q|1 00/p@-@PL0@ 8Pz P H@zpp@p@-d0,`P( 0 0@M 0  0"` `P P!PP d0!3d0"44 6cЍp(0 @-HL H  < فC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H P0H000H00@Hzhzlzف|10SQp@-HMPH <0sHЍp$P 0 R0 $1aUH@, TPDPH @L00PLP P ,$P @ PP ,$P @T-/0U0L0 ꔊmuHف0-C-@q`^M@P@0D 0 T@0D 11 Xp!xf?!0Hp . U. PPT 0@@00p@p A ^ߍCЍ/0 0 0 |1 80<080<hف^^0O-,00\Mp `0S 0S  0S0S0S5 0S0 5 ~QyQy\Ѝ50C0( 0MRM.{h5P^0S H5@D<00 ,0<Tyy@P+eG0 0 0 RU0@;y@Py@PD.0 0 0 9U 0 u0,(000 H( $>=P H= (00$0 4 U0  $ &=P$ (0R< $ ($=P Hc=(0 0$0 h3 H( =P$ (0HR0@( D0\0* c<,0 <,H0S |1 000U H0@04`#000Q 20S5 00``'H`3`= =80H jP r <,0 <,Ua (Y 7Y 0 W)P 0  R b<,0 <,m8x=@0HP H0S |1 X0\0X0\C@0D 0 @0D :80< 0 80< EH0S |1 H0L0H0LZ #H0L 0 H0L .U wX 00$UG^^^hف^+^lځ-$M840, (  0gm$Ѝhف@-(0@ R+`p 0sP3T( PPQQ0SsPU@s0 000 3SH L0SP0\ 0 t@ ЍP< 0CU* 0sPO-LM  k 0@P`p㬌!< 000P,`(p$@ @@ @ 0)!X<  0@04P0,`(p$@ @@ @< 004'!< 008P0,`(p$@@ @Θ; 00!; 008P40,`(p$@@ @帘t; 00!`; 4008P0,`(p$@@ @塘 040; 00!; 008P0,`(p$@@ @劘*0@ ml 040: 00!: 008P0,`(p$@@ @n040\: 00!L: 008P0,`(p$@@ @W040: 00!9 008P0,`(p$@@ @@9 00!94 008P0,`(p$@@ @)040`9 00!P9 008P0,`(p$@@ @040 9 00!8 008P0,`(p$@@ @0408 00!80< 008P0,`(p$@@ @040\8 00!L8 008P0,`(p$@@ @˗8 00!8 008P4`0,`(p$@@ @嵗0407 00㬇!7 008P0,`(p$@ @块040d7 00!T7 008P0,`(p$@ @冗0407 00!7 008P0,`(p$@ @o0406 00!6 008P0,`(p$@ @X#040h6 00!X6 008P0,`(p$@@ @A&0 400!606 0<008P0,`(p$@ @ @(5 00!5 008P40,`(p$@@ @l5 00!\5 008P40,`(p$@@ @0 400!505 0<008P0,`(p$@ @ @'0404 00!4 008P0,`(p$@@ @˖l4 00!\4 008P40,`(p$@@ @嵖 0!40<D 008P40,`(p$@ @@ @坖 0!3030 9)0 9)|1 0000 0 0  0N >(   r RJ0 0 0 |1 0 00 0;K9)0 9)R @ t=02F?! !2Sd2a8(0 8(Y8(0 8(0'S(Wr0`Q E0 0 0 P|1 0 00 KQ6 Q! Q Q^ `00  2dP Pd<,0 <, P0 Q $Q Q" Qq90 0 0 |1 0$0 0$ q_\( \ q Q$Q Qq Q P q Q q Q q 0'S(qP  0 pr00! !0(  iqP <,0 <, 0` 6P {0 0 0 5 P 5 P50P09a0 00S1|1 000fPT9pWP pF0 0 0 @0D 0 @0D K|1 80<080< q88LD00H00 \0 $0DIq$0pSB p0 0 0 I|1 80<0<80|1 0 000  wF0)S(0 (0RrP 0Q*t00 4d 0 0 0 & ,0s 40S `0(( AR*c0 0 0 |1 0040004(0Q Q0(0 C+l0S%T3<0S  P o@0D 0 @0D .Y@0D 0 @0D Y  o0 S  0lb0 R R r  R R 0s0 0 0 |1 0$0 0$BqP0T 0 P0T |0S |1 @0D0@0DW  0S00:S{|0S*@37pWG DA+,Wu嬡h7h'W0S0Aᷡ@ЍOV L_}@P ?Xc0SP@ЍAPP N@@# 6VR  ⤗3@03430(BPN0 30P""##4 R00Ǒ3S86@|0,6 | @G@ T -@ |}@P@\ ||@P 0倅0# 0# 0# 0# 0# 0# 0#01Q5 %0 5 %U5%0 5%0``&0`&0`&0`&0`&0`&0`&`1q\ P $P0S  P  PD $P>0S;  U+ . LPc. _00; $ 0P0|;<3 0&&'0 x000C0吠Z PᐠpWUe 0q`WV2P:7@"Q  <g d2 P" $P|;<3x0S00C0xPp |PP; @pЍt@P9W~+0 @@0 0Z@P d0R55-pGWHHlHHHHHHHHHTH H$H`PP  L8P X0)3SQ10" 0S20I0S@8 0R;0S8@T5)@1PsPP0  R00sX800 sP0S0ĕ8#2120 000P $0 P @$0( 0 ,0s pB_ P7 x `V 3S100 $8#PpW0 $V P 0S 0 000V $P p4` UsPr408 0<0sp^fDP  7P O X "PMpWJ X 0X PQ pD0S85XpTP05PhJ"P2-0Js@P0S S Sd04^d044Zd044Vr@P傱WW > 50S+W$,# GR@zğ \ Rv19@ 488`40ⰰ0P 0 1`60S .d P63`&`1`00>h@`0d 0 `0d KW |1 X0\0X0\V1@SN0D0SMx1S500F00< D06@PPPD0H03D0PS<Z@P `0d 0 `0d 000BU@ |1 P0T0P0T6@ DL P@ D0 p-P D`0d 0 `0d 0@0X60= D0 SC 4@ R<000000> @ 0<01 SP<0SD 3Jύ$ 1T0 P08YP U`H00XD@v  Xl*Q mYJύt00P% W`$<0R00@ U0<<0 |1 0003SB`0 0 0 kU |1 X0\0X0\3@3 ^P x1S 0S  @h0S! 30S00S20SX  @ :P $R*X&Q X X0<V x0S  R SU@0S 0S L0(0@ 1P>LP@0 @J@P@0S `<,0 <,}F (,0V <7 4 [ l@0 0 0 (@I^ ]^ lځ hفS@D0/ Q0*$ P奥P0<10.Q[R0S0Z0S[ >0@0P @ $(  $R@1,@@0 3  10S 10S @ ,000,0 $00 @D<4X<0PAX10S 00UߍvS A70 0 0 B@ X*A(0 0 0 3Ud |1 h0l0h0l[00S 0(000",4c8<0X00[@00(00S0 0  , @,00 #  # R 30S @ ,000,0@8#8 0 0C40 XU, |1 `0d0`0d#0S ,0R  0    0SP@ C`0d 0 `0d 7@`0 `@0W@PTEo0P0l 7o0P @0- IXYR0@ 0l 0 0"o0P @ @$P@0/@L0 8(M | ЍQP@p@-PBTp ␼P @@-`@4MP 0S   1pP P0 P$0S  bP 0  pJp0p0 X,p30@P(0@Q[0sQ4Ѝ@]Ԗ]2i@@-@ 00CS 0@p@-@P[Qp@Q@O-LMP`4-pP  0R@%@ * $0vVP $0 Q@%@ *LT@C, 8$(0 8$(74,0 R S 00S0 ;P0S S`@`0SQ,@P 00 0t 0$`0CS 0-8FQ3 00 0 0 0S1$  P0#ddPhB&hT   ᎻP' 0$ $0S!  00 0 0  zPV 00 0# 00$0 00CS 0 @(0s 0 0#30(0 {@0 4R0 ^P80 Q 0C\?@3c2#V: R0SZ=9 R =@SLЍ^؁@@]X?MbG-0Pp0D MRP|`P 00 05h@P700. 0 00@(0 p݋ 42S0@0B00 @ j2P ԋ0S   <iP ЍY(0$0Z`O@H1ip@-@P(O#P p@GP@p@-@P,`O@9PTp@@-@HOP@0*P0 J@0T@C@O@P@P@- P $PPPP@A-p` P@P700 0 ?P@@-@0O00P O @ 0O-p`\CS0 p.0P00%U?0T000 P*10@T ~ODTX?X I @-4 R0R 0 06: Ѝ I0S"p@-PX0\ @06S jP `N6S006?N00C0p/@-0@0,M`S6S 6Q0C?o20S ?,Ѝ@N@0 P pt0\ 00 00P p$p`NUNRN|1]:p@-0PM@\`P ^(0(S00 Q 000 |0 00@X0<8@400 `4 L@`PЍp0  @`eH]C-1威娑1!$M0巉%#2a12p1P00@TAOD.3"`&ab%$Ѝ10p WAG%0s x0@0P P~%$P  %%pP@T%0s w0@0P 00 [ P%0 00_ X?D IفG-|1P`p M0I S9200S D0CS@TT/  p  0  0 0d  3 ɿ@PV 9 p Ѝ  R   ` Ra R H0 0 0S" 00 03 @S ؐ#212 00 020@T D@DT 3"(00S #%  000 %H00@{^0@-M@ L墈埈00000 0|0c00Z@P  ``XP0P $噈0@ Ѝ0@蒈 X]tI^]^X?X ID Ip@-PW@0@0d000?00:<0?00 0400S 40S3 !0 0p0uh0p@-P P@ᤜU0 @@@D@H @Pp@0Sw A-@`pQ@ DR HQ0PP ᅜDX=QsC 0 0 0 }P r01 0S@0@Hp0C Q6dIdIIdIdIIIIIIIIIdIQ! D R   0L S H0`S@1A 0 0 0 ;D0S H LD R $ ,H0S / ؁]^W^^Q|Q/P/7p@-@P "p@H0@-@PP0$M @K|1 03/P:L$Ѝ0p@-0 M @`NLPK|1 0@4/@LU =LT06 Ѝpp@-0@SP M 00StP  P0@o ЍpE`X%P 0U`\ P KK0P 4   H RKK0P/@- Hk@>@-|1@PL2`PM 0CPj 0Pp 7C0CPVP 0P00PЍ1PD (7C 0CPC 0P p0 ]PP 3`PP 6(06 06$0Xp\00p nup,prK<1P 0P,0S0pW 0W p0'u?0040 0S0$f8 0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$P KVJx00Cx0,Ѝ PP 0 `O-Pd0D0S 8P .00 04P@]4]^^^^ >^Sp@-@P@PXP`aP  03/@kT@ P@p*@O-`Qpp0,p20 Y (0 0(0000@W0@00 A0B p(44( :00r000Y0ppH vV |1 000|1 000AP4T$0 P4T$#HHzl1p 04 0 0$00 $0. P HGGf14p0,00 0 H0,DP 00S  .p p0a ܔjP 5p(0  pp0(00 00@Ȕ0q@0Ap 5 B1o؁ O]5^A-0 p003A0AS@`ŅPE%DP 0  P` Ѝ@-PHP 0 Q@@ TG 8$(0 8$(`Oߍ@0  ` 0P0[H 60S @. p. 00 0@&@N`,F0S  .0& @0S .0 0%40S .@ %0(EC 0 0 0 U"0( 0, 0 \5R40S80S<0S& 50S %500001P40S  .00$0@0Sl40S `$ GP040S  $D`tH`0 EFp0WpS 0S0S 0W?o20S 30SS #00@ t 0b`P00#h3`0`B@P 40zB000St `P 000jB00000@P0W 50 00 S |20S .I500L"x0P ⍬P 20S .!,0<u$0 (0,0 QjW 40" Hp  ZQ- 0Cot"0( 嫲@0, /p1` P0@0@ S@0@$0 0S032@ P) [ 00  O0S 000 0 00 @0@ S@0@$0S032@0@ ^؁ y]^^^^^^*^h^I^y^^@]@  8G-0P8M ` .K 0 08Ѝ` R008ЍGS 03 X1xq@ `P T X8ЍGST .`  00 z|P?0`` 00``0@0@0S `p.` `0 p=Y 0h |1 00T 0H @a]|<0 $ ^8)^ ]]^X?Mb\6I@p@-@D? -PPp@ v}sp@@O-@Mp`,PP4 0S 0# R @` .pp0.   0"2H2X" `X XD P~20S ",C0 00$ 0( 0  0R p0TEP p0 QP FKA 8$(0 8$(,Ѝ0S00S t1|a0S .@$P!h@0qH!000(1 0R  0EP 0 QP F | R 50 00Sa  l00Sa .@pXl005 `FLX, @0P`0 00` ]^؁h^^}^z^^^-/1 @-$01019/]/-/-/-$M840, (  0*8$ЍD@-@5B3B-@-p0`0d 0@0S P(00   0M>( 0KZP(`@xY B B((0, 0 (0, 3 Ѝ1M  .YD@-@-'u@-80@0SgP 㖺00@{+ @-@Y@-Y-/p@-@8P8`ᘰ/pH@-0SP0`000S1P Ѝ~S 0@S0bPP0S 0S0s f0pS 0S 0S 0S@x 0P 0 1P -/ 0!< 04 0 (   !/Hzhzlz0O-TM$0`1`0(0(0SP ~SN 0PS/@?0S@;00100@P0#212$0,p<∀0 p 80@P $0P0 Q S R` X $#2!12TЍ LP @1@  0O-@p`\DM!h! 0  0,p(`$  @Pqb 0!! 0  40,p(`$  @P\b 04 00! 0  80,p(`$ Db 0!| 0 t  84@0,p(`$ /b  固8$0DЍj^^HG,^JI{_DO-dcP4M0 0 0  30,]pP0@ 0M c@4Ѝ0SD0S S?0S0S0S0S  6P-0S0S0S0S  $P0s. O0 0 0 Z (0Q@0 0 0 K@TW P 0 0CCP PWp@P ( 0嗴 80>@P#RH L0S0P  (>@ PP >JPu08 80 p  ( 0P0:S80S& |!  V V F|!Q2[I[I\IP F|1RS@\I`\I\I\I\I\I]I ]I@]I F RB`]1 01  g0S4<02,#2!12Ѝ  R|1 000 000 000 000 000 000 0001!0 1!0!  !  000 000 000w 000o 000g,@ƽ004 0 004 h ؁Dp@-`1@P M \8@0 0 ,P@\9@ 0S/@0S@ m= Ѝp7@-Q@T0 QP   Q Ѝ0P QP0S)T   Ѝ0@f@iTdTT Ѝ0@k@DT\ Ѝ0@ \ Ѝ0@2 A-PpXM00 00000&@P& dVʀ0! 0     !0 0 W@Phd$@P wЍs0Pp0 㒵 HzhzlzHs@-@P` 0R0%0 * 0?P  0Q0%0 *S @м0 0 0 ۼx R ! Ѝp@`帼0 0 0 ü 0^hف@ 寉p@-@@ " " #@-0@S00S SS000C0S@  0IP0S]]0S0S0S R @-01/pp@-P@UQ PP 0S  00S` P pS 000CSp8#<4000p@-0@S8M  .\00 00S 00S0#TTX%XU `P S 8Ѝp 000CS0P0]^@-@04P P @0S00S 8#<S000CS/@-|1`S@P( d 00S(00  0  N7 0SPP@::80< 0 80< 'RЍ-/p@-@8P8`εႩpԗ-/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/Hzhzlzp@-PUL0 T@P 0`!@T 0 p ԗp@-@PR#pA-@0S0S0S0SpP `@TQ8@A-@`pP w@tp@-@P0S0S0S0S {`  &Y101᛺p9pp@-Pe@QGpp@-P[@#p@< 0O-@`PDM!p" 0   0`,P(@$  W[ 0p!$" 0  4`0p,P(@$  C[1' 0 4!! 0   8`0p,P(@$ *[1 00!x! 0 4  8`0p,P(@$ [ 4 0!0 ! ! 0   8`0p,P(@$ Z 4 0 ! 0  8`0p,P(@$ Z 0! 0 |  8`4@0p,P(@$ ZP5<0DЍOj^|^ ^^ ^ԗG,^PgI{_0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*T᪟ 0&5T 1!00 Pᔟ100!L&<^^H_g^^^s@-P`@P0 @Ѝpp@-P`@P @pO-4MP`ޑ@:pP<ڑ4pPSq0 0000 0$0 r`  R81#811/*㔡X1*:Sx |QxR 0[ |P PE 0 ⰱ 108#8)1 P 00U4ЍɎppP {pP lW {P{Ppx{Ppp {L0 X*L  7/P ^^^\ILIyara_V_h_ I_U_ I{_p@-P@P^ pO-`|M@P>p@p8;@0 000> PpW00 'P Nr|pP `$`'0V|ЍqPP  rP | rPu d( rP 0"L rP Z$ 00⸅T0 0lP`0(0p00t0T=PE Pᴊ0 R  OP  P"QQU1[P#* E 0 3  P? 0P01hd  R:ahP 9U  0 SRhP *`r0S<0@0D0080$0H000L040` TP080 R\8X&_^_a^__3}_y____:__I`^P@- P H0S <0@0S RO 8I@-@ C-(M@ 0P``}0PP2 !VP.  Ru*  Pr  Ro0S `V!0# ! PP_ QQ0  㪪 `pPP V  堪ЍRD ``;pW 吪0p  SPP  0p0 00 0P  UP  Q 0 JPW bR   S` P|I@- 'PZPZ  Hp@-@ `PP P 0S Pppdp(00S0000S01/̀̀0   (0S"" /P/@-@, z~ @p@-@`P P@ 0S 3/@P@pC@- @R 2/@5O-LMp0P| 0@tpx`d 0SQ [q 00V 0! V V<'# ` $` p"`0 Q$%``$000 @`0 0 ;/ LЍ $0m0#i e$p$00 ]WH00$C`[V4@@ 03/P) [ 0p0 0|@x`tp LЍO/0S 0 3/P0 03/ $03/P Y@p[ [ Y[ 03/PX  0G3/PpZ@YV @0S[  $0W3/ 03/P @-0 0  00 0 00Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/Q @-/_P/p@-@P03/03/(  03/pp@-P@`03/0 V p'`V pp@-@`03/ 03/'03/PPP'03/pG-@0Pp3/`0 3/' 03/`P` 03/ 0`'pW0 3/ p03/03/'03/P'03/03/0 S \`G-@0Pp3/တ ` `03/h'03/TP `Y'03/pW⩐03/L' 03/7P03/ 0``8'0 3/03/03/  QA-p@` x0xS  &0 A Q*PP Z%Z@0 !P0 0  /0]p@-@P`kP $0 p@0/pO-LMPpt0 000000 0  @u(P%40080\<400400000040  000C00LЍOLk (0 ;40 B0 [P40;407LЍ8pW  H0qZ \-Z0 D P   "ZTЍ0 p?$!_Y_A-@0, (` 40Lp& 3W R@PQ]0 7/(0LP< 5/,0> 0,01 0 c@?<۵3Q#3?P [@P # [P0  R= 080#80C?o2S>^0 7/,0@ 3 #R(0\\Lp專0 0,00 <0cX?q_TIA-@( 0  R    RA| ` p  fP ,]@[  [Lio0 8/,0@ (0LPd0 5/(0LP\0 A/@]x_7@-@(0HPM 05/0<0(0LPB0 5/040 Ѝ07@-(0$  Ѝ0 @ Q 040HP 05/(0HP0 5/04 0R40 8 Sps@-,0@!;90(0LP 05/}_(0H`0 6/0Sw"PU 0S , P(0L`؇0 ;6/Ѝpp@-,0@III IS8  0"S4 ЍpS  0"S (0HP| 05/(0LP|0 ;5/$03 (0H`| 06/0V>00(0L`| 06/S  0"Slp@-IP 8]G-P|p@`9  ⯳<0

m`@P p0S`V P @-@0   00@A-pQ0@`P VP0QcoP `O-Q4M`0I@PT`C P= 0   q@ |p0@000,  ( @$0 4/`P# 00$0 0,0(0R@N 0 pS0 @ {P ^\0  03/`4Ѝ0@00 ;/p? 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8; S 0 0//Q/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ|5J$5J5J$5J$5JX5Jl5J0 .0!0 .00 .00 .0/5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /A-3A@Q6J6JX6J6Jd6J7Jd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P 000T@{4\Q@- /6Q@-/%QJ 4A0&S2&Q/<:J9J$:J4:J9J9J9J9J9J9J9J9J9J9J9J9J9J$:J9J9J4:J9J9J:J9J9J9J9J9J :J:J9J9J9J9J9J9J:J,:J @-0 .0!/  /9Q/Q$Q !0AS h00 S 0h0@-$&Q>0AS h00 S 0;Qh0h0 S/1 l 0A!lTX 0 AQ  R 5` R  R  d    BQ / d /G-<0@@`p  d0P3 5/0pW<0@  d03 ЍG/P`]PEUd 0D32aP2"5/ PPEPEU+0 pD07/`P!  00O D0R P5/`P  O0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SBpNJNJxOJOJOJpLJpLJ(PJLPJpLJMJMJPJPJpLJpLJXQJpLJpLJQJQJpLJpLJpLJ RJpLJXRJpLJpLJpLJpLJpLJpLJpLJpLJRJRJpLJLPJSJhMJpLJpLJpLJ_l?p$?_|_^____ __4__&_-_p@-PUpU- @\L0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0凒 =_A-@P` 0!0`3/V0p4`e%n 0!0p3/ W]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@]]; S 20/ <8#8SA3=8#8SA@A210/</t2>08#8S P2AAP00/<0 /<0 >8#8 S 1A0A`0111Q 0CQ 0CQ 0Q1 A+AQp[J[J[J[J[J1111|1 p1Q 0CQAA Q񟗼\J ]J\J0]J]J\J\J\J([JH]Jh\J110/>08#8 SAA Q\J\J\J]J ]J0]J\JH]J`\JZJ@]J\J0000000000x0t0H]b___/______h________n__r__v_~_z___p 0S @-S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< 0PL  D    p A ,(p$00 0< @Ѝz_ $_<0S/@-@0"@MӀSA-@ S  pplP`p<P   03/@DNT@ @AZY꘧]_ˀ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@p`Pp@@0S/p@-P @ 00 R PD  qu@ 0P 4p $^J@0S/@-@@\u0@04@# O-D0Z S(@3?:pPa0 S.  S lc`Bv @ [V`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800L@P <_A-@PpMA@` 0 Rg@'A-PU 80p`h0@4pn谧] @-@e80S 080<0S4@ A-P0 @R <"p0CS3 : `#pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/P //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@YT00@-Y004p@- MP@l T`sP 0 R V ,Td ЍpRV RW SW lp@- \`PF0S@0 00P00CS0ppܪ@p@- 0@PFPP  p@pܪ8@- (@{FPP @ܪ0 000/G-P`/YP0@x000000X0Sp 0pW0S1h0$h00h뜐 3 \4h0  @0l0 0p000000t0h0KP 嫎h0|0000(00,000000S 0$@>ُ!TP XЏ1̏Wcz P h傏0\ PL P8Gr$_Lt|J_($_I_&_^_eJa^_A-`MpP0XD4@V >44V (4V 4V@ 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQX3V] 0L3V $@3V X 0 p屆`P  h [h X2Vn 0V`P2VA 2Vp 2V |@000000000 0 0 000`1t l00| 0pЍA/g 0     0 0 000l000Af0 0000 0`PdA Ѝ? @000000000A00000H0 0000 0€`P@ 0 R 00ЍA,0-h0 00P0`P5 PЍA ``W W @W@W @W W@W @W@WWW W W W WW($8$@-@p`oW0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0 ЍP R 0 0q`@ @T@@~fvtA-@aP( ?D0 pAܪ40( R/$ R R/  /L@-4( \0^@/LT0Sp@- @RP 01l0p0p@//@- @ P@A- P D@PP 0SPPUPX0S PpWP0`P`pPP PpܪD@- 4CP@T  P ܪ 0!< 04 0 (   !/Hzhzlz RP RP {//C-QP `M 0q<0 0V@p, 䀖XW Ѝ0 8/P 0S 00p W0 0CW) T ,6W 0WT h0 0 : STP 5W'= W: =GTTh Tp 0: 0: 0h T 0:: 0h T 099>08#8 S=;G"0C S $uJ,uJ,uJ,uJ\uJ\uJ\uJuJuJuJ4W00G?o  24W00G?o  2|4W00G?o  2 0T00 0Y  00 e @DoQa Q^ > Q[ QXe @z 0T0 0 0T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T p{' pTP {-t0WppS l00p3/tpT TP 4 @@a0D8#8S @DH$H0S;K; S< S {:< Sx@k1Tp0+ 0k0S0+ 0Ab c0C S@0}p@ 0; 0; S 0 8T .T T!  0@H$H 01AU/0D SyJ@yJ@yJyJyJyJyJyJyJyJ@@0D8#8:S@@DH$H@@01 $'* @-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 04,0 L$A-PHTU@x0S( P$ST`T0V S0 PVPRTpT0 0/l00p3/PPT`TpV@ S 8NT0SP `S __\ P/0 !8 00 (  , !/Hzhzlzp@-@0Sp@P0PS 0p Sd :!.T0S` 0Sh0T0`!X?Mb@-MPSX0@S `..x0S 0$ P`V% 00S" 0p0CS00 00P k< p00`  P `SH?<U@TS0 \MЍLX?*_1_ħ]Q @-p/Q_p@-`P0@ $  `P0(0pLpJoJzJp@-P@PPP(PpL@-Mp`PBS0@S 00%.WD0S$  hPP:TP0S4 S P0 0!! !1Ѝ@-h0U h0TPP @ R 00`SPU0P00 P R 㔇ЍX?Mb]_p@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ 咇A<}_p@-0@SP S`b `? < Rp؜0000 0O-,M @p P@DQa|뼑t',Ѝ0PU T@PU0 T 0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `*0Co[ 0 SQڰ  02"__p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pPPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p)@@- @ 001P)@@- @ 001PE)40 60 0 1PH/)/@-P`x@fp0lpp000 P$p0@@0 P0tp0 Ѝ_)p@-PP@0S ``0Pp0p)_s@-PP 0XP\0p0@`0\0p0T0S 00SPQЍp3/ t0S 0 d `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HO3PV '>C 0CV 0CVP x300 l3V P0ST0S g lpWX` ,3V0t03VV 3V! 6C0CVP 0VlPUQ 0 0RnuO0Pi2V`lPpU``PP trttRdpVʀ 0! $ 0   , !0 00 0W 0!d!0   , !$Ѝ0S S S $ЍOPR X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00N\PP $ЍO4P R 00S0<0_P 0 0q`V PP0S 00100  0;/P\p3vt`WW~fdWcWHzhzlz$ 0)p@-`P f`t@P   pPU X0S P0S 0PpppG-PQT@TP `N ل`lpWX`UrN@ oN 8廄00S 3/`P\p__@-@NTT0 TQ S S @Q @-o/_p@-@PX=Pp-NP ;P X0SP0Sp@p _ 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P#!@- \ X:#:^:\:0Qࠃࠓ\^/<]A-Pp`@@0@Dp@0@L$<#@`W O0pG`@A-PlL0pLALA$ `@`W O0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0!`pW:X  QY Q  jP 0P<]S/G-` p P#"Y@PX O0S  ?P00H@PR/G-PQ0Fh pY@p`V8h P0S h P@pG-Pl @R`T  Vp P匀`#801U 0S  O0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  O00pGPp@-@P}0P $R@P SC@ 0 S 0  S@C R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  fP p A ~f Q0000000P)QO-P`p@@DT 0 >p0 SX Ѝ0 )p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/HzhzlzO-px)@4`S0ʀ0!H)0@)8)   !@V`WPpP 400 $e0@04 00$00 , 0 4 00CS儁P ЍThe4,0P S@0 00 P  [  H ^  L X0STX0 000Wp V `0`p00S`0`p V `d``PpK o lKp1qhpPL|00 10000000 P 0 Tp`  0hVÑiɐ KId 00C0ᑓ) 0R 0 0C b*0s20嘐 0RS0C2x05A45t4545454545440Vʄ%04$V pDhTp% RFDHN\A \ \ 0 A0a00 Q3 0BP R X:  \0 c)0C2#8#<4(",$!8Q(L #8"(!PE  ᾐḐ ḐP0 \0 [꾐 ᾐḐ ḐԒ01 `@3 90  BQ RZ    0S c@,t(  8o@`pfJlh!0V$4?T!0V$4 `FV04 T`    ̈́I 000404040404`T`  ̈́I 00|04x04`04\04d0Hzhzlzd]'_JJJJ@J00#00#0A0S ( H0`0P^ <T"48"$0,04#$(#4 <  !48!00$31##4<  q  0j3 #  $ (#4 <0 $ !0 $ !00A1@00V@`@P0S 1 0 1000 C00Cs0z 0S M "<<"$,00 2#̠$̌(#4< 0 R0#  #4<0 a31#  #4<,<  <,Ġ 0Y.4<.̠̌0Z 00#€` 00#0R B000 0b$00 S\0S3 0 48 0 02##4<00 S0 b##4<032#$(#4 < X!0!  0S  G0`0@PY   j! 4 8!00 0 00R! 4 8!002#  #4< 48 0 0$30##4<uꀭ]]]O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? !1pW:Y  ! !QZ ! !Q  QG `Aꀭ]]]O-p4S@,M@0S[60 G[2* `101!P0P P#8",V0!`1 W㜠0P  Rpsʜ%YJ*P0 0t 0c PRx `RQ,Ѝ S $p RÑ{'U$2 0 2 $0Y:0!448#8400p0P!##48 0S0`0P !  " Q  ` P꡿( ;00 B0c 0! 00#0Qa0 !  R hNP"    "\!  qc2 02 $00 p 1bR0YW:0 $"44 8#8$04  p r  (00!Q" "$,    Q\{ u r  "! RH{  ! R  0F 0` PY*P0 0t xp0c PR`0W 0PE0s00 #  "0  SM{  !  " 0S 0`F EpG0  (0>  P""$,(00!Q"<< 0"$0,000S  E0`0P8ꀭ]]]00 04040404/ĻJ`JJhJO-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  GE0 `0P[:00!448#804pQ 0S  $E0 `0Pό\00PE0 S 0S 0 `F EpGO-4S@P,M@0S ^0L^*0`%!P0PV#80! p` P P \",)0 $0* ((000 0 000) 0 0000XQ:0 E$0<R0S  D0`0PX;:0 ^0# ^0  n 0##C$X0 0cR# 0[垳#CY00c[3\;:  "BZ  bP"]000$0Q0S  mD0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `FGDH|t]T00  ,0X00500\04/hJ(JO-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  C0P00 $"44 8#8$04  ` R0S  C0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PECpGO-4S@P,M@0S ^0L^*0`%!P0Pp#80!)V` P P", \(几. $0*   000 0 0 000 0000YR:0 E$0=R0S  DC0`0PY<:0 ^0$ ^0!  n 0# CX0 0cP0[垳#CY00c[3\;:  @$Z`R ]08#80$0Q0S  C0`0PP0 0t x0c PpR`Y,Ѝ0PE0 R 0S 0 `FBI|t]X0S  0R   Y  Z0X0[ 50 0\04/JJ,00S/  R 0|A-`P㛫V0@P0# (㒫( B0`0ᆫp $B0$pP?{P`I? 0`000  @@|"/p@-P$0@Tp5/@|\0P/ L  \/@-  , "  |)A-p`^@ PP@@@ @S PU$R : ^V WQ @P@^T0 N^@D@D\'LD@D BR@D@D\ @!N N'O-`pP`08@T U00400 Ѝ 0 VP`@|p@-P` 0@Tp 5/@|@-P0P0P`@P , 0< 0 00 20Ѝp|O-dcpT\\CUX`` H2W @0 S0``aH0F400Y0`$00000mP] PN<Ѝ$0  000( 哀(0 SE 1,0 0 W320$040C1l00. [(嚼+ W  0C0C [, 00 00! W 0  + $ 000 0SU 0 Hzhzlz _ _@-@P 0 R0$ԩ0ѩϩ R( 0 ǩ|G-P@P7@P7 0Eb`Sp 000  0 r @V 0S  $02"R0`W 0 R  R0 pP 00 000Ѝ $Q: @B `I V `r`_]@-@0P R8pr BR 0bN_ \0 0 @-,"1AAS)A@T%!0N!R 0S \0@ P  P  P /oS" R/舾]A-0 Q0(@T (0P PL )pL%')`l1& R L1 0S0 + <@D Pr!QbU00PC10c4#P Be" "1Ct p R 00 0C##< #"02#0 dR0 <#/00 0oQ98|7@-P@"l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P TЍ R 00 b?( 0S 00S=P   PPX7@- @P< 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- < Ѝp@-P@` ` ` pp@-`@P X0 &U  0 060P000p4 06000p@-@P0`` 0 000pp@-@P 00   00000CS p $p@-0P@ `0%R @h @ 0X  @ 0x0 000p 'h0R@h @ 0X  @ 0x  'h0h0p@-0@SS4JJJJJ`P`P( UPE 0 0000p S`0P( 008#80"$R*0( 0000C@0$0p`XkR`P`P ;$0V0$0000pq^HH_p@-@Pk p@_O-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c"<3P 00@0@ 0S@P c 0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B= (0 q^O-@( $Pp0`ȡ [ :(0$Pp0`0S3000/V"R/ p R+R*(JJJ@JJ@J@J@JXJ@J@J@J@J@J@J@JJ` pW0( 00$00C$0 Ѝ`  R j"  `PE  p : P   PEp`V47 ,0, ``` q^_HH0Sp@-P` U U@ T@P  @ 8@P0 <0p/p___0-T# ;T@ p&  Ѝ QCM? @ R P? &? H$H`pG@00C Q4#0@CV` pU@D 0 p0P6&0`FS A CR T a DR @DH$H@DX W@;@T@;]O-8P@Up=0`P00a040,($@@ @{<Ѝ_;_@- x8 Ѝ@-0 R  b@ @`@ b8ЍЀp@-P@,000 080/0 0 !""##$$*10/0 pG-@ MP :8`Ё\@ #P $(` 00 c2s~ C1|8Q E^_hFp Ѝ4, RX5^X! 0C#000 ? pP %^?h0, 0 0 0S ^5  0 +hdH `L0 0P0001@00 th0SA 0;  R8 0p 0A a320! r0  P 8 #61S0SS$ 0S 0 <`0H @R000@0@v00 NSX000L000)@~0L ; _1_T_l_] ^P P /;!)p@- P%@P`0S ~DR ]@MT000:0pp@-` MR@@P370  `$!1/@P 08SsMF@ Ѝp7@-P 0 N@P}R@P rM00 Ѝ0s@-P@<`#` 0ЍpC-0000`00CSʺ0 V0  =# C!1 R8P 0S = C!P0S c> Pc>O-P 0X&  ( , P B R   ,0 ,0 $ Bn 0 h0 S0 2 20S09(  0C  ?o 2  !0  20 -4S S 200h0SP 0_S [ Ῑ.0-400 , <00SP}`& A 0hq^P0P 00\/@-01"\A@P <]@-@Q0ST RN^ 0A@D^ \0SQLSQ \03=?00S00Q0S0SࠓࠃQ^\ ?6?000@-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` x 0R (: {>C 0C"4W0  !1 /@+b! T l0<# \0r#-u-ppЍ0T00W0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ w@Podv-0PЍ耖@-0S00R0100 P @P R0S*@? T .@@D@0 Q RP00x]G- @P0A S0 00.SR0 .QR 0L0SZ00UЍ P.P Bp0`^;ZSU Q CB \A R^:^0C `4 pC SRQ G\b*R^ 0S00`p Ub 0 B Q  GcR0b~  0V`: X .XQQ0p`bW PV ` B` R00 0S B Q.Q  W ^` Q.  ^ P^ B`_0R_0 0S00P U]c u,(0f V1P UO  Px]C-@PM0Q s.R R 0E $2S KA p R0 0 2`P 0P 庁d.  `.  [.Y@PPĥߍC-`M@@r PS Pߍ 0?``FW - @ T0@ @D T .. *. 0%. 0`W@F`0! ᲀP XPP zpwWV\ !PV RPPx]C-P@?00CSLM`LЍ@0 `p0R - - - 0 0S*h0 pS 0 A\0S/Q  '0\ \Q^ AB 0  ("(R ! @ Bg, -\ Q?,? Q, ? )  3000Q/@-0Qs.\ \ R 0 #@aAON/0S/S 000/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@PP0 00 @`@ P(Q( Ѝp@@__x]/@-@TT@5@-Q|L DЍC-@$M` ,0pS rXL SUxbQ@x b !08p 00$0$0 0040X< 0L00!s0X0P0"L0(X0\00M0400X0St  0Pqd 02\0 CXe001@0 @0`h< 00@0P@ 00$  0 PP 0R$ЍP @s,0 H0 0I0 0J0 0L0 0M0XR,0\0800sX L000 00X0S B B000v\!!]_ 0Q0A-` @ P80 rGLppF\P:<^pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P00 00H0 C2 000\0 >0>00C000\ F0ЍA&_O-@L8`p0,MP 0s H$ [,Ѝ0 0\0S* ppd0Ep7s0GU 0X0XP 000Z\P0c 0GPh  ZpG $ld0T 0C@ BÌ)0@ @3)`<0"$IP$0p 00 B 0$ % r\P0G 0 -P= r 00 0Pd0;0hl0 Q AH0 C2 000 0\P0 0000#Sn?_p@-@PpT P A0 0`UgM`办6Qp@-P`>D&@PwO@10 000 001 0!v&00`Ѝp@-PL&@P4PЍ &HPpp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@Н<%P$ FЍ0 0pA-0Px0 0嶝l%@\`FT 0S <Ѝ _&p~&P@pG-P|@xp1(D0"HC \ ! `.V x(x 0 @-   11 1`00C`0`0  0`0 11 1/@-  * Ѝ0M000Ѝ/p@-`@TPPtPU \ PU*x^\  pO-`0ts4M(00P000X 8@ERk X0S04 p000 0 0 0JS 0\0 00h00000p XR:0#S(P  Y l0d G BT02000Vp`dp2L0.L00 VX0S0 R d0\QV l 0CP 230Y l0CL3000V00R d\01CpS04Ѝq000 0SNW\0S*(P  ?'$00,0 0[ (P 0(l ,0 B$"P$0, (S:P ꄰ0{0 00^ H0[ (VP gHhlj h00\ %S/G-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0Ppp`0 00z(0 {0(0 080:>r0"\!o0C00D0l `$0 B"0$0$ 00(0 0P   Xp.0Skp(( P XЍ]__O-R4MXP0r\0@Sm: T& 00$0 0(l $p0 B$"<`P3( 0 z-3 0 0 1Q+ q1 :CQ0 ( !4 0 (+0(00t0(P z4Ѝ| Z  R 0 0%RP0 0RP ,,P(`@-M`pP0 0 0u@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51:  P0#03Q0#S 1S c0?oAQ1O-P`pR H0p00?0Ce\ 9$ P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00$ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@`q嬁,M00T\0S*Q[,Ѝ z$00 0 8Y Q  0l 000 0 B"0$0YP `K0S s S00 Q0 @0:02#400@00 >0@020000 * 2@$ $0I& 80C-@$M0\ S :0P(a`0\0pS*W?5 0 $x#WQ 0p0w#PW Vp 0 p l0  0Cp  $#0P $ЍW 6O-X0M@Sp@8` 1hh q h l  l 0 PP ЍL0P!h00h0h0p0l0t0WP X0 Ql00vPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0XP6M!Ѝ/O-0lM P00L0 `圠  8@0 L@P)0$     CRv     RP 0@OoB@lЍNP@M@0  4 0.S1R R-0.S*p0Dps 0S7$0S] @0LpS.$0S0bX S B/o" RL p;0000 0\P+ P2 P0,0 0$`00 C/oQ" 0R pp4 0`(` 0\0<`SLH00 0D0P P PA @  D0,0  ;0l0TP C)CL@H)0c"$<3lP<0 L`H0S0000000    QQ Wp(`Q@40SH 40SE  :K@P?Wp(` W( 0KK2(0(0@,0010 Wp 0S0 00 0 0 00 8P ,0S  \*P 0 00 d~*P08 ,`SRpp pK0p 0B    0C tr  B   C $xL R [ D   pD R`[ W`DppbL0> 0Wr LpR$ R v  J@PX0[0C?o20S( T:0@0b$  R Q R   @v0  J@PX 0 B/oS" R@ 0D$p 0D@P tO-8@LM00`\0pQd :,pA0001 0P 0 \ LЍd \002\0d800000@ pP00lSh0 A)A )0aD@48"03$*P4 h0@0P 0 PH#H0 0I0 0J0 0L0 0M0 0L0< 0\0<0##800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S 0Sz L0 X0r00L S000 S<0 0P0<0 00]h m04S4 d8000@ 9PP,l@ A)A)0aD48"03$PP4 h00P 0P80 0($ 00 0 I00P 00PP pd80@ 7P^l@4 A)A)0aD8"03$VPJh0 pG 4000 0 Q 04S= =7 PEuPPi h/04S& -d0@ 7XPl@ A)A)0aD8"03$P 40h 00 0 pG  BP  0C;O-`8$M000 $@P @DOoB$Ѝl A)A)0a"03$P0P Y HQ ppQ <@ 8;(P $5(P  + P__A-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@)a21, Ѝ8 d0l 0C 3 ?SR`O-`@,M0pS8@,Ѝ 0S@\ Q00S) 衟 PU \  0 R0U0 R H0C200 00 0DPP 000 0 = SP @P 0d hpP R b0S"$   PESQUP!\ P R0R0P0 |@Pl A)A)0a$"03$=@P p00 0CS0! 0PU 0RSU@pO-p P0` S8$M S@ ``J  \000 0 P0S@$Ѝ00S\0S0000 @00\0/0S00-p0d P l0  \RQ B01@ 0 @PZ 0 \ \ >0>00S H0A00 00 0H0  C200000 h@P0S> 0S0\ /T000 =0000 7000@ 0 0 >0 .0 0A0@P001 0 -  0  H0S 0 dd@Pl _ 0* I(C8RP t000 #8 *(80( 0VAP @0 S=$ЍO5@7@5,_M!Ѝ/A-0 @p0`SP , PW--G-` P@U-@P pp, @P 0 -0N0@ {a-B@s@-@0P000CS.I#SR`88 d0l 0C S c10PQ0`P 0##sr$ 0o00#sr  Ѝp@V@8l A)A0<)a21 #cЍpK_@-0P@"XG0@8 4#, #$0FFЍb__&_^00\ <00C S\KtKtK4KPKtK\K\KtK\KhK 0 ! /+ 0 0 0UG-0 SS   ЍS P 8pL  PS  P<0S2  I00 > `!R 0<mO-0tM0$0L0P 0<00S40@ P$08p40!00`0S0000 0#200  0022 0$0X0S rtL Sq@T0x0ᤂ0X@0h0sL0ld0S A A! a,3 1T 0 0 #0X 0000xx0,, .0`00SD: xPPD0 @S  @   0 R50d Q a30RQh 0D0808 p00CS0!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$^PPJT L00CS0@08 S  8 T8 000X :0PD 0T UQ.(0< 0,0 0004 0C0$0\ 0@T0T0 00 00S U   00O~0 00  0F~tЍQ 0S0  0 0J02p40 @  O 0d00e0|0  0S 0d00e068L00S ldA A! a,3 1T 0 0 #0 0m P$  d0 dl0 0m0 0n0  :0X400S*Tc?002 0 00 dP T PL 0(00,00S ( ,     0 R TP40t0000?(@,D000@0(@,0@0(@,0PDq^q^A-@pM0@P`00 R@@00V T0ML0 0L08 0 ! VT@`00R 50 W@T@M00N0P #000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, a@P  0 000 Ѝ80 000 m7@-@P'P ʄV Ѝ080 000 V0C-0@P8`rr eL  h X0S ld0S A A! a,3 T1 2# $0L0!10P  000 00HpX0000(0""p 0 8080F  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL ld0S A A! a,3 1T 2#$0mA-`0M0P@ N80 000p L040S cP3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  Ѝ@- `P@P 0   0L 0 0<03100C: 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0]@P~x 0PP(0(wl0dT A@! 0C#p00$?@ p 0@ 0q 00! e XpLP:!0.e2-8640q."@* X @P&0d00t@p0!# 0, $00{@P 0 Ѝ 000 |@P ] 0`( "4`#/p@-@(0Sp0PSuP 0 R@TpO- DMhR/@lp0.`p0P00`$,`@P!$ @P#W$k`Fhp &h$ 0@o V㨂X@P AP ,$DЍ @P P0`< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PP@H@0 @P M0@SI@H@ R B(0W0 ,000,0_%u<00<0%$3!00 8J0VP 0@80 3!8G@T$%tr=>0 SC&X02+@ 05:7$0P0 @ 00 000 000,0000叨0@pC 0 SQ, 0$R00S 0{ {@㌄ 0Sj˨ @$!X$$(08L0(0+00, 0@@P,p00ʿW 0 !"Т3" R 0P03Px 30p 0d@P 0h" 0"@0  U@ 0(D , P\  0 ,  @l 00 00@,0  0@0 0=^T@D$p 0 $0/0 0 !P"$0/0 0 !P (p$,0pW @ 2$ 30p 0Bd@P& 0$S !@ H@ħ0 R@ X0R 0G# 0p! P1T 8@@808 0  ,!1T+Z +0S !儧 0S֧G0p )!! cm0\ R彧 0  8@@808_41uO-DM,0h08 <00Sy 00P08地3$00S 0SpDЍ00  01 $0, -%Q  0 0\:Q`@(0 0? Q  , DЍO2<0 $ ,pP Q1' 80080000070 `P 00 ` K`8S0RP '000pQ QM Q&Ж000800400S 0 Q:p0S0 0 pQ Q QVWc0 SR0S S 1H0C200 0040pP  0 P0*% 00000$0 0;00t@Pp1`l 060pP "$0 ;cS0!00p 0`$0 0:0 Q@P 060 %pP  >W S00 $0, `$0Y (R   Q\ G0p$ I QX#Q X *Q Pڸ  Q\    00 $0, p H I 0 I R031005 000(0<0040(0X*0( 0R{*  0 $00CY\0X(00 00(0)!00 (0 00 0 0 0(0 % 0`0 %(SR0 (0 0 p0000G010S0|0S8Sz$0p 0 qP 0 ; %0600P 1 [p H   X  R   l40S )!0 0 A000  0 4 0p  \`9q(0 000S} V 00w9rpL=_O-` V4D`Y2!>3`04\@ 0$p 4/@P 88 (00 0੻l_i@_X?_dKp@- P0@@`婄<04 @ 04/@P  8 2_i3_@- 0 0000 0峻Ѝ @-0 000 00 0㣻Ѝ@-!>000!44 0ᆷЍO-@Pp`LM$@Wph7X P0 7 |8/P $ѥ LЍ ``  4:/P 7 $廥 $`帥88000`8 `` 0( $;/#PZ@T<P|p0 3/Pt0 Sx0S $0x 00$0I___ 0Kp@-@P% Cp@ 0`( "4`#/G-@P`P000 C&5(10S@0  dU. X(5e@@0 0U>005000 8Aᜠ4/P#P  p000@PK R> 0R  CU700000008A ᜰ4/@%#0D?oU20S 0 #T T0S0S03T0 P0C0b @0 0C00g te 0 T0S$Y @ 1p6儀00008A ᜠ0 4/#P@H  @P #T 0 T0C007S @3ġ0 00 S00  P  审mx5 0R ,%(10(1Ptv5@T vP~$$10$1匡M 0S0Y @0 0000040S: 8, p44\:# 80   <0L\0C1 01008 T 0`000d0嘚*0<00L 0  ! O 0003 000 s 00bR0d`0Y   P:dd0 00 0`0(0((@8P?(00<S<0(0@40S@ 8<00#<0040D0SC 7& @<@j@h@f@d@b@`@^@\@ZB@XE@V ,0TF@NG@L0  @D<@B@@V@> @<,0< @8R, 9981!p`00h0 !0Ꮯ+@ 0`( "4`#/O-p845,8p /? <*Xy([X0|sd0HSa82 00?GY;00 0S  $0  0 48<8<@|@0(, 0>0P03.: R Q# Q3#8#(, PU0 :8W<r0 0 0) RT<0S<Ѝ8< 8    08 08  0`H,]8L] ^<0@-@ P0 M0   0CD T 2P  0 rЍ00@-PM8  @:8;0 00 l) Ѝ0@;Ѝ0S O-@$MTP`L Hp RQ7PP0UPPӈ U0@2S  0Q PZ`0QYR'1 1X!pW?W0G{r1 0U|/181r3P0PPS P ^r1 1 W?Q000 00U0P00H0 00000`00X0H/181qvr$Ѝ\0P/Q_d_p_j_C-DMP` p g <  0$ 00 0@ "400 00 0 '0|0 0 P0 S  g P gDЍL\ 0 \0? 0 0 90G0 0 0Tg 0@-8@ /h0l P 0P3<P<#/G-@0 qd `00000`P`0d P Z000Pp"SR \ R3#. : : @8   088  H@ 0`( "4`#/O-$;@ Pqs&0q00Oq0a@S 0F  `qF` Aq0 S  0 `@xq6qPU- 00oqH,qo?0尡Z | Q ! |! BR! 'Uq q0S 1S10C1Fq0S @q pp0S h7q 0XS  0 -q+q &p$^&_<@-@ p000p@-<@Pp0@Sqp 0R@C-@M4pT@#(a(Qq@ 0R@ p 0 a]@pT0 0pЍ00 0R圐 0R@T0 0S   0 vp00w&p00C0@0,0000q刐! !  *P![& f! ,++:10 0 F4 NP !*! 0 0 54 =( 40  ++!⳰X?__G- MPp  @`> 5?@T Ѝ* 'Z @0(01;ʟZ R00 00@@ueTP0R00PP $ P0Q\(0 S @0 000O-@,MP0p T0P`X 0 T0 0C S 00   @P ᙚY? 0  P0SR0K|0C!0 SH080/@   004005000@@?0 S0 w?0 o?@i?-Q P@ 0P 00T 0,Ѝ@0S   0R00   R  @P ~0X) 0(T (@ T 0@0 0 @0 0 DR2320   (T7T0S  $1)0  +)i__O-PMp`HPuH4P@0S#げ  \* P$IV  $  # $  L0Y@2P #101#0 00 #P  #   B d#  P@    PG|X  L:7 R @ R  P " #   0 3SH L0SP0\ 0 Ց P <  0C S00S       PHFQ4KKK KKk  #RHL RP \ 㖑0P0, BR    PBVL0Y@PЍ  #RHL RP \ _0P0, BR V   2 % @-8@P(0, 0(00 , @/7@-@ H j dY \P\00P0J D00(0C ,00p0< Ѝ0L_^__@-4@HiP9(7p@40/p@-PH@i00p@j@-Q0   0P0"3 f 0ЍA0C-P4 $0# @ 0,@P y{0  000000) 0)@P 2"1 @P 00' T9@  .1 4W?o20S 4 j@P 1011 Q 0@4Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ e@P1@010@00 @1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S '  000000t 喩0 R00剩tp@ሀ@M@X?o_O-P`1 @&pᐑ吱!@P4|qdVʀ 0! $X!0 P!H!   !,~h0S2h 0! d0    !tT# 000 ׺@P8/P  R (@- 0@X?oHzhzlz_G-0@@p` ,!4#Q !PPa00(00@0(AQ(00  `0 ` `1a@ ` a  P $ S, @0 S0@0$L0S 0 0@`0(00@0(0(00(0p@T0`T $Ѝ0HQH p]Ip@-0@`8P888 0SpT0P`0#90#00 $0S ,  , 0$`VU@` HP EH`T0p@`p@-@P t P 0 S % 000 0800$<00 $0,1}S00p}?  $ ( 4 "3@0 D0@ %`4@ B PpX?Mbp@-\@P 0 P 00CS0(`q @  Ppp@-P0 @0\R B@ CUp0% 3SH L0SP0\ 00P00 P Sp@AT 0 S00<  0CS 00  p@-P@/ , )P0 D21< 0 ,R,(  $0#00(,00$4 88<@@HDPHXL`PpT @1R10(,0P0#01P0S 04 $ (8,@p 0B`0H4Pp `0B`8X<`0s 0 ?@c@p@0pp] ^MbG-@P 0Q`pL ' P 3SHL0SP0\0 0 @0 <0CS00S000800@P 3SH0LQP\0 ޅ0 @0 ̄00LW\\0XX00400O-,p@0Q0P`( / R 3SH L0SP0\ 0 㧅0@0 <  0CS00S 00018000 @(ЍOdR 3SH0L RP\0 w0@0 ̄0 0L\\ 000P0400,(H PX`P P /0 R0@o/0S@-0 5oO-@`pPlM㘀^ @  @P& Q04 a 4 a bbl 0Ph吆 08 0i"*0]191^ylЍtL@-04 $  4 4  4 @ ^  \ ñ@- 4@R 0P@- 4 @$R 0P@- 4 !4@T  R!A-@4PU@` PpTpPp!@T`PPU@- 4 "(,4 @$R""R 0(,A-@4(P,U @$` PpTp $Pp"@T`PPU0P  H R L01x0 R R// /bQ 00/p]@-,@D0SD@P @UO-0P ppW`000 3SHL0SP0\0Ń0@0 W (Ҩ< 0CS00S@ 00 L0H   0 04 Z Z   #RHL RP \ |0@0  #RHL RP \  , BR ]U90@0     EQPE X    #R"HL RP \  B/o"R  #RH LQP\  ,fZ1 @  K Z 1 4 40 0 40 JZPGUX R PPO, BR  RO<0 S<0  00 #8 ,8[808 000CS  R 00@0(p0D0p0 0H0(p@ Ѝ0, 3SH L0S P0\ 0  0C?o2S ㈂f[P㲂P@0 3SH0L RPP\0PP 0  <\0 0PE[ P1  <0K00<00<0p][_@-@W0 (0AoH00Ѝ 0`( "4`#/d0SH /-//s@-`P80Q30 : @0@(LЍpG-w@ Z1819[ `$'PPWPP PP W Z181[1p圀 01PPwq4 Z ovz0 :X?h_p@-@0` P@PP pG-MPB`px i@PMЍP  H/o ``"3PP:LO- 1Ly_A-0MP0`0 0p` @0 P 00 0000@忢?o2P0S@ЍC2 |2 0<0:t0p0x00008|0l 0 0X 00Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 04PK0 TPpK!`_ 0  0SSp   0 ogK P0S00000 \0 Pp0p  A  P { }iU  o v zBሀ(<____X?<_G-PR M 0GSd2p`0 V Q 40p @P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@ VS  7<$(, 0 00@SD@J  @P6ZJY `0 @P)Z `3ZJY 0D@PZ `#0005@P 000 s@ JJJ@@A-1Ms1P@<P0< !0 0BwP@P BpЍ0( ,(0$!    {@Pm  <0p0X0 0(0"@P (( n(lf`p0@``!(@` T 46,M|__<__:_4F_ 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P  H0 P  >0 0# Pp 0&p pG-p0M0`0@8 ;8 "PPd h"\D00D0D  0oU@ (W 8$ #R Q!0P0000|000A A1(LoHL RP \  BQ,L (/PP00$ 0 0 0 0013PP Q 00 0,,PP. ~0Ѝ #RH L0SP0\ 0 qz(0000(0 <  0CS00S( 0 00 0 0,00S00  R,0 O-00\(lMP0@0|0\✀0|0 D 0 p,0 U`<Z 8 F #R6 QC0,@000,0000A A1(L< 8 Pu Q0,@000,00A A00010(LuHL RP \  BQ,L ,<`@P }Pb0 3SH L0SP0\ 0 y<0000<,0 <  0CS00S< ,0 00L 0 ,0Y< 0M 3SHL0SP0\0Dy<0000<,0BHLPP\@  @Q}@ L ,<@PY3P}?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,0 0P<0 U #RE [R ,@  0,00 0K1 1C!  @004000080 0 J@P <AU 080 X0000CS000% (  APP(  4 }@PHL RP \  B[, 0 ,<e@P P 0 0 XPPX0 080 P000CS (  `P(  4|@000"8 0\0$300CS000 (   `P(J`X\` E`BHL`='S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0DP`PDp[`$0S0S P00`X0 `?o2X HqP 4I|P0%'O-0dM`00,00 0p0S4PdЍ|WH$%圀t00t0 $0   W@ 8G 82 #R" Q/0$P000$0000A A1(L0SQ?P{ 8080)HL RP \  BQ,L $8IPP { 808 #RH L0SP0\ 0 w800008$0 <  0CS00S8 $0 00 0 $08 C PHLPP\ : $8PP,00(004 00 0P33PP QųW 4( p000CS0(0*  P ! 0_{ P808i  @Q0$P000$0000A A1 D"4 0\(@100CS0(0   VP @P T@X@D@'SR0000HS#SR8@@DOoB4( <`000CS0(0  P pP 0 0<P}<`X㜐 0S&T P00X0?o 2P @P 0z W808 0¶,00S0U0SPP0%'0 /7@-QP@0 P0 4 8 RP 0H0000  Ѝ0O- 0 `M00000090 00 00CS@0S@ R0.S@ @P0 0C?oR20SoP@0<0000即P0 @ @P P @00 @P 004 Q\80 R] X &00 0" <08 : < L  L H $ 0 $0[p8 < 8v #Rf Qs0$@000$00A A1<0(L~Xy?@0 00C?oR20T00S 00@@X@0  @T 008@ @*@P0 x|0RP(000Ѝ 0ᗵ}HL RP \  BQ,L $8@P vyu0 3SH L0SP0\ 0 Ou800008$0 <  0CS00S8 $0 00 0$0<0 Lf80 Z #RJ YW $@  0$0 I1 1C! 0(0400 00 073<=@PU AR 4( 0@P00CS0(0, ,  6pP, # 0y@T!0S3  K.HL RP \  BY,0 $8S@P e}P 0 0@pP@P0xT0S  4 [0(  00CS0(0 ,  @P,  04K0@?Sp0xH@ p4 (@0 0 0C R (  , @P,@0<0C?oQ20S( W  LhP0vx@00 <0@P 0ix<0[Tp@pg 4( 000CS0(0 ,  @P,  0LxT0S  We UA`P 0 0@@P@p4@P( 000CS0(0 ,  M@P, P 0 0@@P@Pp0 xp唀X @@P b0@ @@P@p W  LP0wH@L0:e 00 <0$@Tg<0[Tp@pY 4( 000CS0(0 ,  @P, jXP 0 0@@P@p]4@P( 000CS0(0 ,  @P, G5P 0 0@t@P@P:0 ?o2R0St  o0 <0@P0@ @V@P@p WU S@-0S00& Ѝs@-P0S`@P `  0Ѝp@-@<0  L 00CS 0@?L}@-@08 <6 0@ 001/ ^@-@08<7 0@ 001/ ^@-@08 <60@ 001/ ^t@-@08<70@ 001/ ^tp@-@PK0 +"p@K@-`p PM@P @ 0/@P Q0  CP030000 A@P0 墲ЍO-@P 0Qf`冋ᨋ`Vc p`0 0S00 0OPNP & A00S(!``0000S 0  0 Ѝ0S- 0 00R0S @  0S 0  0  00p R W:0L 000@000p0 0 000&\f_@-@8 0 , @VP_0 X7@-P@0LP! "0S, ,00 13/ Ѝ0_^t&_^@-@0S @C-`M @XP- 00 0SS S p0 S2 I00>00 P 0   0@ЍO-p0PDM,sr`lE0V0 $P00P0H $08 `8\ #RL QY0$@000$0000A A1(L80 L #RHL RP \ CCq800008$0>ꫜ0 P@ QX@ @hT@0T Q@DЍR 0HL RP \  BQ,L $8@P uI,000BS8 $0000 $00R# @06 R S 0(0400 0 0 0423 @P A4( <000CS0(0 ,  `P,  0t@ T0RSfP 0 0<`P<T04( 000CS0(0 ,  `P, A000 t @t00S% ,sr! 0S 0T00K 0 @GDЍO000 0SS @8S @ƛ 0@0*p@-`P@M8  ;8P00   08 H@   0 013/Ѝpd ^@-p`@M8 & P+   P00  0H X@  0 013/Ѝd ^t 0/ R !0!@3 #Q1#1@281Q1#1@241q#@2q#@Q@/G- P0 Bp`8M0< R0LtLtL0LtLL0L0LtL$L L, 0 @8Ѝ 0S@ <#000D (0%8 `@@$@Q #RA TN0(000(04000DA AD1(L' 2, 3   !  @P A , 4000CS0,0$ 0  `P0  ]s@HL RP \  BT,L ($@P DsP 0 04!`PT  , 000CS0,0 0  R`P0 00CSL0L0LԇL0L0L܇LL 0  0 0C?o20 0S 1 nF@P@# 03803!@P, 0&8ЍGp@-@ `(MP0P 0 0$00 000 P@P A r(ЍpO-dM000t/H0p0H0 <D ` $0"X@ 4R 8A #R1 Q>0$P000$0/000A A1(L"40^ p Qp #RHL RP \ gXn400004$0eHL RP \  BQ,L $4PP Or( #RH L0SP0\ 0 )n400004$0 <  0CS00S4 $0 00L 0 $04 0 3SHL0SP0\0m400004$0,000BS00S4 $0000$0<0040  pu Q? #RHL RP \ 6m400004$04Q #RHL RP \ m400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0;00 640 pw Q? #RHL RP \ 6im400004$04Q #RHL RP \ Rm400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6m400004$04Q #RHL RP \ l400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0800,v(s80<0zs 0ZS40 ~ ? #RHL RP \ 6l400004$04Q #RHL RP \ l400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0408@ H0L0zs 0ZS40 k #RHL RP \ b7l400004$0` #RHL RP \  l400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 k400004$0 <  0CS00S4$ 0000$00,000B S00S4 $0 00 0$040HzPw4 0k 3SHL0SP0\0bk400004$0` #RHL RP \ k400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 jk400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$0000(00,00 0 dPP QX 0( 圀000CS0(0] 8  \@P8 T ,&oPdЍ<  0CS00S4 $0 00 0$0p0 0R01 p0 p0 ( 8@p X0B`HP0s0 $ ?@c| ^Mb 0 0\(p000CS0(0 8   @P8UpPTp PXM@@DpH'SR0SH#SR8ppGor0( <`000CS0(0 8  @P8 WP 0 0 0<]@PJ<0X` [W P00`X00P @P , P0%'0 0 0PP`8@P $G-@|0s-P pr`0s 8<0sqHL0sq0s 00~(,圠p|^ 0>0 ^0P3l:0S#S$Pe PPe "؀(0, 00h1 3 [PP!  0  E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s 80 Q3PPЍPO-00#`pT0DM|0T0D  $0WP 8d 8$ #R Q!0$@000$0!000A A1(LHL RP \  BQ,L $8@P000002(4  3p@PIWK4( 000CS0(0 ,  k@P, ` P 00mH@F #RH L0SP0\ 0  i800008$0 <  0CS00S8 $0 00 0 $0WA, 4( <000CS0(0 ,  PP,  0l@DЍP 0 0<PPT 0lT4( 000CS0(0 ,  @P, Z P 0l?@R@ 0@P O-0 0p0/PP3LMq:0`ZP0,0$00P00[^T%X00X0p0$ [ 0 0,0Z@@T 8 < #R, Q90,P000,0000A A1(L@0 ] #RHL RP \ T/h@0000@,0OHL RP \  BQ,L ,@PP &l LЍ0 3SH L0SP0\ 0 g@0000@,0 <  0CS00S@ ,0 00 0 ,0,000B S@ , 0 00 0,0ZP4 }0!000 0<008000 023PP QZDf <0 000CS000 4 0 <@P 8kPK P4 DP 00 0<0D@PDU8l<0 000CS000 4 0 <@P4 <0 000CS000 4 0 <@P4 p0@P8_kHP600 0< 0D>@PDP 00<U0P 80Fk0P8Ak0Z00 ?o 2R0S0K 0SO-M800@  `    P0 @0/\`3:< ,0?00,0`SX040H00L000(`40$P$0S`k\+H \00\00tP$0SP1800PS   T0 V,0pSde 0 8> #R. Q;0T`000T0 0A A^0001 0(LRd0  #RHL RP \ }fd0000dT0xHL RP \  BQ, TdL `P j0 480SSM?o@0( V Ѝ0 3SH L0SP0\ 0 Ifd0000dT0 <  0CS00Sd T0 00 0T0 0 Ld 0 3SHL0SP0\0fd0000dT0,000BS{d T000 0T0@0`` 80S `e HL `P   T\P$ A# d X`P0 0C0000 00C00 0 0>000>  d B00X0 0`00\00 0 006 3`P <a,0S `X p000CS0X0> h X `P5 \i `<  0CS00Sdd T0000T01- | T0d`P i08 4M>o@0( $00h h%`X 0PE0 0CS0X0 h X `Ph <ptx |x\R00 D0<0R0 4\R8Hoᨂh lP RpIoᩒ0<0D<`X l000CS0X0 h X `;P`h P 0X 0`0lPR<0lSp D0S+X P00pX0 ?o2 pP VX` X0 00CS0X0 h X `pP \h`BP0%'h`UP\h`2U0PE 00000C0 0000 0S/0 @(0pS SPppl=0 Q0? )0PQ=(p[ P0hH0\{hV$00 X0C$040040| 0 LP0(00 ?oU20Sp $0 E000$0C0000000 0S 0 Q  (06P (0  0YQ 0X 0`,0†PP \,h`ꀠ,<00C00Sʐ5=__wLO-dM000%圐080p0p0p0H $ p P $0tX` 4F 81 #R! Q.0$@000$0000A A1(LtZQ?@g 8080)HL RP \  BQ,L $4'@P g 808 #RH L0SP0\ 0 c400004$0 <  0CS00S4 $0 00 0 $040p V #RF WS $   0$0000Gq qG 1800,000(00  0 w@P AijX 0( 圀000CS0(0'  o`P  ,9g @808eHL RP \  BW, 0 $4@P h("0 0\( p000CS0(0   3`P pP TpX`d'SR0000HS#SR8ppGor0( -@lЍHL RP \  BQ,L 0@I@P [ #RH L0SP0\ 0 W@0000@00 <  0CS00S@ 00 00 0 00@ + PHLPP\ " 0@@P@0Z  Q- #RHL RP \ $gW@0000@00"  @Q00@000000A A1 ,000BS00S@ 0K0000 00;0s@0 F  #RHL RP \ W@0000@00 ,000BS00S@ 0000000;00@ 0? 3SHL0SP0\06V@0000@004 #RHL RP \ V@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 V@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 hV@0000@00 <  0CS00S@0 000000008<@ty TY@0 Q  #RHL RP \ 3V@0000@00 ,000B S00S@ 00 00 000408@HL@ty dTY@0 k #RHL RP \ bU@0000@00` #RHL RP \ U@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 U@0000@00 <  0CS00S@0 0000000,000B S00S@ 00 00 00040H;P800CS@ 0k 3SHL0SP0\0bkU@0000@00` #RHL RP \ TU@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 'U@0000@00 <  0CS00S@0 0000000<  0CS00S@ 00000002 0#0<00480 00 02 3@PW T 808Q #RHL RP \ T@0000@00 ,000BS00S@ 00 00 0001R01^1 0008V@p p1B`MHJP0s0 800C?o200 08, D000CS0,0 0  pP0 vPP) 0 0D⵮pPz 0DSp$0S0S P00pX00 00$00p 0?o2X HϮP 4LP0%'@T V 00@`O- 0tMp00,0<00/0圠 `0 l< 00d00d00H $  00 VPHG 8 9 #R Q)H 0@000000000A A1(L0SP`GL?@P`HL RP \  BRL 0H⤾@P .L`, BQ0 3SH L0SP0\ 0 GH0000H00 <  0CS00SH 00 00 0 00H0 D #R4 XA 0  000000H H10 zH0V ~ Lp^ Q, #RHL RP \ #GH0000H00!HL RP \  BX, 00 H@P s,000BS00SH 0000000;00/H 0? 3SHL0SP0\06fGH0000H004Q #RHL RP \ OGH0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 GH0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 FH0000H00 <  0CS00SH0 000000008<@tx rTXH0 Q  #RHL RP \ FH0000H00 ,000B S00SH 00 00 000408H@EHL@tx qTXH0 h #RHL RP \ _sFH0000H00] #RHL RP \ \FH0000H00 ,000BS00SH0 00000040H0  #RHL RP \ /FH0000H00,000BSH0 0000000,000B S00SH 00 00 00040HP<00@0004D 0 05 3#@P AD V04  00CS040 8  @P8  @IP` V8080<00S0T0S0U ,0043 00 0@P ,0TP0S@WW@tЍ #RHL RP \ EH0000H00 ,000BS00SH0 00000040oH 0 3SHL0SP0\0 ]EH0000H00 <  0CS00SH0 0000000Q #RHL RP \ 3EH0000H00 ,000BS00SH 00 008" 0000 2000 08@p 1B`HP0s0 !?@cD4 P000CY S040 8  &@P8  @H 0@?SP@HH@ P D 40 0 0C R 4  8 @P800 P0@PP0VTPT D4 000CS040 8  ޹@P8  @H P ^Mb=[.P D4 000CSST 4 T  ჺ@P@V D4 `000CS040 8  㢹P8  @lH @Z 0 0``PI@P`P P !D 0\4 $100CS040 8  D qP8`d hTPX'S R00$00S#S R8HoD4 Lp000CS040 8 4 D:P8 `P 04 0DLPLpZ㜐 $0SX P00X0?o 2` P P @GP0%'T  + 00@PU U ḿʿO-p M0`ƒ0 00S~$g@ghAƿ3 1 H`P@ 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0VPP PU 003 00 q 0H@Ѝ000zS0P]$ __^G-P `MpPL 0S@ ܼP 0<003 冘P@( 0U&2'ЍH0S0 RP@4P @ P0SH0S300 0 CS 8:8߾_G-P@0 pS kT! S Tfݾ`žWsPڜ0H0S0S 0 P᭾@41 3 00000 00 0 *` VV!0S 00   T 0S  0ᗂTᐾx0 劂TჾT }Ѝ`a^O-0pdM<A@wdЍs%`000D $0Ͷ8 P@@8@< #R, T90$000$0000DA AD1(Lϧ80 , #RHL RP \ # B800008$0HL RP \  BT,L $8w@P F,000B S8 $ 0( 00 0$0 04000 00 00@P wA4( 地000CS0(0 ,  PP,  0E@\"4 0\( `100CS0(0 ,   ӶPP,>`P T`9X6P@D`1'SR0000HS#SR8``Foob4( P0%'4 (P0 00CS0(0 ,  \@P,Pap   @P (@ i㴦a+1u0@-MP@-B0 00 8808Ѝ0@- Q@80 h0 3    808 0&8808Ѝ *@-0S 00 3 ЍO-M<0@8pD40)l":  00C 040S4L3,0A`0 : S 0003#0 #L#32024P Lv0Jv0<Ѝ觻 00 00u0P pu4P kuXTU T]{ _ _@-003!z?` 0 Ѝ _0@-qPM:Ѝ0@@}80@ 3P@z?00`0 Ѝ0 _C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ _0!_N!_O-p400P@ S` 08`M ?  0 0QP_ p(80 00w`(`p Vw &0 &00C030S3 L32  B \%<1R.=S+T @0P SXprpppZ ڨ 0  0  00C00 ST0T00! B!00 0`f ᅎ`` V"%P80 0SЍU TO-,M 0%!@ 0_PP``h\%1R=Sh \1R\0 嵟 Gp1>0S100! 0 $*=$S  01000W 00p50 00Tp4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍO!TU X!_&]!_O-L#" R: Ϡ!800L#" R*080G-p$0P` (0@  ` L 0l6p0t ̠\ yQ 2I!0Rt0 0/V  0g 2Ϡ!8 Y I100 S P?V,`ΚP0A L0V 0S ?5L#" R: Ϡ!800L#" R*080O-@pP4M ů 0`\Ŕ5#!\X    0 T0 L)L,)l"3PgX 0P@,ЍO OZ TR #pP `@0S7 ;0S00 T0T3?R\0 0SP `0 S ,ЍO] Z @ 0 00Q 0 0H EY @000; ,ЍO,ЍZ]O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 `pVp0 00000ſP T (wCe 00 00 0 000"T0,0 0SD  ?ᶅp, 00`2@0(0C$0L3T 2 0$PS98$0<4Q4 0000400Sb S<0SD@$! 0 $ 4P |70S l /00`^H00000 00nP TЍ08SL 0 <0 ?D0 0  0/0S 0/< S T0(0p \%6R0ǂ0## 0 /T0 CL    )pC)0c <3.nPL0<00 S 3 Sq_\%6R=Sh_ ?800p ST 0`S"80 ϣYc8<0D80N,00 ,Qg A!40Y0C40 A40040( 0T S"80YbT3S   , ( LOk$000Sv h00h0 0 0000S TH A)A)@a #;̠S Rd X8 00 ǂ !! ^?001>00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ yLP Nj(;  00$0 lH000$ {H0$ H0 , ^ H0 00S  <0D@$0C!d 0 '$ 40`R0 10S  00p1` 000 0p40UP0`W0080S 00S" 0 0 0U $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<0kH00( C0H0 H0 , H0 00S@~@4X", 0S Hi"_!"_f]"_P="_TU T"_#_XMK#_O-p`0P4M 0 ?ኃ0@00 !0\%0$01R 00@ ``&!! X0 00*P@? j4*!, ZS QS:lP ,l 00\ Ó\ >i4Ѝ $0 R  X   !A,iTt]U O-P0@Ḡ $M"0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@PvlP l 00Q Q h $ЍH  0 0 PiUiT]|#_U O-PḰ@ 0$M0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@Pr lP l 00Q Q |h $ЍH  0 0 PhT]|#_U C-`PḀ@p 0Ma 0\Žß0.S\! 00 Q    ` a 00T 40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PP0s40\pdT80< L31)l< QR>QR!<`0d 0001 F 0h40P 1`dP<040 pL `l\0<726, @ P0Hd,:0000@ (0 00jP0~d0(0 T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ep0$0101 0 "p `@ H0P ЍP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPd001Pp 0 0T0 C)C)ct00<21 ( 0P0 c0S C\1^1 U  U `  Rd ` < #.36,P Z*85@%00L 0404 00R  Q RI 00TI)\5 S0  11@0p@00 p001P0 0p0$01 0101000040 0@0 0-PhP <0 B2 b061")(!H''0001S 12 f X0P 0 PL< l52>p, ᇱa Q0:1S 000000 0(ziP%1P 1ec8U@e8 L0PP`P`U1Se 00P000T\5& S0 @qq p0@01 0 0#p0$01 01 01 0` 0Pp@P''000jQ0805@U50P%P0L05P000T0 p001 0 0p00101 0 0PP'Q P T A)A0<)a21 ( 0l0000 0(@+Pl00Cl00 01 0g00T81 P  0 p001 P@000 0 0 HzPPx0gd000 000g0T0 C)C) c1062 *(?PPdePP0 0ap0T000400`0  0 F Ϭ 0f2f;dd000 00 00  0Pd0- 'dpG<0S00W0S <0S&0 T 000`p<0嘐l0Xd  0 ` 2( bPd9c5c< 0(bd0000000%FfP H0p`d10 `c040" 000 |00S)1S0!0Y8P0 c0S C\1^1 U  U `  Rg ` 4 #.36,P ]*85@%00L p00W00W0SO 00T\5$%S0c 1<00@00 (001 0P 0p0$01 01010000<0 0@0p0 0PP 40 P B2 b061b 0`` 00( ổ0p !0001S P 1! Hc X0P 0 PB2 b50>" pPH Q0 :1S1s 1<00`8U@e8 L0PP`P`U00TC\5' S0 @qq(0@01 0 07p0$01 01 01 0` 0Pp@,Pg0p Q0@558 50P%P0L05P000T 0 (001 0 0 p00101 0 0PPP?'Q P T A)A0<)a21 ( 0l0000 0('Pl00Cl00 01Sb00T1 P  0 p001 P<000 0 0 @ PPx0d000 000p`0T0x` C)C)ct02160" *(PPdibPP0 0a0T00|0400`8PL0d000000(0!ePPrd00H0H 0ql0L R 0P00 zax0PT40<@IP dkaR00TV1P Pl0R 0 H0P 00 0 0K<@<0@ 00 (0 0><@p001 P 000 0<00@00 0PPp4ph0400 0000T0 C)C)ct0201<" ("BPP4 da4p80slpx`40V>:[ h04Ch0h4aPP480L s0H 8001d a4pP0`Zwa1P0O`Pw00TH0 010l02H0 0 0p001 01 0000 0PP W4 ppt0p!R  !  0  T B)B1) b072  0(PP 40040l0 2H0H qd1"ai`1S) !00h  0 0(dPP m 0T0() C C")0c7#10 0 d 000"00  ( PHd0s ἐ?00T0 `C0)0c VQQ? Q^z/" \5 DS 0?!>0  0 F Ϭ 0f2f`d000 00 00  0EPd0, `pG80S00W0S 80S%T08 000`p80嘐l0Xd  0 ` 2( Pd__8 0(bd0000000%FhcPd0H 00d`|040 000?600O-@P4p(,`PT: [0 S0S ⬔PZ@V 0000000@@000@ @O-pTM`@ 0S TЍ@T@Y@T  r"! ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  RȰ%d*}P# P `2@S8NSLQ0 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 ]y$080\< 0/P\00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 R$_?o2Y0S000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@@@@88%@5L0orAO-p|M00-P `븰[ 000P|Ѝ0800 00\@000S/ : 2P0X00 \00&2T00PT@p00h@l00<0 h0@S < `\P/0 d U 4 Q4 @P0080\0000P n9Π ^RQR.L N @n 18E \H$@@NU0@@$0@$ ((0, IY! ? Z40 0 Zů 00:@   aPU@5 ^K$@@@ @L @ Q  N. n*< 0Π U , D   L @   D  H   @Ha$ LP@% 0@D TT{ 0(0 X <PP@][]n@P)Pr@-0 ^ R*@p5 R@Ϭ卾#_000S -/0   R Q   -//@-P`00S-@! < M@P@P 0@0 0 P]@ 0S R ʆ@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 @P 0ST 0S@Pu@PL 囈0pI@p p G pp Ë뼰0@0 0  @p 00 @W  A Kଋ@K0P L" l1. Q*  P0 S 0 S00@$Ѝ 0p@ 0 D p@ z :  w  @P t  z  v弰帀a  @-@@A-P@00S= 00CS9< PPP0Sk@p?oV20#S 00W: 0R R 0000@0` R ⴅ@@-A-P`00SE 00SC 00A0 @P 0S 0S@Ѝx@Pp ׊뼀 0@0 0 Tp ]@ @ A HྊHp ЍAm-@@@O-lM@0P800(00 0080<0000Q.80S(005 0 8(u@Pd0`0p00 00 p 0 P6d0 45#T20T20$ ;60 0R啼t ?0:# 80@0(0P0)#00ҳdY`Pdo`P d[lЍd0000S0 0(0 0?`L0<0S``V$` 0Cd00 $0&@00t R[d*\0$ `0S$0 00 04T0?X0t0pC  0@DpH@ 0S00040t 01,0@0D SP0H 06L0 R00S 00Sp 0 1p0 0 800(0C0 0,u T0 C)Crq)0c9s400 p@i  R !00 R,  ) 080S06 S600S @" 00 00T00S01 0, A0T 0 0X 0 00 pG00040 040D00SD0H00H0,00C,0{Sڤ0 00\0C00 T0 C)C) c0<;2 0 40@P\ 0T0V0S$0 S<0S dX[S @0$]Oo(0BO<0S@dB[V $_A-`P!0[ @pẂ0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    O-`0Mpp@P$ w  R  p0@ 00@pp\%1R,5S0 0 0 s0 o."\哞p1`Z 0 ?  Ϡ ,2 0 `x 0s`0 C c00T0 ` C)Cba0)0c03"2]0P   \Ŕ P\x 0@s GW QZ0Ѝ0  ~s,Z0 TTO-`0@[M80  ,00  C0CSR [ߍZ 1 0P  ;10Rh  $  $  ( \%R\ R @uD%p/L/pt{W  Ð!&4$00S$0(0?(01  0 So 0?R0:$0( 0QSc00S(pWs 0)QQ 0000  L  R 0 \0\&/ 0\ &/0 00 0Pt  PP8ŕ0 @L ,Q-Y!0ZS 0֋ 0)R 0X:0 0 0001 000$0 0S0 0hP0  c2# S,P!Q RQG S1ZQZ3PR> 08u< p0 H0pß 0YW0  0ċ$0 010 0 W00 0 P 10 0X "#H0 p ~p. ?ް 0 哋0 S$0 0100k P w08%Sw C0圠000S0  0 <000/SP0 0 c SRQR3,00Y$0,0, 000 0Yt H0L 0SP0 0SX04800T\` p BW, W pq0S*0xp(p$ Q0 ^!((AP (( 0 ( C 0[00 0 0pQy1(( R@ 0pPn1XXϠ R 0 00p0 0R       0 00,0{0P0[0 S0&t ( 00Sh00Sl0Sp0t\%0R  H ! H04  1/ 040@  p 0T0< C)C)c208<" `0 (0P(040<S" 00 0000S0( @08D 0/@0D pW* p040$04 S000$00 rs \%L5R$00 0!! 0 $0 S000 P,0 A pa1^8970':00圠000S0 00$0 S000 P0, C pc3^09:00SX吷"66 00Q00Sy 0\P 0 b32 R0Z1Q SZ ☐ pBᜰ b<  YS:0 B z'z b~3p2z0W p11 0 PS0  0H0 p55C20000 0G0 0=0 p ~p0Y$0 0( X%0'00 $0P 0 S$0 0100qP 8@ŕ L 0  !pt(APn i1ptpt1p 0140S(0#Sz0[ # 00p\%X0R !0 !09 4P L8 l0 ^85@50%00L508Q Q0(010 0S 0 01@0D 0/@0D 40pW08@5L085@00L0T $_G$_A^T΄8P* P' @0D 0 @0D 0 圠0 0@R    0D Rh  Bh    R  000S1 ?@0D 0p@0DpO 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"@P 000 幃9SU@ЍSG-p0 `$P.T@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000咄SPNWC-0P0`pd@T 0 UWp P ЍT80< @31)` Q0R 0008<Ĕ?MjP0 C c00 0 P  d( 0# 0 h 0S400 0`,``0000008 1 010I> 0008<ĔB? jP0 C c0 , 0ѝP `V0L"Ű0 0$ 40h00e000R}$_$_$_$_%_MG-p0`@ PU 000W Ghd R 00 0h Rhn9S000ἔMO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPw p$`W0@: ,0W0:F,Ѝ\0Q.03c 08T @)@)`"30LPd 00\ Ó\ Ix I0哸+0[0: 0 GTU p0Sp/0@-@0M 0@0@ @@@㋡|P|0 0@0@ @@@}L0 00@@ @@@ p Ѝ0@7T=g'_Dn'_w'_8 p00CSp0/@- @D @T=D-M L~P voЍ'_@-0 R  @ @0b ` 0@wЍЀO-0,M G P00園0 HlpwW PPL@?n /h+p+ 0 $+4KP !  0w % ! % IH4\%R0004\5 P   ,Ѝtl4RR  h0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3v  ׍000S0P0,(5 0S0 @0@00T`0#S> ) %> 1S 0DD@30V^0 P4T$0X4S E>0X4(40`A8[L V$5S0P=$Tdt $}d`P PɑP/ ᾌ800pH0S40LpHT0 C)C)0c"03KPO  08v  G80`$%!0, R0 Dk0PPl \kaἠ_<#| YP  0 ?<#Ή p 0Px 0Oa`0 C c00T0P C)CRQ 0)0c03"JPP 0P$c"   G ei]'_8 TT'_'_^'_0O- ) %> 1S0T$0P40X4S E>0X4PPh04 SSF4P0P0040000,8T0<P C)C4)0c"03PIPP440$ R:0)F0400 5 0 0C?o200004PAY$%,0RQ0 0֋L0Zg$5S0Pŏ, H=`4dS944S@040T3$0`1d1,10 1(5 0S0@0@00P :>0 $  * RPPz$0p0,0 0t0D0t 0b0?o0cH0T0 0CL0804P8PP00SH 0 <Ѝ0(($20V!0703PJ80 00S0 C40HL T0 C)C4)0c"03 IPP*40 0 /t4wE80 4Pj$%0 , Rk\4S  5  0 !000V0 ף0P L T0PPほ4P DEV PPP:0hP (00Pt]8 TT 8T&_'_'_^'_@-0S0pP@ c@P " Ѝ 070@P =aa070>e`0u/Pp-_0Y VAC^B#a^m,M_&_4A-P00`SP pa@P a@PH0  d`府@ЍDC-@p3$M/P++  h0$+4`P6T|0h 0=s0 51 50@0\%R=S04, 030304040 50s0" " 200(0\5WE`$ЍsBT8 O-,M@40AWp PL30U/o[" R ,Ѝ800`H0S40L`GT0 C)C$ `)0c"03=P$ 0r0$000SD8 P#BG-$MR Rp`P/oAQ" R@   hP V 0*L)4 k_@P0 R@k0qP V 0S 0 0R\ՈP0Mύ0 @P0&00 0噗@姛T:040 0 00 0\k@P,V,`T`` Ϙ@创T0 f0@Tp`| 勍 j|Kzp`=S0 @P=04=S:0 0SX0SO@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ0 5< 0P!P000V<1 @000C?o20000\4S Tu/V= 5 0 5=S# U١T@=S 0 -7C>00x0SUT⿡010@U@S ^'_'_^'_+(_A-@`L1pPP 00' pPB=TSAP 0 |<=0S 㸸埌= Sҗz$%0,RL1;h8P 3MI,000:0O-@P`=MS =S  %^U㐱P _pP$^U 00T R8d R5UTp=SB 00v6CnHPЍU / P $(P 0   ᪘0PU\pp  吘P ]g(_tMp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0$P 9 ;909  000&00PP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0dMP00 0 $0) 0\&(0 0 00 )( S RT 0S0,0, (0 0 0 ^0y:,0S,A 00(p地0$0 P =<00004000@0D0000^P࠱8<œH lU?P(8, PP PH L^EpP n7~ ^y[xQ[ W9 n0 ^U QU^YW0  Pp WU(  0%t40 00000 U 0 0 P40S  #0 H0 .P^pP ? G$0:T0$09X00S T0S X  00080P<œ0 pPEUP!U$<0S  #0( H08<Ŝ  ß   . ?t8PLY"Hࠣ࠳Yࠣ^  pR0@P} 0sxi Z pR0 0s40  0000 hP9H0 C2 0000$0 0n'"R0 08sZD0Sj0)C( 0C8RP_ ; <100 #8 )(80(0员PM ,000$ 00 )dЍ *Q@pR0P00 0 4  @  1/Z 0\ s\!p@- @P岰 Pp0p@0@-@Pp増9S ʰ;S  0"`PQ 0 SL0L0rj0P0 0  ЍLPHO-pLMP4  P3r:Po R00`5L:dP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@P:0@(,,0N X !$[0$ [ $ C:8@BP80& @DXT $@0,0 $phP 8 ?080[ 0 0 0 \$  0 $ R0 8P > 4LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@,0 0/\*0 ,\0 0 ) )q,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` Eg@P 4=" 0 @P<Ѝ8e@5``L0`(04S >oobT`V 00 0S;=>@-P`Ab@P0 0@P   0 00P0 דЍpvdG-0`P0 XM00 0S  XЍG ?W p p 0 00000.0>000 @P: W000 08@P-$< 0S)u 0 0@@T0S3i 00S00@P  0  0@3 100`XЍ2 >;pP 0   00=*;@GvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-3)_T譀_l@-  P0 SQO- P4 R 4#0  /" RH @R` pA aw0y T= T @` pA aw0y T/ Tp @` A paY0WqTPp R  PP`@P P\RUP 40S40p ЍHpAD a4Q[ QVYQ@_ AQ[ a0YPPRP   O-Mpᜠ0W@ᨰP尐`00 p 0000f0@ 0 T 0p*Y   Q L B Pb<" P VU \P*PP\& 0 00 W  R@+ @ CP R ' '1/P 0000 P$8#L A1< a20! 0000P C R 01!01/P 0R0*@0 @!0L A1< a20!  U@PY<0 0P0~0 <00Q0000 0P0<00CS$0<0&U 80Y 000 &R00S P0Y00aL0 C# c 9!300 X0 6SQy00(00 0,0, (0XT 006 UF0 000000( 00,0d;PP 0 =(07L0 C c#3800 9!600< 0屐2#T20T260P0 (o8ЍY,0( 6440SU 0 W800 Q0+  $ RYW 0@ÏD0T00 S 00!1 001/P000K0@00  $ R  WR0@ď D0T00 S0 1 A1/P 0@00 0G@-0S    P (000 00 0 CЍ 7N p@-0@00P`06/ 000`06/P |00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0R}PEP0W(0,0ů _t1 000040 0 0pP Ꭲ$0}LЍ0x 0 | P ( 01/Px0@ 0 p 01/}H4QPpUp(6*C/Q @ ?QD   00ã 0Q,ON8O\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-`p@P M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S# 0 R h0 "V_@0 V_"@ @@@P匕$(oQ Ѝ0 ]\)_Q'_@-0,@00V@"4/Ѝ蘛T0T)_p@-@0@000@@PD @DPPP0 p P: 08Sp0Ppppp)_)_)_*_ *_p@-@`P(0P0  d P boP000@09#60pO-P@p0KMP0`@`0/U0:Kߍ0 0 P 0 ~0!"R Q0:V&0'0S(.\S(,0S\ PQ)0.SP PO-P10DMp @0! 0{ 01 0{ 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 .9@P0 h 40R 0 h`F ` l 0={ :{DЍ@>O- p0M`,00P, $00@000000L000$ t0Њ@P#L0980 00 00CS@,00|00000  ;P |0S080,0@OoB@ЍzPM@`00`0|0S0800 0X0000C\0X0S?80SF 0000X40@0 H0X0  @00@0C 0?d00 ?`0 0`0N0P00<00000008#8D00Ch0X0P tS-40S0X0T0 P00400ST[ ?[ :\ X L>040  t   @P X\0X 40X t00?@PlY Y 00<000t0T0000ഀXT X& R  (0 P(0I Z( " Ra H HQU BRX R0Z< <  r  < R  A0 ( R* H R8 R# l0CiPl0H RY  R+ 4 \RX0=X0@U%X(0h0D0C(0(X @@  X 0S  7 BR  X0\00080P00tP 3X0S^ 0S 08 88C?oR20S 9ST0,00 ;4 \RX0_=X0@@@@@)R0*#D0@圀0S0@ @000T380S 0S`0X 0c0T0(0(儠0" SRxx`,0x000 :;80S> 9S; L0$  P@`Y 0d `0M0000 L@X0 0@>@DP@@E0S 0@0@ @C0 00@0 R000Sk@)0S:X 0(0@00BL0(0儠0" SRqxx`$ xp廈@P9  0 $06 0$`p將P @)_*_@A-M`@ p0- 0?PP$ 0 T 9 0C8C890000岇0TP00 0 9S00003/Ѝ0 B?PP0Q   A-Mp`0@8PP$0  @@  9 0C8C890000h0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?Z@Pm@00$0@T  R@@@@@`ᴰK [00S S% gP[ᴀǑ"$$ @ `@ T@ 0P@@@@@B `0[ᴀǑ@Ƒ`0S "440 ` ц0@P00 R ?R *  1/,Ѝ]*_ *_O- 4MPRX0U0 `0删00Jp ((剒0 T @?4/@P7 0 00\ 00000)d@ "4400 00C0 0    ,`g@ Y0 00P05/T@4Ѝ 4ЍO],*_-DMLH ,  0DЍ]@-0"!P Ѝ@-0 \ 0 00\OЍA- MP8@<`P^0yᨀPPP)0P p@`C Ѝ 0 z@-)@0t Ѝ@- @ 0  0)0 Ѝs@-`@0 0KPPPP ܈L0 00 ЍpO-M*_t/ 00CS0/0墈H>tP@- P O-M000@`00 pjuPPjxPP _sЍ00@0 0009 R0  09P  d11 00*ᷚ00)0 P奂P 00 0 00Qd0X0 000P05/PP  C  0  P`+P aU000 ~50 90000r ^t7@- 0@ 00L iPP0ȅ Ѝ07@- 0" 00L X@P000 000居 Ѝ00  0/ @o/p@-@LpPڈ000P0 5/pC-$!0PM R`p0 R R  @ ЍR , 0&U@P ā0S2 9@I00>`9@:#:0*v0  ʁ@@P@$A-`@0P00p0 7/"!""9:#:0900 000""00S00C=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SZ0sW!srS"srO00sL(srH0sEx0sB|p q`0$E @10000! DLQ# 0 K#n0 0 p@PX0|0#880'00 Rd0X00,$00|0 *P\P4Ѝ {G 00圀z㬠* 00*0 p巀@P0嬠0S0t0娰0S0p000*P\P]4"sr# AQ񟗪oNoNpNpNLrNLrNpNz 00娰@[@P#sr` $sr&srxG@x00w0F= 0 ᥘ@@ 0 pH@Pc#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P 20010 P *00)0 p@P 9  :(090*P\P3-@@@@A-`p0S t 0d0 0 0P0 LS@P90VKpЍ@0pO-`p M✐@u@PPd1)R:@Ă:<1 0G0 0@P<9 08C890 000000@04/@P 5  0 @L@ ST܂Ѝ9 0C8C890000̂ɂ@tC-p @`0圀T0L T* T20S-@ Ѝ贐 P@00@ QY  bD 00 0` @ 070 @[tT*_O-34M`)R@#*p0 Pሐ0p 0q@P 0~t@P0 ro0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)] 00X~@P&0 0009/@P % 0 0L 0 @ BTˁm9 0C8C8900000 90000nY]tC-p P`UO 0SP9S B@n Ѝ00"nP 0!@0 @@ 0L@P  029 0C8C8900009 0C8C8900000 00 -  01/ 0s2mn@TnO-`0 P\MS0000 00cp_[? 00 A 0#3*pGp W00n@000880DP4p<@@HpQ0L 0800P 05/PP n\ЍHP0PG0 0n  0[$0 2 #0P @0 00 0U *Y0 SiIPS,@ 0 D7RP000 00S U0 0 0 0 nn0 0 0\00#0300S00 0 0  000,0$0 S:00( IW ( ,0A  B 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( Q@ @p  R0  0@/@-0`0CSx8<)Q\8FPP Py(Ѝp#sr$ 0bBP<0Sh(P`HPP0V0 ": 0S`:`V <P 4003/P $ 40 <#1/P ,&PP$ 40 P0<#5/PP 0:0 m*_G@-`0P@ "6000 "40"†)`徆) P*Ḇ0S< <00 13/(嬆Ѝp*_*_*_^t&_^0   000 0 01/ ^0   0:0 0 01/ ^p@-P@8jPڈ000`0 6/ 0p@0 1/d ^0 0000 001/ ^t0 0:00 001/ ^tp@-P@jPڈ000`0 6/ 0p@0 1/d ^t00CS&NxNxN0N`N00C0 0 A<k<< 0D0 0p+_+_p@-P@ IjP$0$0p 00 $0Cp@A-@P`"v$0S000000AG-0P@Sp`P0p0S(W! !R 0 VR:0S(!0PE  1  BS !!  100C000CS0*O-`@$PMpT T0@0 0 TЍ 0 0S  F0 ' 0K# 0@ 0 0S  `G0  0K `0`  `R` V  0 0 V  ^ @G-H`傊p  V@ P B5^:4\P`R  \ #RP  gV 0S*0S  y  0 D@PH00000  u#P0S .v PPLP0<00S00000000C0GD  !! !R   1   0 S  B!k=00CS0000$00Cs0 D0HPD0@A-P$0@S`p000$00Cs0 A000O-P`H@,MD0#0Pp 0pG'60&6`'v00 `0 B`F$0s w  BrU R$00Cs0 K,ЍXC0I0D$00Cs0  0[f4[ h 10$00Cs`^h`ZhVh Rh 0SZ000_ PpVS Eh Bh ?h^ 0[0$0 qF0@s  O0 $ 0$  O `F!<  O0S 000D$00Cs R0 B $0Kjo 101P g g eV gZ  g 0S0S C0U  00pCA  !P  ! P0PC0Q -<0 0 !P 0V$0JY0$00 P 0Qf gg g0Is g 010 0C1P0S 1$00 1 00 QbP ;0 0$0 0UP 0V$0!Y0$00 0GD0 !BP ; $`R0 Bl 0K$0 )P 0 PC0$`0 0KC-P`dMpN1āȑ@0%T00SdЍ,0(@0P,0Ѓ(0,0(0SX , X00(P\0P0 (0SX@ @S , , , P0X0S\ , \ 0SP0SP0! 0 R00R0S"000PC0000S (0X@S, , , 0X0S\ , \ 0UP@+_ 0 !6/ ! !Op@-PS`@!V 01P 0 > 0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`0S00p@S000 p@0j /-@ $M0 4  *( 0 0 00x$ЍĝN+_ @-zP00 A-P@T* 0S' 0p7 0S `Pm@0 Lm 0S 0 ; 000C0R#+_ p@-@K P p pP MPh PP ` P0 0:878V p,+_@-@ PO0 0p@-@PT+ 0S Q 0`00C000 0b00Bp@ L>z8 0 0 0p@.7 0S[/ #p@-P@ 0 0 0=7P1p@ 0s/ 5W0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0p7p"AR0PF4`0AAbATW& r@Pp 1PQS0@ @A 9`p YZ PQW`p V000p@V00C00S0S $  t,0!qpꀳO-tMp0圀P@`@, ` p90 S6 ?9P i90 `oᩒ tЍ(P,0PU0%VZZ`9 00`0 < 0?9 VA9i0J0 09P "SR 0 !s6'90S 9 0J0 00p!9 `$6:00@ 000R  0  0 07P <Y% 8  OY PcN6V  8 !88h0S$9 0Jp@0 00`v<+_D+_1G-p VZ`'v' dA0$pp P(00@0?o2X0S0( )0Y g 0Q @1@AS8 80< <@@NX 0@p@0 $ AP0 pB"   40Y0X Zd=(00(0Hc$p@p P(c,V "4]#@/0@-`0ML@T LPL   @A弿0 0,0 0X0@@toЍ0"P+_ @-MP@MO-`$ lM@ ^0@pP 1@N@pP0 * 0t|$p @v$zF  'lЍP@p 7 I0 0018P7(, Q   57 7(P, ZY Zll9~ Y c5 .5 o5 R ( ,"&~ p5Y+_+_P]+_ A-?P@ M     6  %:&p@`]V `0 ЍO"554,5 0D0 07O-$MH L $P!AYpZ `4!C20(2>B"  YV] xf$ЍO,0 AT   SPP QPUR QP  RQ  R R  0Rq0@P 0 L000 A`P X0P`@ď T0,0 PL`@$Ѝ# 0s/@-@dM , #TP2,@d804`S< (q< # 嚾 6 0`7PP60  O $0AQ0%4 0LX.HbdЍ6ᵜ 0  36o(0,#6fX4,aꀴ+_G-q  @QU|Gx|@8PU q:D"AR0C4 RyU001S B YXP Q00P oVU,0!Y00X0S `"V0P `7ꀳO-@M ` @VsC f %  ! . R  5  0SI!;5    BR - 00> $!*ផ  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ T>P G3 3 S3X    0 ,  4 @, #&\G- P@) %U `D`(00@0$V0:Pp@$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0p+_+_#O-4MX傉 Dd娉0:hR 0P ?)v%t(0$ 0AT,0@TS3 0B!50U QY (@ 0`0DC3f0S   $0P#0* 0ɔ $0!(0S, , " 80S< < # 0P 02($ Q( ((,(A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$0l 0! 0 0*[h0 d!b4l!0 \    ,  d . 01/pP6 ი4Ѝ 0`0DC3fd0 R 3 R Z s e,d3xxl7sd0$0 6 000 Ԕp,0W I 0h 0 0,00#X?+_&\O- 00S #6:(00  $ (01/#P1 0B!0S@(060`Z``0T:0ї<Ѝ0@s 0,  v1J0S$ 0,$03P0, 090$0   0 ᨑ,:1, 1,0,D1, Y 00 0 V 2P,,20南$6G0#X?+_0@-(A(Q0 M~+^P ) ^0,0,  P0 T0$$ ( 0R*0 000|`0& P `y ,#004 ,0  ,,Ѝ0@T#L>X]+_8##x> ,_ N+_/O-pP@@#Rp@-@P U Tp  p@O-pM00`$` H @" DP 0HPЍ P(0,HpPJP'rp'p0V P0吕0 H@0V00S#1s D0 0 0Hp t0 40& kP 0 Pf0 HZ`PO-8`Cp4DP@ Ѝ$0!SS 80  ut U0S10 0Gp JPXll ៸@TPڸ0u\0@ P@%)$司 0#"SR3 (@00¸ 00 0x0 -000宸QP (0SR0(0b( P,0,T囸(05\0 00000 S@#|]8,_@-@P  0}<   0R  0o<,0 3100S/ $Q 5/p@-@PpPU  p@ p@Rp@-P@ T p@p@-`$0S 0$0P@%P   0/<p 0)<pO-M00pQ`@HPrPP U @T00@P" 000U## 0@ .P U&0W 0 DL 0D0 00@ @ 5P 0%; Ѝ&;8030*֏0/C,_O-PM8@0pH/ `0 0, 0V 0 `P Y -v-5-- GV5P ` 2`Ѝ0S j-P-v- 0  0(0, #60Ó !Z8P M--Y-N,_O-p00@`0PH-,0 2 00 0囍`P ,--8- 5P ` 2` Ѝ0S -,!-/ v  8P -, -Z,_p@-@ 0S 0 0P`P   0;p 0;pO-P` 0M:0pS43#L2H200L2H2V =0@T Y 0V  000 00P-@P:  y 0&:4P 20S 00  0: Q [ 0("*,#PP @T9!  >0 : Ep [: W P9D0 0   XЍ d,X   X tp/,++9, D  .X[ V  0DAU  0 +:BpMp px,_f,_o,_p@-P0`Q@ P0! ^   PPp  00CS050000 V$P y PB Pp O-`pAM$ P@\-0h0i0j00$0XpD>0S 8.882<082$1<0S$10$1B}:X 0x>A-@p@`@P9 ΄0 a@x>@- .    Ѝ0.   Rp@-P@ 000Yp@諕00꫕@- 80000  0 ;  g0ЍP>,_D# 0 iD# 0 iD# 0 iD# / /A-D0Dp0Pc00S@Ꮝ0000 Ar @-,0@ ,0,0t ,0 1,*,*@&& 00S:6&0@ 6, P0T8v0v@-`0`PCṠ0h0L0a3Ġ2,@,R0 GX?X],_0 t2@-$@^5@-@0SoP O(+0  %45fgK뒑"F) 8K1'B7 : yЍH#,_/?-_O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! 7`PE000 pP  Vx>4 0S/(0(0 S;3S8#0/t>,/A-pb@MPA  p101U00 001 000! P n 0 0 P$P(0P 0P0<1 000  P  0 ! )1BPPp`000P P0:PP00 }P00P~0 00x(0x0)0:00 T P}p@Ѝt>p%?h%&\'-_x%S-_h&~-_&/TTx_)PSA-, N0RǠȠ̌' @N@  0 `p0PP ||Dn000尌U&SP(0 i00 0 P )nЍ]-_-_O-p`1P 10@@@Ap0 d ᧋pT0WgO 0$P $K =% @ `X $B$FJgPp3h%t>&\#-_G-@ᔠ@MT:@Ѝ! PpZW``U`#VE` R W@Ppp4$`&\@-. .   Ѝp@-N@N@`P@ m p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0$`0S U,P )0  M%0P 0S  $0`,Ѝ zI K#@0 Djh%t>&\-_O-N@N$M@0`{PP$p`AfX0塊000   %0PV l)`0 P  {$Ѝ H #@0 z&\-_t>p@-P`N40@N@ 0f p@{t>&\p@-8PPpI}@E}0P3#pt>@-@ 01 v  0R ? 01G-p`䐟V@0ᠭ 0SP%PU! 0B0 0S0S 0  B;  0ȭ0S 0S0S#U `FPUP0 -_A-P`pWX '%A0S0Sڋq#000=#z#pX  %0 0@p@-0Pp0 #@H#0S #Q##Rp@-@P U  p@O-dM,$00[ @dЍ,0L\D0$0H0,0P0PHPX PDPz@0 S 0 0CA4H0XPP(0( 00C\ S\05$0 000 [ 0P00T0\000D040H0S  0`(00 R0F0H0S TDP97SX a 4IpP[ 0@ P 0  Q 0S X0D$ Ho@000p<X0 HD P r #R4 0/p Zo $0 K 6$0d@0S X0HDE0 S@y0Sߊv"000B""@ 0S ` X0R $@Hp0Q D@FX0 ( I @,0< <0@ 1/PV DX0@ (,0 I @< 01/P #P2 |0/ ~D0WX 5<0 @0< 0 'X XH 0DAP' D < !<!<!< Y 00 0 0 0<PP  PY< 0  !R9< 0 I<00X0 B H@1 0~!pP0 pp0p 0"pP 0D00 0!s!V!!00@x000峫l0\0 DID'DP T  H!X?-_,_,._O-4M$0X0 P\!#@hX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X$ T \o4Ѝa,X  X , !X#!  "0 / =@X? ._/=p@-,P,@,0 rp@ꀵ,]@-`@ 0 ````!PP " 0@0 0H 00 0  0S   "ЍpC-`M 0 ````p!@P 4 P"e# W' 0`0C0@ 0; 0o p" 0WD0 0[tW1 0S1  T 000YЍ 0; 0\ p= 0S:0P//0 R:P3#//p@- P@700<`p@p b-0 @0 'p@- ` H0@SP`B   DD00 $p@?p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`<Ѝ2OsP_>@O._G-M 0p` @`6P0 P 00 0 0 `@e?o2P0S0S 00S00Ѝ R 0000 0[P >0A /R0Ca 000/P @-aP010-p@-@P` 0P ,6,P R0C P 0C0060@* 0 0T 0P3#pP 0Q ppH# 0R  S01 R  S0100S/0/@- 00#R0 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B B10Sp@A-Pp`d@P 50H10@0P 0A!&0D<$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```10X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`0S #S Pe0S ~]ᛨ000p@-P@1P 0S p000p030/@-P '@-@ $M0 * , 000 00P i^$Ѝ'._0?-A-P`pP @40 1000000 @ 0@AA-P`puP @4010 000P 0 0 @ 0@A@-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-M00@P`U@PT 0@`[ P

P R*0S*VPP0S0S:00P0 PSP 0O--p@-@PTpHP 0 D B0U0"&00 $00S 3/ `5@A-P`@p<0V`!@0 T@1T@!tP  0S*0S + 0S*0S ?Q 0S0S$0SH0S00 @ 0 000$p":Ѝ@SA-P@`pS&S<0V`!@0 T!1Q! @P @ 0S*0S 0T 0VЍ0V* 

 ";@00CS@0I pA-P@UPP0` 0p00 @0S . PU000ЍPP00`V  D#&R 4 R @ R  00B X $6SV T130PPV40S @0S00 80$0S0 0 0g@00@0 P@0S P080 BP }04 R@  B@  0VP`U40S @00CS@0  `H#O-P@4M0U<0UP!@0, T@1T@!0S^p,` 0 Upp230P0 000C0Uf0  Bp4ЍQ @ R 8p U 0 R H$Z 0  0 U01 C00 0C00[ C$ U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ o0P P  $R  0S0S 0S  N  Z0 S K\P 0o 0  BR ;@-` Pp-P@0P  Ѝ\ 0S400@ T:p@-@P070000p7O-H0S@10 p0`$0 PpCL \ SN P00U  R* HQ Q0 Q11!$Q44P88P<<P22P@@PX  ( R,Q RV  R0 R SW H0S 0S00 S10!$0S4 40R8 80R< <0R2 20R@ @0RX3 (0, 0 RSV200S5000 S000S0000C0 00 {V D0D0H0H000000[H0SV  :P M 3P F3/V2HQOV  "P' U   U    B    5V D D H H 0  0  PN Ѝ2/LA-@lpP`(00LP0PP@O-M Q@ 0| ЍO^Q 0QSp0GSP#*XN 0P UP'W P3 000 0sPP04⠪PP4 X  @0P`h@00(0(0V 4s0s 0}` W1 !@XZX 0p0S  @ Xg 0 0CRb00x"hD$0 00l $\" 0000H00SU@ D08 !KP, R ,0P S""D00<00+!D%"D%!D$0 009 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L0000FN `@l r0 S0 S00P0$00 0 0H000s 0Ѝ 0FR 00SP3Z 0 !PP`@GPh]|]4]@-@pP`M  0p P Ѝ@{ЍG-0@P0`Sp0S 00S R 3/000x <@  < 0 00`x0SX@`@@O-0\MpPT00,00`@L0#@0L05 0 L !6  PL00 @, 00L000 0 P 0P$0> P@ I  Y0 S a00P0(4000000@00080PP 0S*80U0S  XT00(00 0PPX @ P0 0P00<00 S>00 0 0 000 @$0S 0Z  I 0 BD @P 0D 00  0 00C0 QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0 <00@0H 0PHD D B"&*@0D@20 20<0S10010(00(000C0S @@ 0  R*8Q RP0@H[PPR$O3T00(0 00@@T*@np 40 00R0 R0%400P0P@ 0S* TX@@wT/ $W Y  TP-@\ЍW 0 @P0  r 0P000C0 00 $W Y  U $@TP ,0S @H#O-P`@Mp@0 0<0V`!@0 T@1T@!7P 00 0S*0T* @00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08pY40 J004 000 %tN00 $0 S40 TA0 @0 W >v00 0 JP  @Z 0V-vCЍ ]@-0f ЍA-` <@"# p0 G&0P@00T@v 20S R 3/Ѝ<0S BOO-2*M00P`0T  0pP 08/pЍ@4 R @ RH0  8 $ RS ]A0㴁0 0 0 13刁0IH0S!  DJ0P$H09[00 80 P[ G  H0S  DJ0P  0  0j000&j` 0H08/H0000p $0 03/ 0, `F(00 0 OlNtNp@-@P0S@ S d*W003/p@ `x00CS0LO._@- 0 ^: 0R:   0\ P00O-._._._._P@._T@._pO-M$(04P, 1/df ?00/0 0 D/00 m/0 0 /000 0/40$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\      0/1!" # A# 0/1!  @ A)  F A* *! A/ "< A/ # @ A   A @ %- A, &- A. '. A0./p21t"/|"x212/ 1"2/1"2/1"2/1"2/1"2/ 1"2/$1"2/(1"/2" $ /$ 0/281"/3#4K? 32= C A@D5 $ÍH! L(#,PT04Xa\8c<`! d1@# 0 0D3hqlHsL( ) 08@ 0  00 2 R"` "0h0?Ux0 0S?#x03@$ 03030300ߍH#KC-MP@P`` p"0  P幕H1 R*Q, ! 0L CT04 ,  0000<0@0D0H008  00000000DЍ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221ӀрH#>0a/Q/0S //C-Mp0@`00 0` P"0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0S^ 0 B 10^ 1300,0堰0#3[ * :#:SX  ^80@.4 620 0 0 eP Y 0 03/^X&  0!  0D %6SP0S 0P 46S0 00 0Pu0 o&\H#@-0ʠ,ʠ 0C0^0@< 0#03P03 Q03S>0 0>0^0 s: O-0$MZ0%ZU@ N@>00R*1 000u7$6 0 0U@#* 0pC0 W|#FF Pe @[7$Ѝ Z PX RU:Z 1 0 $`  pR0S 0 0000S Z@<0J0HY 嘻V 哻0SV Y ߻YV 0 (,0 D 0 P  DDLP 0S J @T0 K@PPv@|]O- 0LM\$  ,040LЍT  j&j R@ DN@@N@ 0C*,0"*R0 @< # 3 S:P03:RT0P0 008040  TQpP 0 0(0S 00 0<00800400 0 @00P@0vC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00N$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0*$ЍO-$MPT0`@LpP$f R R C< i S X:<0SYPZ 0H00_ 0 ! 0L @0 ."    !P@@ 0 ATQQ@;I   H#$0?/$._@-X0S:0 0B00 (KR0\ H#._A-`Pp@P@PUPD0S TJ P  P$6/_A-$aP0AS j0!>00000000 81Pn 6810`U 0CS*J뤀p0WjW000N@N@W\0%hЍP< 0 dJ>/H#a/_//_&\/_O- B 2p A`P LD PkU@@!p]J!P@*P%(0崁!S00@0D 00P@061A@0U0C@@@ r0 ᄠ0S 0- HP@0   S0P  vP  @uP 0>0000000x (0D0 , PPEt $뛥*@/_H#$B}0?/>/p@-`P@.0`P @ p/0@$p@-PU@Ip@x0@QX00 1Ġ  S0 Rp@I0_H#(0_  @-0pt0SKs@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U 0pc P(,`0x S 0: h S 0; 0Ꮚ`P`Eည]4]@-@`P0p60:0ղ0 p Ѝ0 /@-@0:00M0 Ѝ/"&*C60S/ 0S/ 00CS0/@-@`#@-@ P@ @-0@S000`#0S/@-@ P@ 0݉Pp@-0P0@*։p@Ӊщ@-0@ R0 @00@Q A-@ P ""&*C6 0S7 0Ⰹ P * 0; 00  ]0:0 08$0 00S) 0SA0S 0 00C0 \ 0 ; 0(0 0 00 0S0SPU 0oP `V' 0S 0x0U 0  :0V081` 0 >>⣂Rq P A0S 0 `(0`y 0p 0s1Q-9 0 6 &! R  010@ 0"61@ 0"601008 00000E`#$H#O-M 0pDP@Hز2 a 00'603S P0 PZZ@H GZ  PQ d"($($( @0  S  G "0` "zᴈ 0(p @,0@00 +   |40L PZ 0 P0 PMU ЍP  04PZ:T  0(p,0 @@ K]0`e 0(p @,0@00 R * ᓈ P L ᇈ (R +H#h0_]4]G-Pp`ᔐVUG8A0Ds 0 0 0 0P 0  0 0U`0 000@-@t0tM@@@0 @,LP @历 @4P00S 3/@TЍ0>x>0/]O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P ZW 0S 0 0 0剆0 6$0$pU0b$,Ѝ d90X 00L A0 :_PEz$H#D0/0_0_@-PfM_0@b0 06S  0 0Ѝ@Cpp 0 P 0S  p00 P fЍ&\0/H#O-`0M  R0 Q @K V@pP Z)0S W _Ѝ Pp PU ( ,"&"@Pp@p 0Wp 10 R0PPܭ0 0200 0[00S ,V 0@>WH  0 Q00SB =V 0 R 0 05 V  R 0  0 00000uD0W  P  0 ( ,"6  0@ @0 0YLe 0@eέ V;$fV l$#@-0 >_ Ѝ&\O-DM `@f PpEVZ)W 0   P0  ( ,"&h 000 V0 ܄?+oDЍ0 C-@P`؀DŽY$7p97P P0@@ pᰄDy<@U@DOoPB@p,pۄT 0 !>G@@/H#0_p@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0pH#QP$#l$@-P TP0 `AX!h1@@400@D  @ P PЍKH#0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/း0  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT ꀸ@-04040@D 8 4 D P  P 00 00耸@-000CS pO|OpOOp@-X`PP@  `U@ 0 ,0@U @_Tpܸ踀 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzO-,Mv3CPHqT!LpD@!  patQ`1 0 A0 0S000%0l 囒x )#40 .#40 $,#4 00  圠`pS 00,"$,#4$00  3#S$0 0,Ġ̌030#"$\3#  *[ :pY<:^d:0H pP *pY+:^Z*\ `:U0Yp * X$ : ^:*\ >:05p^0#*\ 0!03 ^P0#PP 0900H < R80L0|0@H@H0,ЍO菀\ :0W+P0 000KP/ȸX/@-8@000(< R@@ 8L @ <00@cꀸP/O-hdbd<@T 10P0 1P L< @0R "80L0@0< 40!S<018 L 0!4 @0 pW, ̡0 S(fP 0S I$!0000 SPP0S 34]O-TMP p 9Q 0đn@04S8408D@Ѕ@IXT04@K[WTTN 0`YP 408 S8 D 8 040S8400D4У80n <X 8P0  0S lΧgW 0  PpG[]2RL (10(180@D080T80 80 @ATЍ耸H#@-@\00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/းp@-@ ~P0@PD00|`HP !L0 \  h  t P 2 p@~ꀸO@-@ o"00 0/0TX0P/း@-@@~% 1( #4<@ X0S X @~ꀸH#A-`+Pp A0S  0C0aAx\~ A R 0PA 000J~000~~A- 0@R\1$Y1$0@00P~P`ᔀ0 S  Q0p~P  0R<1$A<P~000000F~3S X?@-p@ l\ `h Tt H < 0 @ꀸ1_1_1_'1_/1_71_?1_/////// 01>.2h !0S000C0< 0S0 00 00000/$@-@P R00 O-\MP0 `S`S@#@2T@U U0!:3 U`0A0C 0000@0 0Y`V0#0#60n((0, 0P0Ço60S \'(0, 0P0$@#v0#6(00#6C0#60c400,0P 0P00 ,0S $0SC@i\Ѝ0K,0Px+(0Sq0Wm*"@?P@!@1#(0S`1`!@D @@0S80*PJW@1@!@D @P`10@0S 400C $ 00C 0@0D < B Q < R80CY 0D0@ @D0 Y A@0@000I00$0Y k0S pP0T00Pp#6$000c0000c(0|0I640 6,0P @x@X 0 ppppP$ 08 0P0S0P0T0P0 @S00R0SL  00`g 60C04 0PD PEP PUP1UP10S> (00UP1X(0@0@0T@!T@!, 0DS0%#`F :0U*080  $ 80 R:0`F$0 S,00T: Y@PY@PP([|0FS@1$0  0l  0@R0T0 0P8 00000 R0T0 08 0): @00@0P00S Vj0P p`T0S*[&*PP U P10S!1E pX*P Z PHEY p`W e[P1 P!P1oE 0  pW PPP@`A I@TH#y1_/r1_ Z{/08 Q/P @- D:0@1_/0@/@/0 \/у0P1@p@-@`PH1ƒQL"^!^D*Q p`V`F`P: E@V P^@o#PpA@AQ`V`F` V P L@p@1_p@-P@x2 Q*    0R p`VH9`F`V @ LPp@1_O-1M0S9`Pp U@70 @77W00Ѝ-  Uڌ2Sᅢ \ J 2PW@` P @ KH#1_@1_)2_\2_p@-@X0Sp/"R\:@\*QLp@0C?0@@- pP 02 0  Ѝ@p <0 P 0 D R 2 P///@$@-P@-PA@-P 0@@-P 0@@-P 0@@-P 0@02P 00 /@02/@02 /@@-@P02 @O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000yp@H#@-@PL0"D0S 03>4000P,02Ѝ000$v2_/@2_0@-d@M 0R0`Sr]00 00@0P0@0  Ѝ@s@-P0@D0S S800Sx TlP: XD8`A P<<84`P@Ѝp$$]2_H#1_2_2_ 3_@0O-M`  00P0ll5600ЍpW8< 044Q0D0BS0S W7*7P .0P W`V70`F`@V @ DD0S@pp h @p 0p0C 0P 06# 08 P 00C 06]/3_X3_$@}3_1_DH#O-,MP`@` V.P 0pP@00㜠N@T ,ЍX PPE%&$ $    01/ޠ 00P@0/@- aP00 ]QP@- P@? Q0 .S 0!  U06P`0!R0P`!R AQ:R 00P`0S6#P `0 S 8P`P`P `0 Ѝ U000S0QRA- p$@P`g0vw6 00J峠Ѝp0 P/0S  4\Q 8< Q < < 8H  BH /802H# P00S/P 0 (Q, Q/820P  /?p@-0@` PU` S R   P00 `800h <0@8@@H00H0pQ 0 P0S  00v2H#@-T0@T00  g0 @ST0@@[2G-@0Q00P00CP0wWP'P""R,40Hq0S)44140P !* OwL00CL0$ T00CT048P26 `=w000P00P0uw`0``FV`G``dw, (D00 @ w `H#24L]3_?p@-0@P va:wvT00T03wP00p 0 G2@-TpMP@`-40 00` >x@xЍ2QO@-XpMP@`<0 060`0 "x@\Ѝ2QO00@-  H-0 0000 0&@P0 S 0 | WP$d6pP @0S  & $0 P000CStOOOO0OOOh`P0S %h $0T T0,0h0X 00$\,`P h@h@p0S@0pP5 4aW%s`PtP?t@ *b4t P? `0s04p00S 00  , #sP  t0s @ s$ 0$ z0P0 2 !\340XY Y' `0P X 30X !'!&`P szs0<_ys Z@gp ?4; fj0S0F0Yt 0?0 2(20X020 0 4C#"#04>0CYC 0[  IH0 E0ız!(0@P0S( T!0S"     l d!CP XX2!h&`Pp0 0 (0S00,2(0,`(0r0000|0L L P P `NxrP\%s@0@s `@@H#2?XG44_t4_5_4_4_4_4_ 5_2 &5_35_hOn];5_(1 0S/O-qH0S@ `/r찟PU/r ЍOD@T P 0! 4  r R `/8 <0R<00# H00CH08@ Ѝ?H#W5_22_k5_G-0H0SG0P SQ@ 00ZrpW R00S0 00@T p 0# 0 0S0p` #R<00# 0800X<0@800 00 0T0 0T0dr(08@ ]rH#2@-T@L0S@ DrdX40 0P@T@@BrH#?p@-@8`Pq@e$00$0p@+rꀽ#p/p@-`LPq@( 0F 0 0C 0T00CT0p@rꀽH#O-1DM0000S. pq R`qU# &DЍO(0  B 0  w0 0:@ PWDЍP'@@00@0 0?p@-0TP@S` 0$ 0S00 B&$ 0:$0+0000S$000T0 0p@/O-tM000T` 00 & <#00,#PL &Q#@P 0 0 [ ptЍ/&(*[ $ Wp   p H  P00'0'0SC pq. ZT 0 (f(@( (0 2Bq@0000 V (0  B0  0 &0p: Y[P h1[T000P0P1H0L1t0 0800<06$0 00p0T  T p0S 0 00p#0L0R000&n0 000&pP[  |1Xv0p0pj[?$3<r!Ce0O001 7@-@HPt@ ,0 6@P Ѝ0##@-@aM }0PQp@  N@@ ,0D $\030#R0#02S zp `Ѝ. & R lp`*t 0 Do`P [p 0 D"60 B+ 0 B"6C00S("06BS@-XN, !004 0 #6:S"& :///R/>0 0 @-@oH0 0@ p y&O-$MPH0TQ@`LpP0#0@ 00S 0SR%0S R0  0`P60 0 H00\XTPLp$ЍO!&O-Mp8000 0 0RЍTd ` 04 ` BPP8PPP Q /BnB?C-`|M@Px Dq>h0Sh             ($  ( 0 040 080(2<0}>@00   1DH00LP00 0TX0\0/S B0h``0d0@ a!P 0000S l0`0B0`p`h0l0d`@ G!P@p`@ |Ѝ`s@-@P`\@P Ѝp@sЍp@- L@xP 0S 1(S3 SP5_O-0M3S P@P1S S  2S T$g$P $FЍ22$0 00$00 0$pP $/KB$ 0`00,080402S300l0`0V L0L00 06/PL0?Y00` 0` SE V!3P Q*I yI`F`00A $0Sz "R'0&b00CS$ 0000 0$DP $00CP $` "R"V`10 ` " 0VL000`8` `2$S00S,0 40s0n`n`4`800XpSD 00t`D00V sP t`0t00S1 n 4 0 l0 0  ALp<040S07/D040 p 0 0'Z (  0, Rbc^pPS01 P([)D0<s0D0D P0a B 0 D0H0 0 4D0P-d 0HR:0R050B0005D00D00 p0 . Q 0 0A B40 00C Y (= 5  0,`1!00 000L000H0' V 08 S00 02 02000p0h`|0l0$03/P$ 0@H0  0`0PPA-PpU@` U R!P  Q 0P  R@T P ,]0O-x02 CMR@#2` 0 00 00 0$]@P  p2 S Oo BA  Ѝ0S%P U"0P0 0$8P PEPPE0PPEw@ U @-P@`pP  0 00$PX0@0X0 ЍG-X0 P `Ѝ0@S `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ Pp   BZ`    7`{p 0ֿ00X $p0 $0X  0 0<`PX0 X 0 7?` fX0V X  !QX0`P 0X0 0\0j 00dX0"Up]W L !2 pP 5_P P P=!>//?@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀA-`@V pp 00000B P&=P 004P?A- $0p0 $0 0@R`P:    U@` P x00 00$00?x @0D0@0D0S/p@-@P`0S000p P :P?A-0S@Ѝ` -0) Pp!@P0t 000'0 q 0  0 0'@P 003/@@-$Ma01@00 0000 PP0p  ?W 0 00 .  00tP$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000PP$P,ЍA-X0 @ 0S00@0#,$0`4R `1pCPC0BD`` !0hGGpGxGedAO-Az 4M޻(b$sS0S b 3 D 7PD202 000*0PP !Q0  00 倲倢 0  pAT \XDP`<DP~P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0 PU ` P0 T | 0C 00PP;0 0C4/,P000  P0@P@ 8 8P<`P#$ ,C00   P0T0P0S  PvAT00h Ѝ$7_Ӏ3 ^6_ g6_%6_?6_`]6_6_U_ k^^6_6_6_6_6_6_@-<0DT 0 !0  !0@- ! 0 !@- @0S 0@忞GxGp@-T0PO`d !0UF Ϡd 0!T@!p,/0@-0dM0@ 0 Q00 P00 p @`T#ʸh@Q   4/0 0 &#: 4/?&6 :  \ 4/dЍ0\@D3T\^l7_^^_^^^X@^DT\^[^"e^,/w7_7_0O-P`p'DM,00> 0 00P(`$ pͭ0,0> 0> 0 00P(`$ p庭'0 !d> ,0  00P(`$  p奭 0 ,00!> 0 > 0>00P 0(`$ p叭 0 ,00!=0= 00 0 00P(`$ x 0,!t t= 0 00P(`$ `c0,0 ,= 0  00P(`$  pO0,0< 0 00P(`$  p;0,0< 0 00P(`$  p'0 ,00!D< 0 00P(`$  p0,0< 00!;0<$ 0 00P(` pS0,0 0$!; 0; 00P 0(` 0 ,00!P; 0 00P(`$  pѬ0 ,00!ʟ: 0 0 0P(`$ 廬0,0: 00!: 0: 0 00P(`$ p奬0 ,00!`:0X: 0 00P(`$ 听 0,0: 0 00P(`$  p| 0R!9 ,0 00P(`$  `hR`: 00,!t9 $0 04P0p(` pQR, 0 00!90 $0 04P(` p8R00$,0 0 00!8 0 04P(` p %0,0p8 0 00P(`$  p &0+,00! 8 0 00P(`$  p(0,07 0 00P(`$  p)0,07 0 00P(`$  pЫ*0,0@7 0 00P(`$  p弫+0,06 0 00P(`$  p娫,0 ,00!6 0 00P(`$  p唫-0,0;$0\6 00!H60@6 0 00P(` }.0,06 00!6 0 00P(`$ ph10+,00!5 0 00P(`$  pT20,0|5 00!l5 0 00P(`$ p?30 ,00! 5 05 00P 0(`$ )60 ,00!4$ 04 00P 0(` 70 ,00!4 0x4 0 00P(`$ p90(,00!44 0 00P(`$  p<0,0$3 0  00P(`$  pժ>0,03 0 00P(`$  p?0 ,00!P3 0 00P(`$  p孪0,03 0 00P(`$  p噪@0 ,00!2 02 0 00P(`$ `優A0 ,00!l2 0d2 0 00P(`$ poB0,0<$2 0  00P(`$  p[C0,01 0  00P(`$  pGD0,01 0  00P(`$  p3E0,0L@1 0  00P(`$  `IP7_P_GPYv_8_9_9_9_)9_LP^0DP69_A9_O9_`9_o9_|9_ 9_9_h;P9_tOP9_AP9_9_9_49_@?P6_9_9_?Pm^9_\^9_\^:_8:P:_p彩F0,00 0  00P(`$  p婩G0,00 0  00P(`$  p啩H0,0 1 00!01 0 00P(`$ p倩J0 ,00!x1 01 0 00P(`$ pkK0 ,00!101 0 0 0P(`$ TO0 ,00!2 0 2 0 00P(`$ ? 0!`2 ,0<00P(`$  `+ 0!2 0<0 (,P$  `0$02 00!2< 03 (0 0,P p;(8$0 0 00!T3<0`3 0 0,P 0(0; 0 0 0!3< 0  0,P$ pը0 (00!3 0 00P,(`$  p唨4 00!4 0 00P,(`$ 倨5 00!(5 0 00P,(`$ l 0!h5 0p5 0 00P,(`$ pXDЍO- 1 0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000Ѝ,/H#C-@0M(0`SP0 P$0p ` $0 P0S S P h00X  00 000000բЍ_G-MP 0`` @p 0P 0  00 0 0 p@峢?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`000 00 0@ 0 {0P?o2P0S 0000 0 PPP0SP +H0l|ЍO-P|M @ps``  U+0H`P0 00@ 000 07?o2P@@TP0SP +H03PI|ЍC-|Mp@P` `!0X X@- XϜ@&@X#X Hp0S X0000դ0 0000 00p00X@H|Ѝ<C-@|MpP`` 1T0 T@<Y00?(P @2 (V(RXX @HJ R Y 0D@ @ T0 00 0000p00ᐡX@H|Ѝ<G-pP`0MH 0` @0 P 00 000 0@d?o2P0S  H0R0RS*00Ѝ"3xoX? NMb@-1P3@Om `q0VN P0 ! 0p:01 00$00f$00$0PD`$00$0T0(00,0 0S00@000H8p0900S  @v0VH00L0H0 HN00P00T0< 000\X00`00d0`0h0$Ql Ѝ0 `1 0 H0* l Ѝ@9t]8]@BA-`MPp@r 0` 0 P 00 0000@岠?o2P0Sq0PЍG-@Q0Mp000` @`0 ` 00 0 0 `@兠?o2P0S, 000 0000 P 0R <0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 ƲЍL?ɚ;6eA-M@P`p(0` K0 000000X000ЍC-`0M@0 0p` P+0 P 00 000 0P?o2P0S@0S@T0&K  5PR000@PPЍD?|>G-`RMAxp rP` ($1 0 1 010P 0@HpΟ?o2P0S%ЍC-鄐|M@P`` pH0X 00 000000ᢟ|Ѝ,Ms@-P`00@0S 0 ЍpPGO-PM@`Ȱ0ȦU0s 0ȰĠp@ЍOX0UT@@ p兡wXV2U`010# 0YC L R?0xP PVV|pWV,V+Z[$kF{FV  P   &lV| RV # W!`JKq@hVXQ 0`FV`G: NVbpP(V   ;?0 `{VV 7VU010#`| 0YmV~Z[ F F^V 4 PV|0S Y1`JK@٠ Ѝ0 M@ Ӏ@ӀO-PR`@$MB @pɠU0 R&V붠@D @$Ѝ Z X  '     D V  (UZ0 H @p 0MO-t"00a,$@ @@ @Pӟ 0(00 00a,$@ @@ @PŸ 0(0l0 00a,$@ @@ @P屟4Ѝ:_,_:__^d^;_ޙ_:_sP_:__:_P ƒ #60 P *R  P 0 / 0CA-0@o`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0kL0 0!d 0 P:00 4l:_:_@-L@P 0S  I00P 00004A-7z@p `PUpPz?00ST"~z<0 80Βz;_44l&;_X?=;_0000 xz40@-M 0000P 0`(@PP8 @P 0 @@0@ 0 @P Ѝ0S  @!!@P @0Dp?  @Sp!@@Dp@Pp ,z_0S 0000F@P O0S 80p 0 0>@P@`z4D;_]P4O-䒟M0S@ X y0S v,0 a,0zX⸪Q08 0(etQ0(@8(0H> C'ᨤ(@H(!,QL H L 0P BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP 8! ($ ,!@0<Q}x|,Q[0* 100S% ,(`Q?0 00000000 00 @0X P D,0a0y ЍЏ 04@BX?T?ӀN;_4O-MQ@L @pP `VTP%@ЍH0 0D00@00 01/PP P@ `p@-P,0@TpJP @l@-@f@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00@-@-P0S  Po` ЍX/\/RA-PR`@\p 0!S-P PP@  d!X@@-X^ :S\!@   s@-D0`P @P`00Ѝp4@-@04 0 40 4@ @ R D0\ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W +P0S ` 0 D  P  X R # \!x00@00H00L0 0T0000/03/A-pP `vV@P oPwP +xdV _@000V 0 `@ 0S 0 00 P000 @  x 4l0@-@PMw0@0@ @@@0      t d T  D $4(Ѝ04k;_0?s;_;_C&_;_;_;_;_<_P/D0 R\0 R\lp@-@`PlAw(@PTwp0`0 00$P 00000@w@ 4@-@Pw 0S 0 0S0   L00C0fw@ 0S 0S 00  4@-$ P P 3PЍ@-  Ѝ40@- 0 Ѝs@-@PN`/`N0 0Ѝp7@-@*PP PP8P 0  Ѝ0@ Ѝ04s@-h` P0@0@PDPHPLPPPTPXP 0PPЍp47@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ4B4=4@-p@`M[1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  [Ѝ 4 4$4@- $Ѝ4@-0 0 0$Ѝ4@-0 00 0 0$0Ѝ4`` @0Q S  QS/S//PH 4/@-  @((bP @ tP@Ѝ4@-@ ?M000H4p@-000@S0S00 7M0P0pH400CS0/0iMH4@- MPH4/@-p0M`0 P 000\@$0x0,` 0000(0 ` 00 000000᭕ЍT?4P?X?@-000S ,0 R@Ѝ@Ѝ0M00Ѝ/40G-aA8Mp 0pPU J<1DP1?0PU0QS30S  R00RC20@  0,00$0,1P0$1`|00 (`000 P PpAP0,00$00(``00 000 `P Pp,8 ; |80S Xz; P8ЍGv8ЍX?4@BT?P?l<_rP)<_43<_4rPC<_M<_T0 / 0T0$0! R!/ R  /4T0 / 0T0$0! BR!/ R  /4P0/0G-b0S  (|B 0x R x0t0S=osP0 00SHPQ呟 K00S*T0  1SLj t00CSt0ڑ,0 001 S P0T 0 P0T 0Ut0DH0L 0 H0L U 1ST0  $0L< t00CSt0 GKt00CSt0 4S$3 2@h0l t0 h0l 4S32@ 0 0 0 `0d 0 `0d t>`0d 0 `0d 0t00 0 0 X0\ 0 X0\ 4@-`@P@sAoậ0SB0SD00CSD040D0p00CSp0(000003 Ѝ@ɯ4A-l0p@P`¼?P0 1#A$'@P@Q@ X?ŃA-@pT0 Q]P`K Pp0 KKЍՀ]@0p@- AM@PJQp@8K Հp@-P40 AM@JQ  op@"KՀf/@-, 0#@0 @J]p@-4 0#P0 ق@Jp]p@-@4 0#P0 Ƃ@Jp]p@-@4 0#P~0 ᳂@Jp]G-@0 `0p0 0#`= CPPP `0 @pP ?0 RS W* p^3  0S 0 0 0S 0 Up 0 X?G-@0 `0p0 0#`= PPP\ `U0 @pP ?:0 RS W* p^3  0S 0 0 0S 0 Up 0 X?0S/0S/P/0PP/]/Pp@- P& p  1 0G1 0G1 0G0 0G0 0G0 0G0 0Gp@PG @PG @PG @dPG @HPG @,PG @PG @0PPPP@,OO@@NNA-p@P0 MW  00 0 0 p_`P 0W!T0``Dz/ 08  f Ѝ0 0 0 ޙ_i^f<_O-M` $0pQ(0@@I>I 0,06:/S *wL0  30S c,@а #IV`@Y ZI/`Pe$0000S 0 C JIDHI@9%Y. n BR)ꈃPPPPPPPăP#z?0J(@`Z``0"10"J000(0> CJ "  IIX I?@X> R;I4II`P @ 0 0=02  @P1 $HH!FQ. 1  )@P0S 0  HTH@W fЍ0S @ IT@ 8P@0SD@T80 &L0  00S 00D000H000<0 8/0(000 00 $00#1 03/@Ӏ4@^e^<_f_ ^DDD 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-P@0`0@0Vp @0ppG0Ā崐@THG.70S2 7 AP V @0 7<H@00@0GP 7Ӏр@@-@@00@0@{A-8a8q0Q:$@1Qmp 0H!L1P!h1 0S^0 A\n1PP0T313ᢁ.=Ak0 0!4104 00000<4?<_<<<_</00S/<7@-PQ@@0 0S0 @UU h000\ 0吙@ 0 00R Ѝ0@0 000C꬈PP<@-P@$` G1UP 1CUW 3C7CU( X1 03/?@1U( PC$10S&P" @000@000800<000 0D3$0P0 000@0 0PP00P:PdGЍppP QrP@0S RS 000<clc,4?<@0/@``@o/@ /@@0@#30#/-//0 60 2/@-`|0@T L0S p]qF0!PF@P P$`0 Ѝ@Ӏp@-@Pn@PsU p@JF@-@ 㝾@c<_p@-@/ᒾ  2F011>101?1?11` P@V@@pp@-@HPF@080C@00S  0 SFp@ F΀@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PE;E @0 PUFttp0@00\PS 0  P@E403 EFp<΀@?<_c1_΀2p@-P@ap@-@@Tp@-!2 A!R!!r`!U!,!P!,!001Sp!AA2S^ 20Q 0 SQ Q 1p0C0C00 ;Q2@-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|eЍOjQ_(0pS<0(000 00?o 2?P0ISM0 $00I?oR20SC0I?or20S<YE`xW01x0#L0D4`P(000U  L0S:Z0S7 $0S`0$ S0D0@0 P 0@ET`?D0m`P  E `=,0D1 @4008040 0S`,DDDZmP80[80m 0T0T@Th YT3$ 0Ra 0 S030#R0S 0H0D`0H0433YY`x `߼V`@d0X `X@\`剔 0lVh0(0p000t040x00儀0X00X \`tV 0$ 0唀 )0夀0(0SJ嬀0020 S030#R0S0 0000Cs  00 0zX00X \`? )0X X00\`5(0SX 0\`X00)"+0V0000000X00X \`H00 00 0000|0AD,?DL00 `@q`,CV800Y00000C000$0Yx x@00S0`000HD<D먎(0S 0 '" <0 Ѝ`GӀ@ӀlO-3M3XX`3@03?P0ЍV0@ᅎT3 044004@PP o0Fd0C\CX3Xp`V L0S4Z0S1 C0 0000` 0PCU?0VlP C @= 0kC1P$00,0$0 0S Ct]CkU)`, 0S,  0808@T  JC00S $ 0R C0000?S0G0 vC tC2Ck PA00S0000cCpG|`Cp~d13W@ (i $(0S1 0H0 0L00P00T00X0 0`0$0d0(0h0,0l000p040t080x0(0S<0|00< | ,C@0 ^P0@p@0C00$00 H0 <ݒ<0 PL00֒0 TђPcP΀GӀ@ӀlO-@HQB00000yBwB0@-@P$M0B000CS00 iBP$Ѝ0dB 00PU 0  0 ! 0 0 05/ PU 03/P0 ΀O-1,M 3쑓1]00AA0 0 `V ⦯(B ,Ѝ0001SppGp zpvW pኯB 0S ] 0$03/A01$ᏯL0 000S 0@!!$@A@ 0 0p 07/A Ae s@-0P31!1  SA0S0C0Ѝp@|0` @V PЍp7@-|031! QQ@U 1S000  00P Ѝ0p@-@P0P ( R p R p0pp@-`P@P (0S &p00p p@- ЍO-@ PM A1失0,0p10Wp!0`1V1!0020[ 00 0p@'  T0p@ BZ0a0S1 S 0A`@AЍV `3`#A@?0O- @$M00100`1V2ӆ01 00 "002p0r0WPâ   @넱0V @Z)$Ѝ0 K  B BӸVڜ1S Z 6 !h࿸0 +0!h೸W0101P0 1@@-@`PpH@00000@ 0P100Qۭ@ Ѝ@- `P1 @00}1 +@f@T 0 Ѝ@ Ѝ΀G-p`Ԑ3 PP 0 e@P  PU73aP 9 0 `? 㻭'@0 ,00 @΀@-@@ ?@-@?@@@-@P 40 @01 u΀031 0gbg^O-\2M 31 pD20@1=0?똁1XPaՈ0cU.  l`P nK K  ˲ӷ ?R’ʂ?1?1P1`11Q1儡U?ЍSPb/c  !嬷  !ᨷY  pW P(P1SQP`%JPH >@p>pT 0d3,JPpvtӀ1MR  !Ѝ/1MR  !Ѝ/G-p@l3a PP    UI@-M@`Pp0P @" W#!!  0@@ @ 0  @S  0  @PЍO-%upWpMH@Pl3졓1 0 00S?`s = 210030 10 .11 R`` =%+ Z- TaX 0\P0 03 BV kЍ3 =0P x z= ~=_0Q`/wt@A-@PxM␀ Pp`x ᳵdp` PZ=T IP  wo,=xЍdIP 0 oӀA-P`h0hp@0 0"+ - 0(00  03 b3Q-//-//-/-/-/-/-/$0 0!0 00 /Hzhzlz0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Qs@-`P@0S00000S! 0U@" H<0S@ Ѝp<0S 0S @΀lp@-XP`@ PD03 1pV T( P p#p΀π0 100S/I΀̀p@-P@u<5p@<΀@-000S  0#  Ѝ̀@-@0S0 R_000000S 0s0000S0StH00ddWPX00SL7$A@50 0 0 Ѝl΀=_=_](6̀ππ7@-@P f ,h04t 000l00p0000 Ѝ0輳Pp@-@P, J00 00 0X0$00(0tp@P@-@ Ω@3 0.`@7@-@`P0 0 00h1S\0\PZ_00 @00 0 $00@0 Ѝ0p?_,=_1=_B=_@-QaAM0 0$0G 0S$0 S*;01S< `10X00q01;W  ˳0   o;!(0,0(0,  F I 0R1!0CQS B0 00  WP tO.S1! B0C 0x;0  4{πhP΀X?π`Pl΀3]86T=_=_A-P~`P p吀H0L,A0 U P#H0LTp0    0SC;|03/0S:@l΀̀@-<0DT 0 !0  !p@-00P%@00.pπ0@- ! 0 !A-p@xP `⡎0 S S R00S0C0CT0J$ h0l0h0lA΀l@-00@0π@-"0 @0 0nЍp@-PHM` P @ (嫎P Ph@e:( G (J $ =  @:HЍp΀0@-A4MP000S A:\0S)  BR/* n t00 000X!h0l0h0l810000S0P=P4Ѝ0 Rn4Ѝ0@H: ,aR !06΀PA-06PPPMb `,{7C0CPN 3 1C7CP7+C0 00000)@TG5V* 37V 7C0CV+E50_΀Y>_Ѐ>_O-DM8hpV0 ,00P!3娃 03 0P($  奀0 00p'N`!P#P3 0` 0@,P(p$ 叀 0! #3P  0 0,P(p$ ~ 0`!2" 02P0 0,P(p$ k 0!2x"P02B 0 0,P(p$ X0 00!$"@2 0 0,P(p$ `D0 00!!1 0 0,P(p$ `10 00!!1 0 0,P(p$ `0 00!@!h1 0 0,P(p$ ` 0 00! 1 0 0,P($ ` -3P~-IK21 S;,AT0 00 <8E 8DЍ84t@>_=_lX6>_>_P>_pP?_΀?_!?_ ?_?_)?_/?_:?_зP$Pπ@- ``Xl\0PPL 0  040 P $Ѝu Pπ\?_?_P?_/d 0 0// 0"/// Bp@- ` pP@TLpA-P@0`Q 0P@mA-`PD0@XppQ P P@`6Rp@-P@ R! m 0t  0!R4 0 R R\ 0\ 0\00`00  0t0$0p\0 0`0000 0?_p@-P@@B2tP2pp@-@`PP62'00p`t0p2pp@-@PP(2(0, 0@@a2pp@-P@@2$PV2Upp@-d0Q@P  @0, 1S @@(0p`1 @01S, (0 @@42C- M` Ѝ0 SpA" S) S /0P@D10@ 0`01 3 0!0 UTV20 ܩ?P@0 өP@`S@T0P@`FV`@Tp0P@00 P0 0 000000ʚ;@Bʚ;7@-RP@ R8 l0+ p⢕X0 0X0 0Q 00 0@00C@0X0 0X00"fP 0p`00q 0 0\0 0" Ѝ008 M]%@_0Pp@-@P11@081@05p@i1p@-X0@@pP 0X0p0PX00 0@008@0$p@*p@-@PP1(0, 0 (0, `q pp@71p@-P@@0p@,1p@-P@P00`0"1p@ (p@吞n@-P0<@P 1`Ѝp0x1t0 0@ 0000`P 0 ` 0d@ 0 0\00\010Q0Ӏ@-`~@P |0@-@|0@oO-X`M@``x0p0x00P000 00@PT``t dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 000X005 \`$0`0/(00,  C0@0#?0 }0 /050!0 000p 06`P f0 d0 `10[0 0!#4#0 !Al H000x00CSx08ЍT ^[ ` A-pP `P' 0   ( H @ /h8 *`0@@@%+3 1 0{3pЍ]O_A-PU@d0p00`h0/)/T]p@-@d0`P/ )p@/p@-@Px0Sp8UpA-@P pP/X0 @ 0P  /x0S/`r@0x`X03V00  ///A-R@P` |pR/h003//h 0 + !01 0 R)p;/X0% @00C@0 0R 00 X00X0i/ g/h00 l؜A!#4#0!10  N/p@-@`P Y@0 1p0@00F=00`'t`DG pA-A@ `p.@0Q0@:( / # # P 402 /,0P/0 0R03 0@2#/m`6p@- @`0PT 0T@)0,@P"VPP@ 00t;WdVP ,ᩈ<-W0z@ap !W@k h6A-P` p@0U @TP e. A-P0@(PP3paS.Q.@01@0.1S1S .>.8`(H1 Q  PP10SPh0 0///@-@LM@ j 00\00`00PP P:忛 PLЍ(`P pp-0p``00q 0 0").0 n0P@-'V@ h6\P;_O-P 0pQS hA`VP&P 8cV0 sP [V Q$ PS PS0P P E [  \  sP(  S% 0T 0EC1 00[  ?V00V`6h6p@-@P 0S UP |Vp@P\UpPU @Up, PP & PUph6A-P<-hAT h0pS ``0-\0$ 20S$0 e-@A`-]A-Ppᘀ-ATAS-h0S `` -\ $00$0  qP$00$0$0S 5-@]G-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101 -0S 0h0/h]O-M( 0$0 B0P 0 (0S $ Pߍ3S 3 083/PP803 000000 0S 0S (0 P $ 00S0#003 @04/PP0`3,00:00 pp TP 0SL UP3S 90?00P03 @#04/PP30C3000$ Y T P P  0,1 1 RA!Y @Ր0< d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>0!#4# 11 | p+h003/PP@pP |,0 0P+X00X0,09 P+X0@00X0X0 R)0X008 0@@0@@0@0$%0 R 0R @TT0i ~ 0P+X0@C +P +Q 0#$# AT S Q Q @ ? 11 0R!rVP|+0@V+X0@0X07300+ SZ @0X06300x0S(  x+s+ 1+ PtSW Z U0@,0@`S 0 0C 000|P+| +000h0 0S 0040*h P 5/P404+U 0+ .+ 0\00`0 PP3S0W L5310 0P3S5 H@Xp 3 C pPpӀ h0`0xP*00@015w  8@P@0!S&3S XHhpP@st@ #T *@ 0S 03# @04/3 0C( P0@0p00h t0 p00*萍0s*q*0@hTX x" S 8m*8*@  S 8^*Z*=m Q   h T8I3 S{*~X  X " X @  B@ i*|00%* 0^**X0 0Z!0X0@00C@00h0 0S[  0 @0 0X0N @ X ! 0@0#X00 @00C@0)* )) 0S@08** 0#03 @04/@))0萍000 0[  T RI 'R 00'@ 8)) 3/  $!0X0@00C@0 !00 00X0 0 0@@@h6|]@-,0 00000 00Ѝ]p@-P@Tp`OP v@G-`p3aMd)1 PUG)P R)p@-P@``I) 0@I @p@)p@-@PP<) 09 0p@v)00/A-@P@pET|`*)h0000h0b)@]00/0 S  0S o/p@-@PP)X0d`)P=)kX00X0F3)p@0)0 @-@L屛XPP@@-@X0 0dX0h$`03$!7$H@ pP tP @x6 0'zx6 0zx6O-p`@嘰  HQ:/PDPWe \   0iP ?P Ѝ0S 40A3/0`@00@`PGG-M@` 8pJYP+0-P@@0/S WךЍ10 0 S?@# ,* b۳0 C /  C1$@ P00<`00 D` PV@ k`F ẳ0W@C0`F`00S/ P 3/>A-P0 `p00l 0 0010 (@0P Ѝ P'0P 0@00 0 0CS 0P`V pZPp P'0P 00@0G-PЁM! @@P a0 @@9 ;xQ1 0;0 @0Y0`!hPp$@T l`Y-W0AU2(@P ^000(` S'Ѝ 00S S S [ 00@0P0p 01@ 01p@ 00P!0 R nЀ8?x>x6@_@_]^C-@PM> (0S; $ X7 `V6 f0Ԑp03/ @0^P00^P 00` 0 g`P 003/Ѝ ͳ D0 (0p`003/x>@_rP/(0S/P/ R  00/G-Q @D(O08$ Q!P( U qOp PU PU ^`Op R(0  @` jpP PU *\EO$0P(@S0`$`$@0S   0 ЀnnG-PQ pN@(`T `(耟VOn&t! 0S&@0S LPPp&dNv"$@T 0Q S   0 T#`@ЀӀn]A-@`PpU 0S  A   0S STP@-@ṓbһP]3_ &hP lP 0@A-@I`埻00Sʬ寓#Ѝ0 0 0PPṎ0 0,0pp00 00 0P ,0/pt0Q0!*៎рH?|0S/@-@h3/0|0h0O-dMZ@$ ` +g0T L0P $0(`T `P8p$p* dЍ PM`P$0p$p m1 00;`P c/eP0Sz@!PPu!(PPo00j( 0;0!PP`P1 00 0000 0 =PPO^0$ 0C0:P0$1$T0 1 Rjc!A `( !l  2/`PH0T S*P S:00S18 ,0 0Rl pP 5ptP 0tX ZxP P `Qnx6O-`4Md@qД 0L0 ?0+MX) xS受4LP0 0/0 0,0p p00 000P ㏍,0/pt0Q0*#P,00 04PPb,0L ~0P0wP000 PhP|P00(0L0 C5<0X0pPtPlPxPќ(L >PP X0H(``QdX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S t20` \(0,PPUd1, 0d1d1`l H(0000C01\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ 6~$ R!0 R $0$_$0P(P`10`1Q\`X00X0 P\`X00X0彿X0 0dX0$!$G$ H P pP tP \kLgLX0 0R0U0S  x6|_@_ЀȓRȓRPGhrO-40p<W 4p40q0;40q/:40!0R "40p #S0, T001"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@ig 1\D03/"(Ju4p0004Z0xe","1S% A"UKK(0 T 5@ e"5`0`S "hF)4040pWgx $pL"  lU @eJHJ ~"Y q#@@__A_+QӀ@ӀЀO-`,MpQ #` @Pw@T ,0〠X2 P@PP  P< P` X !P P`@#0SK?Ɗ媏V 0U> :$@$ @PN `0V): `V 00 ` j@P0 00# $ 00`00@PQ  $m@0@,Ѝ 0S S +$0t@P$q$ U`X hI}@?рQO-a4M00PS@u!!0S Z0081S UhX0T P30_,00000>0#6040080>0#60D0>0#6000<00@00F80S O6!0/1000L09L0@0(2i!5@ 0 0  o0Pdp_W'cp^WL0<L0T0P . .`1Sp pP0  I0  I5p4W  p+6q+6!0R  p !Q<T0    [0 x 000[  [ 0T6p30pGor0 HqP  $$01 0Y:pc$!$$WpW /gzz zD DD0ĐN I1 0彘`1H!<1d1D1l0 p 07/pP\T!@0AX0  81 0<1$0@1(0D1,0 pPGk l0 0,03/l00S 3/Ol0 0$K(0Sw [u Yr 00Lp @07/ 0 03/3 0000  0 0TpP 01Q 0 03/HZHX h# #HX pP tP 0S H&p%W   R 2/pP+$R [    pttr/H`1S e l0q 00S p0Sᑳ$@G$0p  $@1H0tp0P  1S 8 R l S 2/l0 000S 3/l0 0 1l !D03/<10S ~ZHZ,H^%0"# " pU uROP0. pl 000pD p p $pM&0 0Z000C03qXo0 *` 0S M5p4Ѝ[PGӀЀx6@_|_Ԁ0@-_MP P@P0 z_ߍ0@-(000000 0ЍQ@- $0000000ЍQO-dlQEv1S ~'f T 01501 c 0Z0C000000Cl \V U2 0 D\l2\~  Yi <w%&  [-\1 P 0P^ 0S 0S5p@ 5 =5Ll0Q QM00pO `<C?;x0S `\3A_ԀӀ{ӀKA_@Ӏ3A_p@-a@PP0   DO-M00SP؀  X `\63q80S0r ZYY1 `x0  $ S,0O 0 0 0P,*pD P $0S,02 H0S5 `[,0Z R3 RW ,@/0SRP0O 1P00000C0X000_T-0S00S% `P (%@H0S PS0,0,@T V5  Y4M &P0 Z0S 0W 0 P0P0n0 `0 0ЍB ,@Z0S0S5@ 0000C0X ?005@000`PV``0,0 ,0p0WZ0S000VP0830NP0 Z0S000W 0 P0mP p0W 0  0`P cVa `5lP@ 0U 5 =5P@UH2PH0@S 0  0K {Ȅ|p(-=(X*=((X&=0S X (RX (0L0020Z00S   00C0p0St t ' `%D(% a P6,=(?P D剽 NJ ljA%0 S Q R0 400``0 o0ZQ"04P B+ 0 0` cӀ@ӀӀ3р0@-q@M QaT0P0` ,0 2TP X åЍ00@-P0dM 0 0@S0 0S0 Q  ?o 2Q0S X dЍ00@-@P0 SMS0R  0 0 0000Q P }Q P  u?o2Q0S kSߍ0p@-5lP@0U5Pp@0`P *"P5<50 Spp@@-X0C50S[0  Lm 00S @SPGO-`$10|0L048<0L0 !80 !!L0?! 0  @  0 0 7002P DP  㿻D <0<0 z,0S;,0[0000[` P055 l`0<10x0803D4P P0$(, 0P0ᙂT0T0(= ( fd 4R =0c?0h0d  0400h0$  0`00,00?. 40!! 140S  3/B10 0S [0[00[0x0Sp p0t (0x@tH05A ARX B0BSlz505 V@ J id~$j;mB0BS  R`0@1d0Sd d0h 0d@h02 R @0@[ 1\D03/2022! X! ! ! X! !20C22S *Y 20S QP1211S T0  ip(Ji?p4P0) 0 0Z 00400 [`00005A ARX B0BS5(A0AS hIx 04pZ0kYB0BS  Rp@0S5D0DS Y Y yIJ4GрH?hox7QA_sP_pA_wA__A_3`EQӀ@ӀPG@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1@h@00@00 00 !!0400000, !  !==P 0 W@0e=P=P3S 7o7p@-X@P0`S @兼8<@Tp@ F=03/@|oRQ7 0o_@-0@T0 3/@|oA-Pp `4 @P  p `n00 (R $@ @0@0W|oA_o R 0$0 1 |oPA-@`!PP0q$0开0PU(0(0SAPS 0 I0 3/00PTp PDU(0 S 0 40 3/P|o]A_A_^p@-`P@  `  +n(000p@-@P@ط0S   зG-@`X %0p013 0PUPU'1Y P 9/0SYP  0  号0PSU0P儷P PPA-Pp`t@ ``p0S0@@PA-P`@p~0S 0S   RA00 00SD0 3R W@ pA{xp@-@PP@Tp@-@ <@^7&B_O-`0Sp,M@PTXbP ` x` 000000 00P0 00<00 @@0`P a,ЍZ  $ \0 $$0&w[?p`p  cU 0S $  0P 212 2<22@022 02UY 00@qr@-0C0P $p!Qd2  TLP1S  < ,$/B_7B_77hB_0@-@H0018,@0S Ѝ77p@-40CpP0[;P0UMpp@-@00S^P00#;#P0mTpp@M@-0 0@/uB_ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz00S/A-@`7ăPq3PX`00S xP ^P [P4 0,,( $ Z̀B_(]B__v^x?_0 0 0/@р7O-`PC1(S 01O000O~㌐0I0SOa岀po@n0S p0I0SOa岀a \OYL@рG-餀PopWUpP@@ t@]!8R#8 @L A@ 0B072S S B! 0B0+@р0@o/@р 0P/,Yр0@- 0D0R@00,$00HP dv C-p0MP0 0`` @0 P 00 000 0@Y?o2P0S  R Ѝ脽@-@08M@@¸0 00@ 00@@0@8**0|0 0000,00 (00!P0 0H0$@ @000'> @00]8ЍрhaQaQB_рaQB_@-p p@p@0@@SC 1X01t@ H5u@@<<80$@~рopр RB_(qB_prA- 0b@SPpbe~b0@X4100S 0 !!04L0H0@000, !  !Hzhzlz@-@Q't T 03100|P0FPЍvx 00SP 00S t T0 #!R`0SӀ@-P 00Sp@-P@PpTUp7@-P@}00 Ѝ07@-P@}00 Ѝ0@k7@-@00PP 000U [ Ѝ000/0@-P0M0@ 000TЍ0C0 0 @=P 0 P QRp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@R?0S P00 0000@-@ 0  R0Q@R  R 0CShQhQhQhQxhQxhQhQhQ0S@$d0  07p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S}@p@-PP@W j PpP0 b  BRdjQjQ(jQPjQdjQiQjQiQ8P08P0P0 ?R8P0>Pp@-@`Q6 P08P0Z0S P0S 0 000C0 p@]R41041/41!0CS41/p@-@Q p@Dp@-01Q@101`41Sp PP/@P/|0S/@-P1SO-餓MsQ[0`J`V  00 0C0`>8AT㜲@ 0`` 081S.8AZ/ dNh`0 !0L @0;/2 00  00p`P PЍz[8APU 0R `0SNPXDPܡ  2/0@ ! * 0 0p`P X*  2/ `0*i`P { 0*!rX 0000@ :0<`0x0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10<2020 20C22S) MP&#x>#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S v20B{0u1 00$_V;0 0 `!`0  0 0 0 004 00 0(0011S ! !! 1 00C000C00100C0 h]  P g P;0S .;Zjh0S YP M00$P .\W,0 Ѝ@HrӀрO-PM`pDT 3RU ]@u,0 \ *00 0 0P 0 P u6 #@T  ᠰ5/:L h Q4p 3c 2 ,@,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0Lwp pZ20H0S@u1 1n[X@00#:[ Ļ@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S 0P N00=P 00S t |2 x p@0@@SC 1\0100e 1<0SЍ3/rр RB_B_] Ӏрр A-0p3a 8Q@T0S 00(o ׯ081 0*oX˯@x>03hl2/<@-@1 0S@A-Q 2@s 0  BR 600 1@0S 3/]<o 5P0PS P0   1hS!!1 !   P01 P  !> @P0#Jf0$ 0P+t00C00S   rWM0 _ LXM(1S,1S |`V ;:LaӀB_B_G-@Qdq+NP00`P  衔2 vP03P0(f ᮼF7S  >PY @  00C0 F 0 ZL $  0 000P00P0Ѝ O-`pA000,P0   P   W| Ps 01P90\+ W !W V$ 0QU  0OW(!0 R (R3 \!Q, QB V:  R \S; Y.  ǿPW P (1 S0(100C00,1z R0,1(10X 0C010u \  0R P偿PPu PPA- Pp`3@2::P@1@!<`JᾭPP   ㆂ0@D@P0Q @@ݭp@-@P0p@S@p``FSPP  ϖ@  B PR / t0Q   0RL     / Q `r7p@-P00@Tp0 YP @`rp@- P0Sp8 P`@ᜭ0 QV ᓭ Pp!!0p@-P@㇭@0$P0Rp7@-@000RP s@@o7C-MP00`0p0 0` @D0 P 00 000 0@)R?o2P0S R0 Ѝ7@-D 0⮭P0PP0@EU Ѝ05奞B_0/7-@-,00NVI ЍЍ/ C_&_^O-P`С,M @TpPP VPp 嬔P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #c0S 0 PP 0x P ᯬ0 000!R00! 0V0C0@`r"C_7C_[C_O-0p@!T?Tr ሬP `1 !R  !1 `Vp〱Q `10 V$PQ0T0< `  Q      Y?@10Q@Dp0 P* `0   `P 0 0 @Y0V `P `T@ Ѝ`<]`r7P]C_7@-P p 0|@P X Ѝ0Q000 $!@ C_D_7D_D_-@-<00S 0,0  ЍЍ/рD_&_^G-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8W$0S I0 0C0!R 00! 0S% P ߫$`X!P l Y0000000@0@@000000!00C0D_D_D_E_E_8E_7dE_`rE_G-4Q4q `,@T 'W 喼@$0S- 0* |<0P000@03/ P R00S $ 70S (0, 0 Y"P<000 @ 0"  7`rH#7X?рE_E_0 /$/@-@RP` Ѝp@CT0 0 00 0P Ѝp@-Q`M AP0 ( 000@P @P Ѝ菹Xp PU@ 0  U@P0P S  !  00C0`r7O-DMB,0RbS20,0ɻ 0"0@ 0 R"0 0 0000|" tt唷pBT:0(00p<`@PD"0  < 0A (0p,`$  <5S<0 SX ' 0 01< 0A 0,p(`$ S0 01 0< 0A,p(`$ Sx1 0< 0AL,p(`$  R@1 000<< 0A 0,p(`$  @R0  00A00,p(`00$0 0< @RpT@g0000DЍ R P 0 @o7E_7ء_F_x>777 E_PQC&_<_*F_8рK_1F_;_6_tr,QCF_d]@- @0 400`$0 P ЍX]LF_؉Qx]VF_@-鋸$0 0S@薸   0`r@0P`P/'@-P`0 H 000㵷@Ph@tЍp@-@]000@i@-@U00C0@aG-`PAqT:pW @P P  0 éPP  + 0S  PP0 Ph p)PP 埩 80p0@@@<_ء_<]`rF_]F_F_F_0   卩7p@-(@ P40$008p@l7X?O-M00p00h04 Q⨐ @ 8 00(0<8 T@7   噐P @00S 00 0Ѝ0 傐P0 S  ! 0000@00`  rPK PB@TP 6YZ  0P0 0@Pu 0 P0 0(00$P0 5/PP  D 00 0P00@00lPP  N ިY 0BS  50S0cS ڼ5 90KP 30S Q *PZ PP  P$0S0 PPP$ 0  YPPPU$P'0S P$Y `a^  叨PPe  `(P 0(0!R00! ,4 \T 0 ᪏P 0 PP@1^@0S E @喏P 0P00 @PPP 0 @ [!$ 0S ,S0PU,UPP J R 8(0[S 3PP Єp P  {P ԗPԗ$0rS @  `0, P $0S)( Q03/P( P-U .  0I80S 8R$0S &`P,8PP[ 03/ `0, ɧP`P,PP[ 䂘ז0(0 PP$ h03/P!R00! T0Y@S㤀 0S U00(00,00 0 0 0+`V6 03/`PP" 0 P#`r=G_H_3G_)G_G_G_G_G_/H_Uo'APH_xH_H_H_H_I_J_I_jI_I_AI_I_7 J_!J_B_LJ_xJ_eG_@-pM0Pp0嶵Da @T U 0S @T%@0S U  R 0S"000 !R00! 0p0@@@  P00@   Q     0000SvЍ`rA-P`p\@P  dd@cЍ @@@@ 0㑴@P@0 V@3G_G_@-P1M`3A2z?0` c00S /ԌP U@-Ѝ@njP.Œ@Pp㪲 @@ 0Q@P L90 @ ,J_рJ_J_K_8K_ 0 707 0 070 07p@-`P` P@˴00@0  @@0000PUδp6/07`rp@-@ᲴL0PU  R8 00 巴p@ť 03/P`r7@-@ᘦ0 00Ҁp@-@@`P00  ⋦p@襦Ҁs@-@`0P000@ ᚦЍp ┦Ҁ@-$@ ⾶w ҀTK_O-M 0Y0`0p lXP)/P$ 0 $Ḿr 0  ԥP@ P Q0 `Ѝ0$0 C@/̋P@t3t#``勾HE 0  ⧥@P ',3X0$0Y@X@  p+P[ḊP`'@ 崌P ĊsP  @ 0 ]`2V <(Z` (00,0  ```@P cs̤ T~(0⹨@P*0!R00`@" 㳤1, 3 01(00 0000 0ᴬ0@P`,0S$ @ ᖤ`(˶(  წ sሤTX 5P ԄP P@} `P @n$ 0Y0R0S`YD^]K_^K_7tK_^|K_K_K_K_K_K_0  rQ7L_$0 0!0 00 /Hzhzlz@- @ 0 /2L_/20C22S/B@- $0 C0? Ѝr]L_']@-<0DT 0 !0  !p@-P @hxU00p00000P0p@-0@000/G-`@#202P̠ X4 CX$S\U  PmU P0 Sd pnmU d 0 dGy]@-0  \X40SX4 0 !H0  !Ѝp|0@`V  ?m00dPPP7m00Ѝp@d `/m 000 Ѝp@JèP/0 00@o//@-D@ @X4 CX$S\#倿@moA-P`@pݢ@0 80000]ȣZA-P`@pʢ@P 0 $0000]ȣZ@-@lPl(@/ 0  0 x0S0 0l0 h0S0 0\0}?r0}?}r00<0 R / /8@Bx 0/8 0 (8@-0000(0( (0$10c00ЍX]QzL_(8G-P 0$` T@`FH0 00 pfMY <804 0R 0s00 000000  B 00C$0䤴XG1_O-4M$0h4, 3\`1`p@00S 8^XX0600Z0 P ! ` h$00剳 $庍0P0D0V ^0 _p 000S00(000 0S0@f0僡000S00 :@T 0R@0T nV@x[@000 0TP(0$0,00H000000070|2 00 4;80 0$< Sg0;;00S8#$0000\03/$0" 000 0 (00L0P  u0PH 00 00L0 000SY  0S0 0S  00S 00TT [^X ܲ0ᙡV 0`5000700 0峳4Ѝ òm0S1೛0 00 00,03/0 0C00 000  000  0C0?0@ 囲rQL_GQ$0S8$0/$0 0!0 00 /Hzhzlz@-M xP@x`xpT  xU \XЍ`vP UMJHP Cx@^L_&_^G-`plllPB<@0S 0SUЍ)0 \  08L_L_wQ 0O-p`PDM!2 (P0P<00p,`$  @?o2P0S 0000 0P0S0 0Ѝ@-p0 0  ^8 0@0000@00C@0Ӏ@Ҁ@-@TZ0S[00[0''d@ 0@-H1M@T- 0릶(Q 㧙!0   P@@ @t00P 嗴 0Q@@Q@3@t0 0l0@@0@0@ B DDЍ0@腦]Ӏ9Ӏ0u@ҀrO_0?QP_Q;_0O- a 000p(P$@ @B0찟,00 000p(P$@ @ @PB/0,00 000p(P$@ @ @PA00,0`0 0X0000p(P$@ @ @PA<Ѝ@uTQ#P_9QsP_2P_LQ8P_000/00CS0 HGp@-@$P,@U ۘTpp@(՘Ӏ A-0 0 2#@T 0PSpW Ax `p0S RpP$ 0RAz@TA㣘ӀӀ{@-M`pṵ@P00Ub 0 0  00@00T0S@1 0 0S @Ѝ軵 0S 1S Ӏ@-@P0`0(b 0 0  0 0 @00T0S@a 0Sq@Ѝp1S1S Ӏp@-P``  0 0@0T 0R0S 0S @P4Pp@QC 0S~ӀӀ<:D 0  !"P/ R0S//ӀQp@-@ @PXTd0P1@0P !0@@T@EpӀp@-P(@p`6pӀp@-`Pa\ T `@00  RAP @ppӀӀ `0S  0  /Ӏ 0 I9p@-@Td0QDSh h h0d 010Sp@p@{ӀA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR {O-S0@` (:`6p0U,#0 0+Z  R` R8 HP P}`Q l TV7Q R lP Z RL  \` PW  ЍQ@ZOP0QS  Rz Pv QV :P(֖oYQcVZ U Z RY Z&PU V000 ` @ $   1 00001 [00[0`0`p `p  d Rhhh d!QPP Rdd h@hu PVu $V (mPpPIӀӀ{@-1PM?@?@`pL0{P?oP20S`ߍL 0RP S@0@6/P0S   0Ӏp@-t`@3P1S 00SP31S pAP0  OP000Pp@-P0PSA,00S )aPpjp@誣XwG-0PPpa|@P @T P03P0ATAU EYL0<L08W~TGy 0 P90|90@叴9s@-xR   q@ 8 | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/D  0 R0d1`0S00#0H1``0S/00 /0 f/6& *P 1:f@ 0|i0`0/0? ?,0l`00000O@儱t0*|`P4  ;>Ѝp@Yr_A_o9p00p0P >p00p0>p00p0[>p00p0T>p00p0`0t0<1x04/4/*-Y(0B(-R #t- . A. 001Vq1`00` Fd`>1 1mRv{ qVr{00 0 Z &h!Z|2x1[k1"04P B+ 000 0zG 1 G0/h2p0l"/`2 Z0Sz pCSWppp'pr00 $! ! ! ! r"&" 0r &0B2*H0V/p2t"0 0p0`00` d`R> 0,h1P:>p00p0T0000 0S00@00ip0j10S  bPG0V100`00` d`'>00   |0 S)W 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0z PNz10S7 $0 |01f0010 0Sh00h0100Sh00h01F1 0=[0 100S R  V 0X00\0`00` Xd`=Z 0BRS000#0s-( (!!( 0!!0 p00X 080`00101 01(01(Lz`N @"D !HL  $ (,8"04<(X0h\ l00  ` p  R00=9B =C00P20T2Ѝ0`` d`2= 0` `00d`*=$0` (`00d`"=(0` 0`00d`=,0` 8`00d`=00` @`00d` =40` H`00d`=1` P0d``00< 0%(0` ``00d`<q qqqqqqq  ppppppppp1p00]]]],]8]@B@-`P@v 1S0 PЍpkP L0 00000 00㟞PP v 0Ӏ@-`PM@pv 1S0PЍ:P 0S P 0_X0 00000 00^vP 0S U ӀO-Q4MX@dp|4ЍOv8QT@@Z`PG J[k@fZ70 @P[ >0 0O0$@ 0];00 V@ T VJ 0 Z 01o1@P0Z@@y 0ȏ#60  V@P DAT@ `uV 0Z 01 E1@P0Z@@yU64Ѝ6p P& [00 @@0 0川P@ VJ0700Z0 CSRL0 @꒟ mP@0J0 @P Z$0,0 0000@0 00 0p`@ӀDQC-M p@P0S !PU  A&` 0 :s@P`P Ѝ@@-@፛0 000 0@06oЍO-LM00|0 P<0H<@3pp U%`v <0 p|000xtpLЍO@70$00S$0SVh SV000 0`0S0000 00S$0U `VUU00U@誯00 005 㧎P 㢎1L0:p@0@A400(0080T(0Sy :ATu 0(0L0SZ0S 0 000<0@ 0壜P  @ `VQQ\QxQQQLR\RhRtR`PP110$[0x0S 10 R 0S(0S6 0S0p0p@ ,00S.0$ 0S0R0S&  $0SY ! 0 000 b00 b bY 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@ibH0YH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0 d0d0h0h0l0l0p0p0t0t0x0x0|0|0000Y0000000000000 0000000Y0000000 00000--....////1Y1 1111 1 111111111 1 1$1$1JυJ?Y$ 8181<1<1@1@1D1D1 RR]v1 1UvY 11222/Y22!2? !. (2(2,2,2 0, |0 S 0!4 <.T^[ ,0SFS 10 Rx ?RQ 员X勘吘勘wt 3( P(00 )9  pa0  90  90 90 90  90$ $90( (90, ,800 0804 4808 880d d80l l80p p80x x80| |80 80 80 80 80 80 80A/A80B/B80C/C80.80E/@8@0F/F1080G/G80.80N/N8<1Q/Q<1@1@10y80/s82@0@ 0 Dk80g8(2/(20`8 0, 00C040 040 00C 080 080,0S @T00 Vu0S  400C0 08 S * f@800 U=0 2 LЍ0S   @ҀӀ1`00/1`<10/1<10/p@-@$Pa100,pӀp@-PP`@V11 P@ 10$00@pӀp@-PL`@V11 P@ 100@pӀ@-@p@-P@p@-@@-@p@-P@p@-@ܖp@-@`P PpR0p@pp@-@Q0` `00p R0Q`R /O-MP`8pu@;vux &M  ኖPuv\ᆖP u yP uOO널IliO Opx ovc _  XP @ TP  0 P[  Ѝ;Pvx3P ᦘ+Uv 'Px  P  PPx|uvr Pn xux c  Pf   P_u Pv O-MP`81pRu@'vex `:  ʕPuvLƕP /u ĕx Õvg c  ᬕP @ ᨕP  0 TP^ # Ѝ᎕PvxᆕP ን3{UIv wPx  lP  hP_Pxuv WP~ —uxW s  CPv   ?Pou 4Pv ភo@- 0  x Ѝ"0@-00 n Ѝ@-0t`q @uP$0P 000S Ѝ7@- 0   Ѝ"0@-00  Ѝ@-0t`q@uޔPٔ$0P 000 Ѝ71L0#400/s@-@`00 0P@PЍp@tЍp@-@PT@#D`qMT1  r  ЍӀ0A-a(M 000` 0PD@P p0  @P ?T@(Ѝ'1P0 ` $0R  aP 0p0z/`00 0 00+>DӀBP_(0310S/00S/㢷<@-d03" " R @" B"2S @'@T*P p@-P@Tp 㪈000000@p@-\03Q0S m@T 00@ ㏈TpG-@`PT1 TG TGUE h1*FRA:0CU= op81P3  1 0SP|% P$ V* W%003A }j @T@ 0V00CS  @G@@ -@00E "@(vA- P@`N70 0S\Z0S=Ɍ ͌pWX 0 S RQ   ЍS@-M p@`P 70 0S ^0S PQ S 00U0Us00Ѝ@-pP`#@P∀ 0 |0| 0 00 h0 R\0Q _K{0 M$3S G^̀3̀ZI0@-M 0000 0@ᯕ0P     {P ЍBA-@ `$P B  p֒PӒUV#3ǒPƒU V VX031S ( ,02 0P03#\P qp@-`Q3 OoBBP @HI PP0@p OoBBxӀ@-QM`@|P0T  R 0@ 00 0@`)PP PbP `p]W WpVWP ЍNO-QM@p帰Q @PH0P @@0P 0@P:00CS@5 aL0` 000 0o0 00P 00 0 0 p}+0@?o2P0S` 00 0@P 0SP000P0J ЍL]O-QM⨠崀:p0PS5` 8@P0 @@0 0咔@P⒟ % Ѝ 0` ?o0"00  P 0 0 #+?oZ20S@ @@O- DMPPZ 0!@/ Pq B,$o 0   0,p(P$  .0 000@!. 0 .  4,p(P$ @.+0$ !00/>t.  l.00 0 4,p(P . 0!0. 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>͟ 84 0 0<0@,p(P$ . 0!/>4, D40  0<8@0@,p(P$ u. 0 !, 0   84@0@,p(P$  _. 0!/>x̟x 80  0<4@0@,p(P$ H. 0!/>$ D0  0<8@4@0@,p(P$ 1.0 400 !+ 0   80@,p(P$  .0 400!/>\˟\ 80  0<0@,p(P$ .0 400!/> D0  0<8@0@,p(P$ - 0 !* 0 4  80@,p(P$  - 0!/>LʟL 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !) 0   80@,p(P$  - 0!/>4ɟ4 840  0<0@,p(P$ w- 0!/> D40  0<8@0@,p(P$ _- 04  !( 0   80@,p(P$  H- 04 !/>ȟ 80  0<0@,p(P$ 0- 04 !/> D0  0<8@0@,p(P$ - 04  !t' 0   80@,p(P$  - 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/> D0  0<8@0@,p(P$ , 04  !\& 0   80@,p(P$  , 04 !/>ş 80  0<0@,p(P$ , 04 !/>| D0  0<8@0@,p(P$ , 04  !D% 0   80@,p(P$  s, 04 !/>ğ 80  0<0@,p(P$ [, 04 !/>h` D0  0<8@0@,p(P$ C, 0 !4$ 0   84P0@,p(P$  -, 0!/>ß 80  0<4P0@,p(P$ , 0!/>\T D0  0<8@4P0@,p(P$ + 04  ! # 0   80@,p(P$  + 04 !/>Ÿ 80  0<0@,p(P$ + 04 !/><4 D0  0<8@0@,p(P$ + 04  !" 0   80@,p(P$  +8 40/xx! 0  <0@,p(P$ + 0,$4F! 0 <8@0@,p(P$ s+ 0!/> 00  0  4,p(P$  @\+ 00/! 0   4,p(P$  @G+ R;_pP_$GRxP_d>R8_P_P_P_<_p@-PN}@ Qx jfpN}0O-LM@(00<P`p!0 D0 a0,P$@ @@ @<D@D&D0SR 'HH1 0D 0a<,(P$@@ @.&0 010D 0a<,(P$@@ @&00D 0a<,(P$@ @ @&0 00D a00<,(P$@@ @%\0 0T0a00<,(P$@@ @D %LЍrt_(G Q_Q_$Q_LG.Q_@v;Q_  0  /(Gp@-$0@S,$0 P R$  Upt`0@o>0|0@0C0000   0 S po0?C-@]`Pᰐ1qS21 0! 28. h R R R ' 弗X0@00P0#*1S0Ap@0 0@00002S000000SP ЍC D000@HQ_@<@-@0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@E`　T`W |p PW 3U  G脏ꐏP 0S<@vp@-@P p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0Bp@-TPC%0C0\0(@T@ 0S 0AMCXp@- 0!0@@0  /lQ_0/000S/@- 0 00| ЍZ]L_bDv\]00/00//O-H`Q@S 0p0202  㷗X07E3" B"2S1 ЍOp `00S<<0 ᎗X <0 40<V 00S 0 Ѝl]G-0P@s ppD EY fUPa<`P WVV `XD 0G<D0 XD0 QA-Ppp `D0@c`  (TD@A-PD`@ @V` <pX0# @< S" V@0 A<<p@-P @H0c   0S@`Dp0 S pP/0# S/P/ 00@o/P/P/ /p@-@Pz@0000p]Ӆp@-@P z@P 0000p]Ӆ(l@-@D-lPD@%z/O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` b0 P 00 000 0@?o2P0SH00S 0 00,,Ò03/P 塔4GPv]Q_Q_@-噔Q_@-P P d``娒PTL壒 Ѝ (,噒唒8GQ_]R_R_@-e划])R_@-@ xxt4Qڀ  !P H@, ! c]CR_HzhzlzZR_A-@M0s' p`PD@T#0@400000 ,00(00!0$@ @ @00 000'>0<0!@P ha@@Ѝ`P p@<0W(0 00PSPKPv4GOR8GA- @M,(1 000p<`@P0<0A0,p(`$  !0P  @Ѝ<     '.A 0 ,p(`$00 0! P P\ґPT@<`PppP  ƑPU@8GvR_]~R_PvR_R_XvR_s@-`P 0@TT0@T  S  0D 0 0 "P $Ѝp 卑4G8GPv] S_h0#(1< /@ ρP PQ00@0!!#/ 0S(0, 0 (0, (0, 0/ B@- @ +P 0S,031!10Pp@-P`|@Tp 0SP0 `00C0A@- jLp@-Q@Z0S P0S00C00 0?0 p@T \/ PGp@-@dPFͪp@&p@-@803Q 0dP 0 0F⸪pp@-@00C"0!300 P p !A\  Q` |`000PUR0(00@@@#p$0P @- /PG0S co `/P0`o@`/0@-@0M 000@0@@@/0xP 0l00@0@ @@x DPW7 07 ((Ѝ0@[VRT_Ԁ T_ӀmR4VR;_p@-4` Q[ hpT0堋@  60P89+_s`Ԁp@-@[@hPp@!0p@ 媋Ԁp@-4`8SpP0P o@  +_084@p@ԀO-04`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@Ӏ]p@-@T 0 R X0 PP T x D_0000@pt J0Ԁ0 0S/0 ԀG-PPp@U3P @T( 0`S 0V00 U00 t  _V  0W` S `0W P x xJ0p0p@-@0PQp R00  㙊Ԁ@-@P`P" RS . 0 000 00 000 00 0 VPP  E2 1"  yP0E"0A 30Ѝp0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@Mh04`pP(0 000"!       P0?S$P(P,P0P4  Z L0QQ 8QQL02 SR|0p!!!!!!!!|0S Ѝ]@-Pa@> i?,10!(1T00!41  1 00000110010 0 p@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0 MA10101A-0P`q ( Ƒ@T  00@P 010 10010@-A!  !!! 1P $P A-@ 0S Pp`qP0 8P0}@0D"0!!#  0SW00S@ p0>S? 00CS'hfRfR8fRfRfRhfRfRT P@G N 0 S 0 0000@<S P@@ -@@O-Z0M0C21@S F⥦P4 q<00Jp"@03 [P`+ q`P -PPP  !QP PЍ! 1 0S P 1PS01ą`$ 0 00 0  (  0S @1S Z RP Rp Q+  _0P pQ   BV 'V  `P [0  D@P7 gPP1= 0 B "Vx1Sp` 0?\ 0p!x!ZR|||!xruZ0S*P0SU =|@T@P`?o22PP V Z  R ; 1UP0/1P0X Z  R  ZS 0Z0P0U1P0Q 0Sl 00C00 0P?o20SA Z1UP0 ]@ԀԀG-P葐tp@U" PX1@T, L0S` ZR` 0  ``PX P@T PЍ@TU `0SL`` 0  ``P X Z0 CSRxPd@Ӏ@Ӏp@-xM@?x ` PF0U0000`0 0}(0$(P lP, 000P0 KxxЍp@-P0@1P00Z00l 0000l@ mA-`pP^@T L0SVP0S@0SP|UAK2Ӏ@ӀӀG-1`pAZ0PS&\W P_0SP0SPP;0S|PP0S G0 fQU 2ӀӀ0@-|M@t P9F00P |Ѝ07@-P0@60#R00SP  0$100\ P P P $ Ѝ0@A-P`p@TW [0  d@p@-xM@`Pt E0 0 0`xЍp01 10/O-1M`p0ApPpwuXP0  @4[SOa_54c@㇒) l 0R[0"? R (`pap0` 1RZ  PZ 1 ` ^0% ЍO/0G" 0# ?o\20S Vd20 d2MЍOYP k` 0  0 0  2(#ЍOЍӀT_O-p1唑|MSA僿P0   l XO X嶋%@8|ЍO R (alS  t D0! Rp 40堀尐1!` p$ZY0  [Wphp`0STP 1`@T 0c/ 4/|ЍᔁyӀT_p@-@HP`ge50S p@@!p@{ӀO-`PA$MZ0S P R 3EZ 0 1SW [i?Z!00!00000!00000!00 0000pPWJ?Zn @3         0000  00000 000 000YP'ػP04P0 ` ta$ЍfP @ p `3 `X2         000긕@  5@0goG 0J"0!!#V p Q; p0` 1RmX J2  p  RT Z [ [  l P V1    ? ᰠOP. `0 !402S S1 pX 㨑C0HL1`0S" W[0  lP 0 E?ⰠP0  1P0!F\Z Ӏ]A-`@Q` 4R{pC02! !! ! ! !! !0 0F"0Q!V31 $0110102AF]p@-@P0` $ш` 壇p@ 0T_)T_@-APP0  ׺P08P0g#᝿щ  !p' :P0|`V0S 0 00̀ 00C0ᦺVP08P0崺a7P0.9/000X B 1XHqL1# P"  03/`00S$ P yz?V` 0 `OyP0 :P0`L?iP02P0cV GT_QT_]v]Z]C-@1PC|MT!atR 40T!md2cX0d201S" H1Sx  B` RV1嬁p0P n 1 ` X 0 8/#Y* gP  0  ~|Ѝp@-@ 314020SS`@P`2Pp 03/p@;S p@茊@[T_p@-@P@`PN@  03/@p@p@-@P@`PN@  03/@ pp@-@P@`PN@  03/@pp@-@P@`PN@  03/@p耾0A-PpZ0P01P0?`0Sl 00C0|@Tb 0SP0 o Rb AV  Z ` p000G-`1SxMpA 1 0t A001Wpp00 0 0$00(00,0@ 0A0( S :.P0  hR0 R (! VxЍ%@ S `40` 㠐p0`1RU WP 1 `@T 0c/ 4/tT_A-Pp@ X0`V S R @0GXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/HzhzlzA-D`DpP@O0S z00U@`00Հ P0P<7 P0宷P000# #$ "X  q {P 01 QP 140200S   Ѝ<WP0 @0P0+00l00 W+P0@ #PG]A-P@`pQ 0嬀S @TAp@-@P Tpp@@-@90S ,0R@DP0@0P0@%H]p@- @dPVʀ0!` 0X P   !wuTU XpHzhzlzpQx0tS|0|I 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pc~ࡖ 101APU0 0 0 0 XP0 0 ᙶ0 0S@00:#003/G-@`pPԠ ,1{?R 參@P @ zO |fP`P\00S 0x,!##)" !qaZ@GT_PR0>00T_X]_U_^ߙ_@-L0!C !!R@ 3 3|P@|A-l0,q@0 PN `  0*  @X @R X A  Q ,1eP ,1! / x/ / /@-!U_////p@-@ P  5NpӀ///N/-////@-   Wo Ѝ@-  Wo ЍQ@-@ @ZAP  ,P 1U_8U_@-@9NP @ʥ@@C-@QMPЍP`pP PP M P@PP D0a0CQ R P FQ0@pDPP yMP uMP 0 nMpPt#MPMPfM0y0 cRY0 0@Ñ[M뉙! &ခ"** 0 LM@IM&"** >U_}u_^A-QMP@`0p!POP" 0 z@P$* ?@QaT ?듥W ЍQOPMP6MP1MPLp WLPL@ >@LPL k^HU_^}u_^U_dU_^^TU_A-83@M` TV 0  n30S& BOP B0 rs #eOPP  ;0"0 !& 0! "̀ @PPLPC`LP>PLP9D2,b0`L@L7:!#:  : 000@0QwP1qL嚃bLPLP LP?a⅃x僃Ѝ>@DT>Tz HL kO`Ps?LP@3XG_U_rU_}u_^~U_^&_^zd@yU_O-@0pSM800880S OP8 830:PP>@PHPP t8lFNP0ST KP//00 000 `@ hT KKP KPKPa 0(r?oT20S K 00KQگ0 0RA*S 0 0B00 0+PP 0 00 0"PP & $00PKPC 0"SY NKLJ0q`P;Y H&0 *t6 006 #:: 0( ,0 `5!86000S ~?CS <_/00%000b#a 100@KP;KPV0MPG   (00`P l", `500Y7L H~0qP8 $dMP50J@PcJJPJP JPP4?a4PD`D R 2MP hPP0)MPP00 MP 0 G0P D R~30S ~P0MPD R 0~0h000.u~p30S ЍPTUET5 fJ MPP.UJbPdR)JP$JPLJ0w0  cRW >J 106!#: : 0000P,J)J 6#::0J (0jPPa& "  J@PWJ:JP6JP x1JP41h?a$P1 LP p}PUv^ 0P0000i p0 02220l0|@0#0$@0徭1S3x0 02P22 0S P @pSeTTp0 0 ᛭0SP 2S(@LQ222@0#0 0@0Fx282徭vG@-0C៭6@ @-(0Cᔭ+282@G-pȁȡCRU 0S /+Q t!@0D0@0D7+2@ +dVʀ 0! $!0!!   !0S0S B 000FP10 0 0 '282202+20C2Hzhzlz20C22S/|@-$02020CT@-P@[0p@- @0BQS$긳RRRRRRRܳR5@ ?0S Y000 R 0 0p@ʬP08P0000r|{2R 0 0p@ͬM0 儬`'0 0Pp@W_A- 峼1aq@T. L0S娼L00 @Z R  BRl  00Z0|PU 3S wP0 P R {Q8@,廼`T  @AeӀ@ӀO-$3$#$c[3$M10100S0#0X2@T L0SO0p|P0U0"W50a 0S0z/` 0Dyv@P0I40\ 0S؃0$! 0Pz/ 22 "y40T000T00S P0  0S 0CS 0!Q500 ) Fd00500pQ0S,0 P: ^:pz_Pp0` y`0 Ux   0S LqP$ЍOdd 0@c5T504vX?Ӏ@ӀW_^_=W_W_W_]/P00p@-0ll@lP R Pp0Q# R" 0RR ppo RhRP00G- @`p PĀP㰀尐PPPUዻU@  `R0s#0"s#R Q0Vs# ohR RӀр/0$ R @- 4/PG 00S/(PGs@-80`SP 0 00{,U`㳰@P  Ѝp 㬰@P ,E3P` @30`0P40P0 R8@0`m *X_^4^ X_@-0 '=000404  R4  000@>1t A 0st@@@ 0 P 0?P8D. !  11W000PPP Ѐ 0 ( W# W W 000P`1PP0@p400 80<8`PP  8oYߍЀ԰10804 P00D0p<0,VP@B3>P H1R0!sR u oPP1 00 400@ 808`cP8` `404SR40 8✦$@TR4`Sxo` `0Yp8p @T2@P @ P#0Sp1S X@T01X0| ;@Pt  >X@070l@ *00 0@0QS P0S p0 0R  R 0$0S !0(0, 忧0P$0 , W*$0 ! >Ч$0Y 0(0 0 0S[ X Q B & 0 0C 0! 01PB(     P0SQ 0 P0S@nsP 0 0Y_Y_Z_Y_Y_-C-M0000P Uy 0  0 !0s  0PE( 000  0o@P iT@ЍCЍ/X X` p )4X001 ``\    p @`$0$@VBPP804 \@\CRQ f%PU Q@R0 0P,@@`  R XP T0@:$@P 0$ X= 0 X@' ?@A-`t1V`04S )nAPp`8@T 00S8@P 4p0p8pPPUV  0P Ҧ0p0 XP ʦXp`@4 802#T*0 R0 R P8@GvJZ_G-P0 m0 p堀堐堠 RGm sA S shmT  m@m@0p`C m@oZ_Y__e^Z_Z_O-`PM PU (` ( Sjh004Ѝ    p @$G 1( P,00 00R P 0 10P0 00`0 0@$0$ K 00 0GC-` $MPS0@@ 0Yp00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`4m00 T @ 00$R01 @00-Z_Q|J-//0 R/ 06S/`WvR@- 0 3V ЍG@-@0 00 #3  0 0 0 0 00   0 À/ʚ; 0 À/@B 0/Ip@-P@03/0@0pp@-dP@0S03/03/@p Q \ *@$0X{@-@=@-@a0,($@ @ @<08 ZDЍ[_ S\_C-Mp 0@P`` 堐P6t0 00  00P 0 02?oY20S 0S0ńЍ80< 0S 800< /i_p@-@]@0`0@0`_,PU 80< 0 Ꭹl^p@EP_Pc^@-@PP@M@-P@2p0S 444a 0S@0 Z( 0R0000 V4^0 a@+^ 0S 00"#! "#1?^P3 $103$!-0 3/0 00000@000MbX?@-g \_0p@-`Q@P0 U20`, eupL20` p@e\u_5_0H-@`,M0崨P0S@ XX$PU? ,ZU80< 0 80< `P @ ]H D?Rp pӷ1 000P1D HBp~W  a !0  t]@0 ᤨᕕ]p00 0P00000p\^p=፨K0SF 0R 0(0 0 ,P0$  R 0(00$P 0p=P3^h&v Q 0   P"^1\_9\_SX?F\_C-@,MP` 0 $0(  ,0p@0000 HPD` @]?U  t000000 T0 壔PP \ا,Ѝק00]O\_X\_tSp@-@`PPK PpPK00p@-@X0M 0@0@ @@@ b^  00@@Ѝ@蘧c\_I0SA-@p`ᒧ@Tͧ`iK Ps@P `aKH0V P@x@0T@SP P0PT TPX0\ P0 X0\ 大U `=K@@H V P@I@-@lOX0\ 0S X00\  @@儧P04ST T % |T@`K0SA-"<p8`)PU dJ0@!`R R0S rRJ Ѝ0V PP0UPS 0 |0@ 0@0 T0 0 -T KRJP V PI`S0S4SI@-@pӦ0 0S 00  @D08S   TR@Jp@-@QP Rpp@-@PUR@p0-@- p@ 0P` 0c0`00[PЍ@Ѝ/s@-P@䅦00`V ὦ`[ 0  0Ѝp@[Sl\_p@-@8PS 3 $!b<g\00p0S/p@-P@;P,0S  (0 0@0(0L\p@耦0 0R0000 000 @0S  Sp@-0P@0' 0R 0(0 0 ];P \pp/p@-@PPp0Sp&[@-@X0HSi@ nip0S/ R/h l00hID @-(֥ 0   >0@ISD0 ,P100S//彥@@A-xMⵥp`@TxЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 ӀI0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0U0 0000 0@0DWP H0L 0P0S 0003/(@ʚ;I0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0SP 08jH \0AQ00\0`0S;,Ѝ0 p@-PH 0@   S%0S@#p H@@- OP@T@-@ hP ]Ѝ \Q?/ɚ;0@-@MP W\P0 Ѝ0P@-@ P P0 L0S003: 0 Pʚ;ʚ;@-@ PQ  7]ЍO-`DM00  0hp iPP <UW 0 00 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP 9hPP 0$  0P0 ( BR %0Sk) ,0 0SHUNiP ʸPQ( ^0S (0 AQ 0S00  00S000 PQ ^0Q 0 AQ0S000  00Q00t\_ʚ;0@-@,MP m[P0S00 0EPQ 0 r\P,Ѝ0p@-@(MP` K[0P 0S000$ PQ 00 00(Ѝp I\0P @- R R S12S1`01 02\ Ѝ@-0@SM 0Q  00 \   \P Ѝ0@-R@P$M 1` laT U  ZP  @04 S#*/00$Ѝ0|\_@B@-0 ЍA-@QP  i0!.`Ap0 'R pW=) -` p`<UP0 S00 10\00 1 p 00 00\ @@S0P S0."? A 8I@BZ{c /I?B0p@-0M 00000` 0PT@PP  YZ0P@0S!Q Q  _[@0ЍppC-P `0EQ@P XP\ ` z HUp0Sp0 0@S((0,0,0p0 pSII0`0X00CS/@-@8X0S000S(0S, , " @@-@X00CS@P0@-@00S &R, l00& 00@FIA-X0@0CS8WPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@ʚ;ɚ;6ep@-P^H0L A 0S PH0L P$0NSQP8@<`0@0SP0 HP80P00SP0UZ, @T` P H@L` 1ppʚ;@-P8@X0 CR3   R* S q0 RS ^0S 0 AQ0S00  00 +S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`P3V`8  0((bS \J S HL PH LP Q H !L P R 0@ 0aS \/ S9`p1S d`$V0SF 0SC0S@0S=0AzDHLp P Q 0HLp P Q 0HL PH TLP Q H < L P  R  0 Aɚ;6eQG-PЍP(0p`V W`'DX@ p 5/PP Dp0SSt00C>SDm $\RgD#P0SRX Wp W xt 0xt00  0xt00W W @ _ 0 00⌠A3 XP@]@-0 Ѝ @A-1`PU 0FS0!RX00CS 0S 0SxxS 0mHHL@LpH@L@PPp^P@HL@P0ɚ;6eG-0MpP0X@0Ѝ0@SP`dPdPđġPAT@V 8H0L 0P0SJ X 0BQ!SCR  HdP H0L 0H P0L 0 SP0, HL 0P0%BS! e HdP H0L 0SH0 PL AQP0SH0`0 L 0P0$ P0S p@ S0 $0ɚ;6eʚ;p@-@HM` VP P1U(P0 0VPU (WHЍpp@-`V 0@S@@P!P pzp@-@ M P W Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 3!!04 ?A3c00?A3c0/Mb0@-@Q$M   P /W$Ѝ0O-QM ЍP`cPc@Pp0 0[W 01S 100[%T B@W@pU0 @ U 0  0t pxP 00匀P@@Ϡ0H0L0P #0 RQ @ U U' p AT A!HcP H L H PL  QP H LPɚ;6e@]C-`PV@p,M0S,Ѝ iUP0S K p00PV10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@T?p@-@`Pv0SpG-1C0(qi@@XP`X R00G蝝 00 CQ;Q Q 0d 010d0 0 01 C40dC?10d8 0C?Q C80d?10d0 0?#<d?10d8 0? 0000 0 00 H 8/ @R 0@A-0p @P  0 0S0 0 \00X00\0@\@A (aU0 000000TP ` 000000\00X00\0@\@O-@`pP0T! 3R V"0< 00800 80<  d 0 `j 0t ` ȜW  ЍO肜῜0p 0 ` 000 ЍH]\_@-<0 XX \   ` R`d00(@-(APT2 ,@@0-XX0\0 `0000Sm p0  kY ,`p0pt10 \ _Y L0`8i1:xP(A Ѝ (($0P[\_\_\_1S\_ 00(1 (  S !$00/00/A-@p`Ptp ` Ap@-P@i p@p@-@a0 0  P00%pp@-@PP0 0  0000 T  ,03R ppp@-@`P/` Pp@@-@(@$A@@-@0@@כ@-@@Л@@@-@ @ǛA@@-@000@軛p@-t1(Av 0XP0 0!` \ \\dPd\`dP:C$ `ȑC\ \\dȑPdȑ\`dR&C!*`\ \\dPd\`dQ#__@-p0@0PP`M:? ? 0` ["0 P 00 000000?Ѝ?" @]J<HJG-P `p@P 厈nЍpJHJH L0)-JG-@p7bP0S`PU23`0kt'0 0 \aLP`P%>8ZP0F=PP QЍb 00 0F50S0S<0K 0SH 3/PPD0e0<00<0x!L0,h&>4P 0(0S 3/,Y.0S  H͇0`0= 0U0C 0   S($0S%p-P  FP  0R )P 0S0 4S  +00J@-@P 4@-@P +Ѝs@- P`@P 0 0@ЍpCG c_@-@P @-@qP@@-000 ЍTaS@-000 ЍaS@-000 Ѝ[@-000 Ѝ[ 0Q/P /@-00 0P ЍTaS@-00 0P ЍaS@-00 0P Ѝ[@-00 0P Ѝ[0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0ᗆ<0`0<00Sʸ0Sp@ʆ<;@-@0P|0S@/|/A-`@rpȀ<0P 0S#Q003P0 000{;00C0Y<ᒆp@-@PJ00CS00H<p@耆//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0h@S qe)0`S0Z 3 #pG Shl`T  P) P0!!00A-P@l`hpT1S S@ R Th@l@A!)1GQ @p@-P @P.0P $    $  PU  U p@pSQ P  80R 0 Q P 80R 0 <p@-P0 0S S, S@@#p@P`F``V80S@@P``` 0V80S@P<88@T V p/ P0 W 0 Rp@T Vp@V + +  }0 ST  `ۍЍXT 040 0G#P@03/d_ Khr`d_d_0/0/0/0/p@-@P0Pp$ P p@-@4P 03/>  00C 0xp@# K0/p@-P@Ppp@-@P$ t 740 0pd_@-@ @-4p@-0 P@0000@0@00p@;p@-@P~`0S0S00 R00 00C0p@#4A-@`p~000V P~00CS04P U P0 3/0PP0`$0 0!0 00 /HzhzlzA-`@MP3 `0Hp @00;tp" k"07 ~ P <q=8 h1 S(0Z?00ЍT_d_e_,=_@-@Y P U= @"t@<"-e_@-<0DT 0 !0  !0@- ! 0 !@-PDMp@`) 7XFs)0 000007 3 P =7 0`DЍDe_p@-P`!0@`  )p谭SȬSO-Td"0P 101S@0T<@0 @0<) 0 @  P011 R@0 0@0<@000Q@  S  R@ 0  R S0S 0S0#9T 0S@0@0@0T @0 00000 0 0SЍT 0S 0R;`P嬰  0:p6Z:@Y q Wh`:V HPZ/ЍO:@:<e_>_e_e_e_e_^e_h^&_^e_ f_@-PÑx|0x|120C22S@@-82cM0S-$$acߍbpTUʀ 0! $!0!!   !.W@ 1200Tcߍ@-|!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`-B(xcPP @ @P@PWs@-`RP1`0@{0wЍp@Ѝp@- <_80, $01000 ЍlN=\'T^i_p@-@H`PS0S(0p[ @<>p@-@PT`_L0!RQ41`_p@ T_@lN=i_s@-d000S `@8P0d0?oT0cЍp!C13/=A-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !Hzhzlz 0 <0G-P0p@|0|`cP@  $P  Z0 0 0 ZUPG >>p@-`<0@@P@Up0p@/p@-P(0@00C0tUp0p@/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz G-0 M P   @p X@`lP X 0000 ЍG@1  @P>pNA-X`PpW0S8 Aq P@m@pNi_p@-@P0 p@>p@-@0PD@Tp>@p@-@PDPpUp@00@p00S:/>00S:/>00 R !>0 >0 >0 ~>"111/"111/ 211/ @-L0!0\Q S0>,0 0R/Q0 />@-0 o>D0 0R/@- 0R> <0Q/1S co `/ > @-@0^1 0 co ` >40@0\/@- 0\ >40@0\/@- 0\  >40@0\/@- 0\ >A-@`P$0pWҶ@P> 2 2A-P`@$p0SQ @>A-P`@$p0SQ @>A-P`@(p0SQ @>O-`pPа$M @T$Ѝ0S:?T@;Q; P 0 ?0@4'V`1  L     = T: 0I37@-@0@T t0Ѝ@\P0 1 8*b0 )PЍ@>,p@-P@P  p@-0t  B^\  @ŠP0 !@0. . ;@>,p@-8`8P0+[$@ 0*Tp>0]@/-s@-`0 0!@P0 0Ѝp@Ѝ/A-pP`r@k0P U @0p@-@`PX@P  00p@-@PN@|PB /R/rN/@-1k_N/@-1k_@-1k_@-1k_N/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`P@0 0/0 p@p@-@`V[PP 0 000 p@[0@-@0as@-@0 PЀ `o[0 <-P-'[0 000Ѝp=9Tzp@-@`P0S  [0 0S 00  >[p@/NG-`MpP@ᰐP!0 3 0000X0P3/H3 00P00 ЍN=k_Ek_T&_^k_p@-DPt` 0 Q@Z0 Q Q 00B0C0/T(0@,  ZpNNp@-@$P`Z@ @@ZpNp@-TP`Z @T@ 0 001`00 0R@@ZpNa0N@-$0P 0 0 ЍNp@-@ `P]ZSp@ZNp@-A@ <`POZ0 0RS@ ZpNNp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PZ0P$PBU 0PPZPp p@$0 p@|f~fNNNA-pMP`Y| 0R) p@T1 00S 0E0C@S@1T( T@# 00S0 SZ @@YT W 4Z#@Ѝ@P YNNNp@-@T P,0,h0Y SYpp^NNG-頁@0MS㠠P# px1 R0S! 5S-@Z@W 00@ Z~Y ` P@U`1YV @B0@0Ѝ 0`` +0  00  00P 0 0@PEUP!U @  0@S 0 UT0p`FP@Na0PGQ/p@-P0 @AlP Q PP g @ 00H0pNa0O-@S @T`臁 13/ pWXG-p0 @0 0 P  (`,m(0, 0/X(0, 0Q ;000C00Ѝ 0$ 0 0$ P@  13/P lV 0 %P`^&\A-@Px`gK@pPEPE804P"8%< 40R:AKlp@-@Px`GKH0,PU< 40R*p@zKp@-@Px`4K0Pp@pKA-`@xPp(K? 00+0`@`PPPEP0pE8APK//\00S /@-X <!t  L  R0S p@-PJ@*KpOO-PP@4M?p4ЍO/lR` pR cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ0`t(X4/X L4/<0D0804 ,4/P0,0@$4/4/0 0-4/X 0S 4/ 0S 4/ 0S 4/w0SH4/V4/W P` 0FNQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU{  4/`p0W:P4/ r 0 4/p` 4/$n_Cn_Mn_Rn_|n_n_n_o_9o_Yo_o_o_o_o_&_^o_ p_0p_Mp_bp_p_xp_o_p@-P` 0@Tp @A-PxpI`V  `V`V@ J (@P`  @P` @P`A-8p C  1@0@/Q Qq QaUB  JU # 3Q R.Zp W 0S8U: 0 S00R0S0&W8 p0 @CT20S(U* 0 @DS00R0ST `x4Yw7   P0 JZ 00,    Q  [ p B[ RU  KR  Q R|[X} U p0@  00`w0%G P0JD*0J&``  00``0@ "8`; `7 0`01@ ,G000 0i0SQ000IB 0+0  J R(0S0P103/LЍ  pQ   j[puX  R%U  /o"QQ 0P RP P E  ,0,0KG  0 00 ,0  ,0W0  0 0pGZp0  0 0J W  Tp  @D^p_^-0@-M P0$@ @ @800S @ @Ѝ0@Ѝ/N-@-T031[  1 0S 00 00 ЍЍ/-@-T031[  1 0S 00 00 ЍЍ/-@-0 000Ѝ Ѝ/s@-P@`J0 `{Ѝp@I-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@Z@-@P`00 `*TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <u!1 @P >h`Ѝ c00 U00S`C 0S. z,@T@p T @@⍕ 0R#T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG ?@1c  p U 0 e^gfffp_@-m@ @@ 0 4 00"  |@cZ ^ s@-@Q@U-?@-@PH0 @ @ @u800S @ @k;JЍ0@ Ѝ/N0Q   p_p_@-`@P 0 PK000S   A ЍpN-?@-@P@P 0  000+ Ѝ0@ Ѝ/ 0S HP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@M0 4 0 000 Ѝ@ Ѝ/V^@-P`|10S A3S ] lPT e#T212@00@00A0S<$10SA0 00S 0 0Q00o0 Z#p0 Pa 0 pp0 [0S `0` 0Q01<]P.0 `toZZNNa0p_Z^&_^p_-@-`00/s@-@P` T 0 ,@J0 `IЍp@3V^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 ` $00S Ѝ@ Ѝ3V^Z-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 `Ѝp@3V^-@-  ЍЍ/-@-00` Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppPW0T00 0 \@~0 Hy0 xH0SЍARЍ3ZV^p_-@-  ЍЍ/-@-00  Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p.$00S Ѝ@ Ѝ3V^Z-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_?f?@(p?01 010101C/A-a(P!R Ap@1!#880Ro?$1 q0$12020Ad?@-`Rq' _@\?T (0  !R@D!!!R Ѝ@?A@? P _Pp@-@V0> @ 00/A-@Pp` h00$0@p#0 qAA-P@`wp Q0S00  0S00 Wx0SAA-@PpY` 300@000#0 ;A[A-0P@`xpx00Q ` 0 ? 0S0Ѝ= =[p@-P`GT0ST X0S   0 T00CT0puP װ 0 upq_A-pP`@P PP 0p`1010p`0d00@d@0S0d@"101A- 1@0C 10P0C00S   0 01Q 1S 0S   0 0 00 00Q 1S0S   0  0000000pP0S 1S0`V10C1@ P0\A/vA@ @-00p04 R0* 40 \@ @ 0 0S00 10 1ЍO-P`@41,@TtABy4  ЍOI000P3P#00PS\0P0$Aa0Xp40 S 00CR %05萔耄[H쀄?4 10C 100C00S   0 QY&40[ ] \A-pP@`3 XVA4!X0`FS0 X@ T0@0T0@-@03$1$S(!(!(1$! 3@]/O-P2TP Ѝ000 @ 00@- X( b0A*(P Ѝ @- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-P@>2 X0P4 R0* 40 Q Ѝ0@W0U @-,^ :@!!<  12@X0 0( X 0 p@-@P2`Qp@=21S$A-@pP`10 00@$2ЍO-c,M@0pPW`$ 0)p B1 1  1400#C8."<`Yw#?NW4 `Ï2`8<000Td0a@PZ `h 1d0H0> T`X` 0寋P0PP0C1p@W U P!T0L0X0$ P0\0 \0q``a a,Qʩ1011410Q&3*`5WpF&8!U. P0`Pd PR0 㬩 0 PSD d0 $UP= =@,Ѝp\I  B(pz`1QES 0 @APc h00<  W0O< @@ Q]? P q`F pఃd0 cL1( @,0,@SI$1((0(1:1 \cq_T0Tq_]L@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0v$Ѝ \TTq_NNq_ 0?q_-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-cq_00@-M00|0|@| 0x00c00PP  TTLJ <塔80 0 Ѝ0@_X]\PTq_^q_,TX?,,00 C#' ,00/<0?00 Q0000$  B',#  /0?A-@PM` p 0.0 0 0! 0?P W 0  \ \0P  PP /Ѝ$ 0  0 PT_T^p@-P@/ P0A-@P/t0 3R 0SP` p!VU A/S0G-0P3x0@ /p `V 00 0/`03/V/0 0 0 @-@G@Qs@-0PQ0 7 0@S c/000`ЃЄd 0S /P/r @Ѝp@*hTO-0Pp,0 `0@ `F`! P S(0P@0 0 PP PUP@0?p@-P@ /000PP p@A//G-.P@p0S 00 `@1/ 6/. 0$ 0 0$  $0RPBB@-L@L03/@.`0d 0 RS`0d D@.BBA-`pP.@"^\Up `0 0 P0 @0 00AT.D0 000  0BB 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz0@S@-00 /r_@-@q`PMU:,A0 ၦ !. D0 @v @.D9 ~g yg  tg og0  00G0 0t0@00d0 0T00000<0Ѝ蜂Br_$r_T5r_+r_^=r_Cr_dT\00S/QA-H@H@`PQ-p"R0:A.[  w 0 03/@PF0X0>B  @< W10 PP@ @ЍZ P@P  @P  OWP@ @Y X` `  @P Y  7`W U( UP U U UUUUUUUU U U U,UUU U U 0,Q *Q : @  0  d@001 001 000    6   =@#000 S '0< 00C 2 0 0 00 3/@P 0  "  00 0 0 3/@P 00 3/q @ @00 0 0t 3/@P 0 0 0 0< 0 3/ ,10 0 0 0 03/ 0@0 0 0 03/@= (0pS10 0ᴑP@0+@# 0 03/0 0 0 0 00 @@?~f}f3{f@|f@-@bP p p@-@PU0P @ 003/@%p@-@M P pЍp@-`@60P @ 040S-@  3/@p@-$M!@P @, 00`V-@% 0 10 !0S! S S@ 11 000 00p q> 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  pP0000Ѝ7@-@P oP P Ѝ0A-"0`p SB@ pP P`0 @  G-@`p W T0#03V0SuP (0S0P Fp(0SV @ 1!H  @@7 PU @WP-dM"h0 (00@#0 00 ,8dЍUA-0P`p@0 TЍ@- #W0@-PG-P1p SB@>(21X`1U @ T 1P Ѝ@-050 ЍO-`0x#MPܰ" 0$0P @Ѝ(0SP (0S00SS @@S V X_ @T    Ap0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  &@P 0 00000 00 -P@|  @u0  @P @k0  @P5P ( [1 01  010n 0PPQ`a0 @ @W TTUEp@-0PS@`M   P0 Ѝp0000 O-14M`P@X0`0CS*qP  (0SX\00X0 00 ` sX 4Ѝ$#  0\#[ #0 O#^O-0p IR@4M, [P  @P!@T  @P @  @0` @P "@ 4Ѝ?@-@"p0t 0 0x0 @#p@-d0@P &r"0@3@#p"&r"0@3@#"p@-d0@P h0l (00@@, p"h0l (0, 0@@"p@-l0@QP 1CQ 1CQ p~"h0l 00010"p00f@p@-d0@P0S S p80`h0pP^""p0@`^^p@-@d0PL"@p@"p@-@d0P@"p@z"p@-P@PT R@(" pp@-@P` s"&'00F= 00'`P000@0QT >"pp@-P@!A` h0l 0H0E`P &r0`1:0@9"pG-0SP'@  pDPP srF !h0l Y^:0 h0l t$A'!ЍX#x0S `!P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ `x!phl 0 y0S 0Q h0lt l$@!  ̨PX!x0S P!Ѝp0t 0 p0t tp0t P0Sp0x0 t S PP #PG-50S`5 P `P-00p 0 0(00 0@  !-x *X@V00y0hl`,t%+  @(0300Ѝ^r_r_0 0R0,00 0 0/Ὀs@-P`00@t  PЍpp@-P@H` U88ǨP@P PP@ @ pCCCs@-@`00P EPЍpQ@-@ X@ @-@!P@oЍ0P :0Q:///0/P$ Qp@-$PP $@*i p@f d 0/P$ Qp@-$Pp@ P $@*  C-@`00PUH@B P ( ЍCz ؍0S 0S00l T5 0`' 840S$p`  (PU  *Q P-I   #^@ ЍCꙍ EP ЍCCCA-P0`!Qp# `!0   PP   PP0S ,Ѝ@@P! P0 0$pP 0804P(Px,00SddT0`0 pP4`0S GPr_CCCG-SPM@gM PP#@D V x0St@P:0  00 0 , R0 0300`  f@P (H,kH4@L@$ FP  #@P ,X(2PЍ(1,0( 4<08@ 80,0g e(@P!$H0Sx 40Su UVw PP0  RS< QQ: 2  d+& &bR0@p 0S4#,S  @P @PP `10࣋#h0S00 0 Z@Pa Y 15U`4U4U5U 5U $0@@PR$ 0RUp 00 0p[7 *k"*A 0 BQ<5UH5Ut5U5U5U 0  ! 0C?o2S 0S0S000  p S00S00S  pP BpN@Ar_0@- 0@SP$M  P 0 P     $Ѝ0 0 R  //p@-`Q0Q@0 5 Pnp00hp 0@-@ 0P  P ЍC-@$MP P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V dPPP^X V  r_@B5s_@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P R tT00#T0S@D0PE0S 0 @VP0P4ЍPG@-P@` P 0 Ѝp0 ` O-R@|M PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@` @P V  8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @V̾ (( R LP0UP ᵾ ᙧ@PG0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h3 LP 0PED00S 0 @UX0P4ЍӀPG@-P@`P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@ `  @P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 K! (0X0B 0 R  @T᯽ (( R LP0TP ᘽ |@PGӀ0@-0 0I ЍO-1M@`0.P 0 @Pf#΅"^0@@^A-QPp Q! Q`+2p`@2` R`   Q`024@20+C-Pp`2  Ѝ S @ R0P0@A\0 00$\(0  #i 0R P A-`Pp S@"@Q  0" R0Q@D0 00[ 0@  "iЍG-`VP:Pp S @ -V  0 APP$!i2 02?PP 0 ( h @  &a  00ЍW ^$^G-` R P0S0R@9@ 0+@P)V  U @$P0p @PᐗP`@ P0 YZ@ gpW ԹѹO-0TM00SOUPUSU$TU8PU 0@P#@TЍ0 0@P0 0p@P003 @@3 1P00`@r$PSpW$0X3X$p^sᅹၹPYZ43Yd4P0U0,0) U 1 #$, K,0@PU00P00S W 1 !, 9,0@ U00P00S V 1, )@C@Tpp 04p|0$00P מ``p0p$pP ̞``  Yo R<  <  FPo P T R , (q( $ , 0 0@P00 0$0000u  ,o R<  <  F#o P T R , (D( $ , 0 0@P00 0$00NlP@he P 0 03/@(NT@O@N@`rlrĀs_ B @-00S/A-@P`p 00P0000 0n?@r?v_` A-@PpA` $0SH0( `@ $ 0R`0P p@-P80@T ,PepAD0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@a10< 0D0<0p,`(P$@ @@ @P`D0SU '`Q`1 P0D 0<,p(`$@@ @`0 010D 0<,p(`$@@ @`0 000D 0<,p(`$@@ @` 0 000D 0<,p(`$@@ @`d0P00<,p(`$@ P@ @D `LЍ s_s_s_s_s_s_t_ Q 0 NDDp@-@PBoPPUP 㓷(Pp@zㅷ R00 A-d0@3`q00CS0 <DPRU A-@p V0` NPP MЍh@PP0 PP 0`PP  P1S!!1! pW020KI ( P vtWm@Dp@-@PM TP0WPP+@@@`\V& WP0@0@ @@@0  tP|0 @T@lW PPPL0Ѝp80@04d^Dt_0?DD@TUC&_{p@-@P`l0P ( R ? pU  @@p@-pPPM @P Ѝ _@P0S00C>S@0`S 0S@ xe100@-@M P P P DЍ0@-PM "@P p@P0`S  .0000Q  @ЍO-@$M 0Hp(0`  PP  PP<@ڧ3 P@P   (  , ^ !$ R W  RR R0R Pz@ @80j/ 0S(A P? 0W`0" ⮞1 00 0 100*-嬡@`pP= @  P $D1 00? 0@0 4<00000 P  Py0 00 pNL0 T# $Ѝ0S@P^vod`rτn0X@Sk/1!p@@PFV0ꨂ^t_'t_o D@D0p@-P @`M P  PAЍp/O-M p8`bPP @nkd 0 S/ z(PЍ"V   0PP f `0 20q0P"  P#PPP |ЍӀp@-@aP[1S @T 0S 0QU00001501 0S pDyPPO-03pP*@`ᄠTH P 0 S E U@ 0SPP02P0 ^C-p`$MRP0P P0CP0 4P0%@ RP0 0  0@P $Ѝx0x E0 ` Ep@ #P U<@ @U  *^3t_@-`PV  Z@P  ` 0S  @QЍp i@P 0 W\C-T;M0 0H S@#* paVP[P !@P U QЍ6@A-p@Wq?0P 7@P ?T0003aP @P  &@!)$q$Q:x W@@-0P@3UQa% PP^ Ѝp$Q  1gO  0R # @-0S@$P ЍG-pW@ PP F0`0Sj d\@P0S jo@/p@-@1P 0c⎙ i⊙$ Q$180pep@-`R" 0P1S 0@S  OP pP0   00py p////// B 0@Ps //Q 0S P 40 P0@1S///{A-@Z t03@`P |0S 0 R0`hE d0P0U TpH} 0AD0Q00C0 R0 Q<Ӏр{G-0@`p @M(0 0 <0a0,$@ @@ @P<@X<0S% 0 00< 00a000'>,0(0$@ @XX00P000a0,0($@ @ @< X@Ѝ:t_{xU?t_wU3_C-M@pV 㲯0 P `㬀嬐0 V: JT` V 1{@`唯VЍ0`1S 0 + eIt_<{Nt_C-M 0@p` PW$a0 P 00 000 0P9T?o2P0S@.0S@*MVPU@$ J@h pU*0!R0X H@P 2@$  +@VЍ{<@-808@ P 3  @44?{TuUC&_0@-M 000 00 0p)@P@,P 0R ` 0 S |M  @ R \@0`80;  @@P Ѝ{<@-0 000 0 000@PЍ@{Ѝ0C-Mp0 000p0 0ϼPTa V  0RD@P0P d X @ЍwP w3pU W @0U @ PU0pPpU# Q  H@0S jP ϬP ud T @n Q0S 2OJ2 Q<рӀ@0G-M 00 00 0pPP @ЍA  `P pz @y`1`3P@刐/ 0S S 0h f @u `u`a t` PR P @L@@' |PUC Z ? |= Q  @V 1S 0ሐ01Q!  <Ӏ0"!S/ 00/P /A-L0C@1S`H1P @ATA pUw`@O-TMxT$ ,0Y〰CR|0S |@1 00 00H1|4R00L1L1,0P10(00Y@1<10 @4 0/00/000810000w0#S' Pp0ԣ`$0Sd岀FP0P #FDV 003/ Rp` @ pPTP,0 0`,33 0啁000008000#p h /oX b 0$0Q5W 20S000 0H1 000W 0` 00$  0R   8 RUP6 881SQ00BRUbPEQᆢBDU"XOW[YgP @Pa X g ỿ0Pe Z  00XWYPELD  ࡿ0P P 0  0P P  0P P   |0PT P   n0PrT P   `0PdT P  W < L0PY 7  C0P0 01 0 100/oX" R0  D0/oW" R  90/oY" R_  ᕰ -0X   D^p@-P@U`0M  PPP  P P 000Ѝp@-@PP4M  ޾P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP ᨾ@P81 00HA@P ᰿@ U ȪEߍ^@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  ePP P  \P0(ЍpE/08!PR/p@-SP@Ha:tP@10D1@A `0p 0 pkmO-0@SP 0S 0`yQ X280SP81X0S =`0@ 0 B0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!%&00-   0 >VU@ ЍXU  0 L0Z#  P21p ppp pp \ 0R 081<10<1    (PB(    ЍO! P `~HDL^A-`唀p?`@T|@0C0੩P@PEPdH= 0 F0 f021@& 0@@AHD0?@-@( ~@rp@-@q0Sp 0P R @1S@  0S00p@@-0M?SV1``0@SP T;8|>pP @ S @Ѝ$p巴W00SZ@@D@ @Y @@0p 00\@P@T 5@Tt T T0 d0 Ѝ@*60@Ӏp@-@xMP` x x}` ɼP0 xЍpp@-P@xM`x b}001`0 0T0$ txЍp@-n@PqeM  I} 3. 嬽eߍ0p@-MaP. 刼@P 0@  4@T@ލpO-p0A$M>SHL0&0R00`A 0 0S9 S7 ZZ 1SL0  3 [( L0  3Z P[0S30S x3 [0t0[0SZ Z[1S zW4P0S 31@0r | " ) 0     X P   P L  `Q((L Q`Q''L pHp Hᢲ"!    Q QpR RGE 00000 0 0 00 k2XP1 01 1007[0b ZZ[Y 10SuTW4P  <|2 020奐0V000aP0S 1$ЍP101 1R 0  02P P0 4P07 PZ[{bt_@Ӏ]Ԁ0@-P@PЍp Bp@-P@ B B  popP h0T @DT p0PpO-M0 sP 0Sb0@S_P@ t `P\+PЍ<#L0 P13a|@TP 0S 1 S2xhy?o20S P[yp h0Zpp Sp ppZpG 0 p`寲PP hAPӀ@- @ 5P0ЍC-`0PCMJp@PP Ӱ0 0001 00|PP 1ЍQphb10IS　HWV@-@ 0 P   PQ  Ѝ0G-M P 0`P'q1W`$ 偢P 00S,@0)0S(  @P|X`lUP P Ѝ@p@>L0 9`A0@ 000 0`P|P $Z 1 S 0S QUY P ١X ҡᤀᤀ<ӀA-0MS90PS5 h@P `P@p @@@1 00㥱P 1@១ЍvQ ʡ1 妡@괡@p@-P@`]u 0SP S00C00 xP|PU x0sP 0C0PXp?U p0PS ʀ000h0S x0UP@-A0O-@`P |+1Q>C/1C  Pp@X1QE 1CQ [?0Q Pp@Ŀu0S1::8C81kPpf0 S10011000000S0S: R :SP0C BS000;8MP5 s@s@~f s@-@*X0 0 0h0@#Xp@-d0dP@ 0\@,0(@@T@pX\@,`(@@T@Xp@-0PQpl0@Q `0QW\0S0010W R0*W0\0pp~fTf@p@-PU @d0`(0p`h0WpWpp^p@-@d0PWpp@Wp@-P@PW['[h⛲pVpA-@Pp uW\00tp00@`0W00F= 00'`PP囬垬 @-0 @0 hIp$@A\  \ R/ C-0SP)@ `hW耟 hp\ 0R$S$Y#P0S0 0 0 A0 P0S00 S PPEW ЍP S ,`0(@$ <08 @DЍ{u_UU;_u_u_S_u_u_P_Uu_@- B 1011 S!1 0 !q 0@$v.{p@-@PX0U00 00@1B  pP{@-@$0  (@藩p@-@P LQ 8Q  _? = 0>;0p0<0g|Q ho$p@p@-@P u 5Vc/0000`0001S 0V (A0p[{_Ӏ{A-P`0p0| @@ @@1B  lAT 4/0 #P@SP {p@-@0P#PP@ m :pX?{@- @$^+{G-Da@ Q8# 0 4 0 T 4 T ( ,8q X( ,:T% U' . 8 < 8 $ < $  @ !    0P @14 0 LS0000 ?X#!D1  L0S81  UP hP000@1 t1S 3/P0000  P   +) 9R0\0[S < SEK1 C/oS" R 0Sw rX <0SP@4ePR? V1 C/oS" R   ^KH090KW1 S S R D15 q0L s `D15D1G!S3  U@n P; P1 C/oS" RQ1 S S R VBP1 S S  b0 :  8T!U1R3R1 C/oS" R Vv  & U1 C/oS" R 0<0咀T1PSPSPUT1 C/oS" R D15D10<0 U  P,M1 S S R# _ 0 R P /  *Q 000S0>;9 H L1 C/oS" RP N1CoSQ/ q P P ph p0a P P lyp0Q P P V  "@ Z1 S S R :L 00 S   | 1R0&,`( dP"YE U_ H1S I1S J1S+ ) U' 0 08L*0  :/0H1PC_oSRPU  P PEUP#U PE0 S = {,^p@-@AK `P @p{@-D1 M2D10@9000 00B P090 Ѝ@-D1@ D1L 0X1SY1SG-@LTAP` p VW 0 Q(P6@QBYP1PVW) ``&@1B  U!!|0R W PP Q xV s| 1RWP 0@1B  $KPW 0{p@-@pP ?P,00(@@p0?P(,00@@${O-0DM S @0 P`#48@3 @(00D 91 Q/[ , S) \4P[01 0S,pDЍ "3KpW`<0}Yq00WX03QHp=0K Pp # d/ bQ8!  TP h P  @! t!R 2/P   "Q8 SQY0sB@0T 0R2 @A0.@!B +@) Drp Q XB("008  R(00C?2cO 0@CdB$@GSYL0S800ڄ0)T0S 0  |@#pR 0]pT6X!R#W W#W[ BfSQQP 0 S W] 0pPX?0H SQ00Q00SH uptW>Q; 0S  R5 HQ IQ JQ  R(`!`{ӀX?gfffQMbO-M|>@QP`q P\>Q 4P>0S%D>Q 8>U9 ,>U1, N={.23i p3!1P =U Y-23=QЍOG=0S=Q%>C0CQ X=Udl=U0 cGL=Q Kk0CQ=0CQ(=0S =U& =U2<U<0 S| ZP 0 :/`zh| EP 0  9/KTX<Q P<U 000<Qw $<Qs <U4 <UQ Y_ P]  z T;0SV[ ] SZ 1 0SV [0S PN \   D 8;ZP5 Ѝo ;Uq0CU::U< LQ0CU' ? 0CU %40cSr\:*0#Vl:Ut 0CUPuG p x1 0Rd[0a 8PP? SU,U,U,UU,UU,U,UU:0SUU,UU,U,U,UlU9U908p K0;9U 0CU 0U %40cS KS V0CSt9U l90SX9UG 0CU1 @9 I0CU00 C0U %40cScU 8U  0U0{0p8UEPP[ 0Sq l00 3/ 03/P\  8/ =@8U 7UL@ 0#P  ! R[   Q!0(03/G7UD >0UR >C0CU, %40cS vS<70Sl70S PP7U p0p p1S 3/P HX0S00004| s|00n0| 0Ch0;PUPP_8v8X0 0R01 ST 0H0HS^PP' 0D 80< 0P喜@dP ^s!$Ÿ$B^Z @Y 00\aT 0<Y s0S ! S Lf[0 0S00c01 0R[0 0S00L1 0S[  $0@19@1e|00@1$0\1(0S`1 x3U D1"    2D1 0R810<1D1  0;; 0D!"0D1 sxi0 8P # D12D1o Pk\0D!  %<D!0 w0<0jzDmk10S 0RS P100100@[00[0NP xP3PB0S ! S,[0) UUXrePP 1 0R%PPQ\v0 Q [Pb 0S ЍO7&ЍO & Retrtht@|ft,@{0^t tBt @utt€u_Ȁu_tCt gtӀX?f@t nt ot st@jt@wt@HtH~ft,_{6_p@-P@U0  @  @1B  !0p00P{H/H!/81 , p@-U1@ S S R 0\ <0 uP 03/pT1 S S R 0<0l1S (ql13/#/#p{/p@-P,0@TpuP @؂/@-@PND0@PP  80P  R 00 0|{܂p@-PP4L0@T 0S 408 CTT 00 0dp@{؂@-@P($08 TT 00C 0@N{܂A-@sP/pPP` <uPa00|0p @R 0)PQ 00400S  R  0?{^؂@-$PP 巨܂u_ v_@-@XT08 CTT 0S 00S   {/܂ 8080 1l1S 0 0//L 8080 1l1S 040//L 0 601/Lp@-PX X0X` 601@0003/]000lQpL{A-pt`PJ@@@ @L0 @  ARSD1 WHt@@@S@P0/@(0, P00C{0 /@-P0 @"6 0<  $0000P0@Lp@-0 PQ"6 0 A X0 0 X0p 0` X0 0$^0p$Vp@LO-0lMS 2P"0 & q`될@@, 0 XY 0X0 o@P@  ,Q,#N plЍ YY 0PY0 lЍO}o| R  @ X>  @P   eo@T0@@ @phdRd #e@P o@gT 0@ ?o 2R0S@@#@@L{O-@`2P"0|M & tr< 000 07 @  c L Rh00+  0Su 0X#00l ,TdRd #AQ@!@1U oPi @``Q` @P R LP8p UX<`D!L"$ L\ "P R ( ( 2/@T R R TdR`1d`# 2oP@h @0``D  ޜYn 000 |ЍL{G-`!1  60QpA@0 @ |Q   XP YQ Y.S  Y SQ@@@@ @S @ Q YQ 0@L  Q S 0 T @\QD  @L{p@-@p p0 601 R R p@ Ph p04 Qp 0PL^{^p@-@ Pp`0rp@;{p@-@ Pp`ep@.{A-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @i@W{@-p0Q0A T 0SlAOoB@ 8T 0SlAOoB@ L|A-q`0S3@Thhy0VT@ PQX0v0TS@K R P!(s0@@ 701S`/@0PlE01S TX`0AnLKv_m_|A-@0` F@PP x0x0q@l1S XSPH0@`l1̀J0003/D1;D1PUL{VQp@-4Pp@$0S@@,pL|@-@ $T@ ỉ0|L,sr/p@-Pl0@"6 0\ \ a $7ț 0$/0p@L{A-\A0` F@pPP840101@0@$l 1810<10D1K<@1=`1\1l1S000( 0 03/P @ 0得P \PЍ00   0PP0C0 {L+p@-PP0 601P003/@@epLO-졟p3`!1 ر 60P@ @` %1 Q[  S%L0S> xq8L0SI@T @Jk@T L0S8L` :VIP1 0S [ &@ @P < t#@ X2@P T @l1S 0 03/@LX?{G-`$$ 4 6 0Q 4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;oP `3R X3Vl 9>C1CV %83Vm 0 $p 07/pp{ 0 ppr0o 2 Rk0S Y`w2V, 1\0CVEh||t2V" 0CV 0LR 0 000(k$2V0CV 20S0S00 0R 0 py00u 0R 0 0P0E>SpD1Sh0 000|00D1  0 1V '1V 0CV X0@0X000S80 @  UQTQR+ X @0 X 0!p0V T00SRX @0  X L`tVft_t u wt@{pt tttut 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`@P;U VB2P0P0 0`p@-@P !P 0SB000p@-@0SP  \P 00BS0Q3\000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP o0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 PSpS 0S}  P0000`P  BR1 " 0010 0000S000pav_O-`QM@p0 SB S0S5 000 0R4P 0PPC PE0UP n R A00N \ᡡ:50C010 `F000p0S000Vl  P \ Ѝ@ ࡡ0030c00 [ yv_0PPQ/@P @- Q^00@S0\3 | X0P/@-0^  0CS0\3  |p@-@ RP 0 BS 0 \0C0P 0CS0Q3\R  pp@-@PDpp4031[  10 P /@-[  \@@ ᾕ@- @ [0  P p Q  Q\>1P!  S[ @ [ @r@|@@at Ӏp@-`d0@31[  10 PU 8H0 @%p@p@-`d0@31[  10 PU 8)0 ۔@p@p@-0@1[  10 PU 0  1@p@O-@DM p`\0@ <00  <0,(p$@ @@ @`Pl-*0 L 0  `<4,(p$@ @@ @Z-DЍ|^v_7@-@00P000U  Ѝ0@& Ѝ0@-@H$0S 4 0 S   0  |G-Pp堠堐 M@T |`  i  e: 0SkP$u Ѝ@|Xv_hr0S/ X0$VA-tp@hwP`V U0PD 0 p@kP`X| h000@-@AM,P WXLA iQ i, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01v"PLaPU 0S 3/P 㤃 㡃0$L1wM/@-PAM@zU 0SAߍ@, _`P  Aߍ ``0pP` q0PS 0S f &i0 L1S0Sp0LQ:03/PU`P E B$MO-MRQB 0$P|ߍO+Q0S 0 S0  pL\000 0*W`P* pߍ,3@00T 00PS+ (0S(pW% 0 S!0 00S0 000$0p 0EP [030#Z0Ss 00S6@00000S 0 0`0&23 -0P0W0 H 0L000P0@0T00XH 0P40@pD01 X00& 'QI x k0S QD   xk ) @X ? 0"0 2" 2" 2" -0^pbXPU000 W A0 K =00Js 0( 0(P,.0( @(p,.0x0H0y001H010( ( ,o.0( (00,g.0( *(00,_.0( (00,W.p$t0S02)΀΀p@-D@(P+B(B0 8Bp@0 2B|D/V.Vp@-` P00P0T0@Tp@D0D,BP0SX@$0S 3/,P|dX?@|p@-h T00T0\0@Tp@L0L 0?0c BP0SX@ 0S 3/,P|dX?gfff0p@-X00@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c0p0S 3/,Pd|O-LMD@p`\" 0  t 0p,@(`$  @PX*H" 0  0 4p0@,@(`$  @PF*" 0   4p0,@(`$  @P4*0! 00 0 4p,@(`$  @P!* 0!hh1 0  0<8p40@,@(`$  * 0!1 0  08p40,@(`$  ) 0!00 0  0 8p4,@(`$  )D0 S @tPt`tpU:T /LЍOP 0"S %@LЍ^}^v_v_)V,^__}$P00 !XP/ P/ R/X|d@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P0ӗ/^Qp@-@!@3P/PP@p0S @-_ 0i^v_p@-P@eP`  H0S p@/p@G-`0P @NP D0S G/PpU 1 !QoPGPp@U 1 !T Y B BR !  ,/0@ S /@-$0 @唵PЍ&\G-MⰠ P`p ` @h0P00SS-ЍS000 000000@#?o2P0SQ $0S S S h 0QQP<0H o80(0f$00,?}^(?$?C-釟M|@P` pMSp0p $  ᥆0` g2 020202HX00#ߍ}9Vp@-1@SHP™L0S0L0 iHHLpP UpH@0100p@ DWHUH  L00L0H0P @0` 2T^ p@X0\ /o!w_} 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-$M`0@TPp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P 0S 3/ &10@d} 0O-DM!3Pp'`0< C (PP00p 0,`$  &3 0P(P?0l380  04p,`$  &03 (P?03<0  04p0,`$  &0 000'Ȳ!2 (P 0  04p,`$ y&0 000x!t2 (P 0  04p,`$ c& 0'!$$2 (P 0 0 4p0,`$ L&0 000!1 01 0<(P04p 0,`$ 5&0 000!|1 0< (P04p 0,`$  &<1 041 08 0 1 0@ 0<  咑 厑0P &R+3'! P<0 傑 PH0$y<0DЍOs_}]7w_]=w_9V,?Fw_(?Rw_$?Zw_P;V{_cw_9Vuw_zw_=V,/^A-@`(pP$I!$WA`}P 0 0S/p@-X0PP L@@P 0 H@Q000 0p}@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` PP0L00H@40 400;\00T0X0}G-0MZ勗0 S 0pWЍ@L\ T 0E0 0 tP@T 0H0 0E0 0 D pa` `FV`!  ,epG@0w_w_w_P/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PAp@-@P 048900H00000p0H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ/\/0 ASQ/p@-@TPoPpP@p$00$/$0 S$ /0S /@-@pp@-$PUp@Qp@@-@0 ( 00@Op@-@s0 0P0 p!R \100 !w_} RA-@P;bS`:pe@P PU0P SA-@P;bS`:pa@P PUn0(PPp@-P IP@ X0@p p@-@PPlTp00 00FS0c 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 hc0@DJ0000CS0000`VTT`p}O-pPUK `V#:S`F#V@`B @P< 0< 0 !000 000HLlH0H0`0000%PH0 }@P 2V2(0 0C(000(( 0 > P(@- b0O-rMP`@0 ``(`0 0`S`F 80000U V0  ( R(PE0Sv80 0pfW &R Y < Q<&0G 3SL <P 0F 3SH0L RP \0 = >R 3SH L0S P0\ 0  0CS fW< < 0CSSp10U 1 !M0 P H00 < 0CSH L0S,00 BW 1U  1M@rPp@ppWt 0q 3SH0L0SjU 0< pP7Ѝ<ppP U(0% =0S0%8000T   #RH L R!Y B/o" RY0@ 0C0pfV00 `g000 ; Y 1S  0 t 00IAQ00@0Wp!S  a000P`V PU @P@-P   Ѝ@-0000 ЍP/@-PPQp@-pp弓`P@Pp0 0` U P]^x_@-@P@Ѝ@-  sP  Ѝ0bSG-@9p`PP2 0 i0 0  I,b0W`!V`! V `!0 1a0pGI0000CS0000@TWW@yP}O-PR``Ap0PPPM 0j@P 2 (`200V [ ?@P Q Ѝ00pJWp!fW\  W 1+#  ` @PZP`F R[ 000R000 p}A-0@S" `;(0 S8ʸS C< 0CPHPo_P (00 A2(0000PP 0 06@ y`.pP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP 5`pA-@pP$`V@PW0$000@$@p`p@-P@ 048900H000$0p@O-M@0r000?` 0l hQPp000D vVQ@%U 0SPpGW0pUv    0  P@ 0ЍS* v(`  B'(00C(0  B 0E 0S000 0 00HLzhH0H00v p`F0Sp0P v B R ! 0 3SH L0SP0\ 00<0Cv S0!0  BR ! Y_x_g^%x_;x_@-L Ѝ@-F ЍO-Pi RP@  Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP_pJ^  \ RU [ #RHL RP \  $ #RH L0S0P 0 , B!R \  0 I0000H  0CS  B00Q 0    ^  B PPZ0 1AP? ` q^00C0 00 000<00qw^^G-0P p@P: 3  0 0  000HL%gH0H0`夀V0^xPP P  0  0 00HLgH0H0`^r@^\x_/-/-/-//-/-/-/@-@ZX-@-A-PUp1p!0@W`DS W c c+dPW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  HXP  g]W`P  ^]`G-4pPPP8 `@P 00 00 `Ph@ЍG-$P0 Sp`M 3Q0S Ѝ@50TY @ 00040"0P 0  0SC20@T D@DT ]D2W? @02W+ WS M0PyG1W0To 0Tl r m  *H00@^0p @TN100C?o270 T:0 n9xT\@P# '0 Z$ 0 0S0"7  # 3@ 0S L IDiiip@-@PPPU@` ]\`Pp Bp@- P`8@~<0P p~@0PppPp@- p0Pd00S P0pDP<@劀80 @piV0^EFp@-P`0` 0@ 0AT 0S`B0S}@ 00 0pFEA-@Pp. ~G, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0p"`P@@CA-P@p0`,P7VU  AbVG-41p!,10RC*Q`= fX PP<*P00 /R0S /,0(p0$@@ @0\00 P0< 0,(p$@@ @@zPP DЍEFiVC&_}x_x___^p@-@P8p0 ʉ@P pp0s@-`PP @=TPЍpPP` h0\S   @00C@0 0S"40040@FEA-p MaP 3/@P@P 0 (00 0<1R 0R@ Ѝ0 @P  B  P0Q" #Ȁ!0 p@BP 0 @0@ 0QPQT 00 803/@P  P^DRSPFFE@-00 0 Ѝp@ @O-pP0$M 0*@P@P $Ѝ0 (00 01R 0 Ӌ@ L P03/@Pe `Q` ^VZ:1 UPH000 PP H    >P  噋@PP 0 0 0  `o #P *|0!0R: P@1P `0S1@01@00 P^EF@- 0000 00[Ѝp@A-M` pgP&# Ѝ(0 ( W  R  0@P  V #@(0 ⵀ(0@P0C(0P$P @@$0 0@-@MP P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0@-@ 0;@x>O-ܐܠ`̰PUV {z0 00HP0\@P `N@@ p @@DV\0G $`0 ,09~U &\}O-LMP0D0p0D 00RZ(Y`t    ""20x0x \20\2p0S@t0p@3080X00t00408" P x4S @t  $B .DpLЍ00 ?o2Y0S 9@00SL 40 S R08TC0PI@ZD Nt00001`7 DR   Y;4 10R0 D0p 3/0@S000Y1;ò10PD0Y[pYY T0P t0   j PayP00 R0S D0(0D0S 0c 0`(0 0003 R80 R00S3Q. `# ,  , R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6<00 $@ 0S@@ [fYu0o Ti h2 0{b W p00 KK@C0`H01`}90 @v$06@0<0S,0$ 0H`\p:XP#:0 P000L !4040T 00 0C0000 00C00 R0000C0 0SK (0p`D(00(0p'TY(`t0000 Y p{ [ p p0WpS@@T 0[00Sx  @@0 p04/'@(@#@ @p0ꐄ&\L|VI0O-@`'~X<䭾ssr0p@ cv R4400440(0$800<0$08/0 $Q(\A/8< Q$<  < 8 $ /0\A/0BS@-@`p P`X0$0X00sX0 P0 PX0  ,0 0 Ѝ@/ Ѝ ^1M/ ! ! ! !  /7 $0M/ Xp@-1 P@ 00U1! $ (0R0  qp@MsL!: ,L!!00 !0p@A /:sp@@-@10800-s@@-@10>0 s@! !@-@ss@s P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,04d0 0!!T0    !/Hzhzlz@-0 @Q# ЍhQ:!<P, i` @%P 00@H 0TD@D0<0RH0G-RpP`0<  ( 07`{ 0R<8 P0D @R, @ BPS@P P )PP 0L00H@40B300\00T0X00 W 00 IX0ST0S@L@T@Px_G-@R`1 0)!{XPP2  HT@(0 0(0PQpXT0S@L@Tp0pWP0@ppQPt@T7 y_@-@R0hz 0S00S0ST0S@L@T@Py_A-`@PpTXUd 0000 0R'X 0S UQ 1QT0S0T0&@1Q U? 0 @P@S0P00@pU. 0#! RQ  3SHL0SP0\00<0CR1Q00H 00080 080L@Ahx+y_@-@P L0T0p@-@Qp T0PS@0L@T@0Q 0 00000 p@hQ/T RT 0 0SXp@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@.p@-PL@Q``UQV 80y`0S0C0000800C80Q 0S L`L0SP0  RpT0pPEHBL`Cy_@-@@0S87@-@P1 < @#0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0蘄p@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `F@P 00000111010044P0P041418181@1@1D1D1H1H100 P A00111100!1.01 0.000003/P 9V 101p@-L@Q0L00P0T0uPL0SO-(ppP U [  v@`(@P U U ᇯPP  H@L BÌ\PTX0:( 000P 2 G1 ^Yy_@-P `@P   _FЍp7@-P@000T Ѝ0ʹ00@ᅹ0s@-X,`0 ( P@\  n0@00U Ѝpn@-P0P@-׹P/ R/@- @@@L@-X0@P0X0 ЍQ#P,p@` Wn000S X0 Zn0P00V U X0, 0X0 os@-P`Q fn0@00V pЍpFn 00S/PG:7@-@00P000U  Ѝ0@R Ѝ00BSp@-P@`pPP  $0S0$S0ĕ`psy_p@- 0PS`(M  kp@P- (Ѝp0  w@P0V" 0;;0@P R 0  R ! \q@P  Vq@ 0 S@ R  0p@P gvp@-M0000`P @P x00Ѝp@-Pp`@w@P @v Ѝ0@-AMP@ fP Aߍ0s@-P`w@P  @vЍpO-`M؃pP vP (0S v&@Ѝ x@P v 00PX .00 x 0 !4* S  #@m,x@Pf!401  504DT04W0S f0 Plv0I(0=0@0  04 0 1 ::8C81@PgPTP ⴷ0000uu3 mwvX |).  Ry /[y3 Bw-@u40 3Lw@@ @[8_^@-Pp`Tv@P5v1%@* 0`P!300$@F @1P pP% 0110 $R 0V SD1d Bu Ѝ0 `S1 @01@ !t@ 0@-AMP@ ;P Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 z@P*$0r,0 WP@ @T (o@P , v( v0Ѝ, v ( vG-Pp|UUpW @0 S0S``F``T@&P4uP t@O-`RZPP Ѝpİ@0 T    R R @ 0;oP0p pUXp 0pGp@@JZpP |y_O-tM  ᜀJ 0X  aW RD R(@OZp R<@P  A0$ (\?<" REP 0 0 0$ 008A 4/ 0@0BPS 0^ pP  7U ! RdY@0p m@P 00W YtЍ0p  FJ VP Y PB#P U RYP00XP PU@ hQ @U H R   @YT @@y_PGA-PM`plt@P 400000 0(@sЍ7@-PUt@P w.@os Ѝ0p@-`PV M  V00 R0S@"  t@P0"V 0@0  #  l@P s Ѝp "]Z@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0 (00(0 1:11:1010 S;305<0@T $ t  t $ {t wt 00$00,Ѝs@-`Ps@P19@ 00003/@sЍps@-`Ps@P 00403/@rЍp@-pP) cP@  ,lPT@ 0 S05 \s 4mPV  ,m Ѝ0T@000sy_0p@-M00000P0` @P #0@P PrP =rލp@-p PP`IM  k@P0 0000 0@P # 0@P PrP rIߍ@-pP/ cP@"  kP0S ЍT@  lR   lPV  l0S0T@00sy_p@-0M@P` (, 000 00 00 0 0`4,0000*PP #0PP 20Ѝp@-P4M`p Rk@P043,0$0 S0 0@P $0S  @P P 4Ѝ 0o@ P T u 6l@y_O-PPlM%  (k@PmB00S@h8(8xP- ( 80,00< (0 @, Q00(0D2 , 000 r@PF0DT?0` S;# p0 @ts0S@' 10@" Hj@P↲ :`0P @X0 S$0 00  H0P #0@?oV20S@ P {TV0`D@ _qlЍX0S- 0HL@P H0 Hd0k@P`0`0S 8(,08< SP00@ S00S p $ H@P P000ɚ;6eĆy_@-@0M 0P 0#܍@-@0M 0P 0#܍G- `VpP(  R0U@6PP 0L00 H@$ B# \PT0X0Y P jpP 0BS#?V@ V p O0 R $R ÕPpx0311  U`XpV 0 0F0ER/000  R`sy_|y_O-MP 0 4qM Q6 Q(@AU` R. 4  0$0 8^4?o2Q0S7Q=@20SF WP? U P>8@` yi@P @0V UЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* R tT00#T0S  T 0 0$; |u h就U T00S 0@ 0{@U0K@@y_PGӀA-`MpP p@P 0 l0 gЍ000! @o0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` hP3`$00 (ЍpO-DM`  o@P0P S;# p0 ts0S 0 P0Oo0U@DЍ h0Pⅲ! 8p0P ,0 <0i0PPy_-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppO-P0㄰U`!R `VP R@ R R ppG'qZY08/0嘰7@-@00PQ000U  Ѝ0@ Ѝ00R0 0S  0Q < ^ @- @-p@-@0`PVp@0 ` p@Xp@-@P0S 1`0D0X_H[_@0L0@0pp@-@P Υ P @PS@-@-p@-@TpP0P R  RpPp@ R   R4n Q  101py_@-C-@MP9_` 0` P 1 p`00^^^ ^_0S PЍ_`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @N0(00M  XЍpIny_y_p@-P@e Pp00Fp@-@/ 000S0S P A-@pP`V (peORp0S 0`V`x` 0S [ 0S 0SD@eA0@6P A΀$@-@5p@-0@SP 0S%Q{0S 0S PRP0/@Pp0S@`刯00d m P p訄y_@-@P,嫮80 S 08  @< @΀p@-@PpPᘮ 0  p@Ү(0 S 000Ap@-@Pၮ400C40弮 4p@@lp@-@`P97 0 ` /Up@Q1M/ @- ^  0S 0S005m)y_A-@`pPP 00S0pO-Ln@Pm%Sc0S 0S 3 [cpWp倓pW[^P'c<0880?XqH & n[p0 Rq  o4Rl 8 Ri ( RcpW`  2Q[ X  R  @ 0  0 d 0 5 Y {kᰭ [ 0SXpБWQ{(帑X 0娑X  8   8  0 0偭    M  B 0 R ᳭d0S 0 0@000000夭᢭"kWp0Wp. 00 J(0S 00S 8 R4 S 0 0S x py_΀X?$΀V0S p@-0S pP@1` 0  0S J/O-PM0S@i@0%@e@`0@0  妢p 90o`PR 0,0X000`9]46%@P L@T ,bPOO<0@ᙢj@00@0(O@s10@0$0 00D0, @0_@P O\ TK0 0$pbO@00@0 Ѝ @O-pDM@0%@(@0@0P'4 @90`P @ T0,00`\4$@P  8 @00@0DЍ0S&@!_@PM`V刬=@ 0R 倬)@TO v001 0P @`0S $ա$ 8$0$0@0@01`0D0_[Hb[@0L0@0@0 DD8@00@0 `@P 00S p@0@ 0  0Sl/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P}0 00!'> 0`,`0 08p4($ Pf0 00!'> ,`0  0 8p40P($ PO 0!'>X ,` 0 08p40P($ P8 0!1 ,` 0 04p0($ P"0 00!0 ,`0 04p0($ P ``$@c` @0`@P (+jDЍ^^z_ z_z_Vz_0@-00PSUP`- P!0 C  SJ,10SF @P0S S S  @0R00 @0R 0 0@0@ Ѝ @0R00p0S S S *@@0@ D@@00S @*@ꨄO-pM00CS@z#0a0N P$@01 Rr $Q[ ! Pi@P 0& [T^i(@T R 0P 0 P Y0 00- ;@j X)+ ⩝   0$  l  &l j  Z4  B4 啪h0[$@*N 0  B"Ѝ@(@P/ VO-@S4MP` 53100S EC 4Ѝ `5Rp0WWpG'10 000(5 54 0 Sp⭟P 6  A" 0pp01Q+ 00? 0S*#x 0p1qX00S0[7 pUhP (0S(h w $  (3( 0,,婩'0044$ 0 00h[ N   @0 L00T X 40000 H@ 0C00P\0 00SJ 0S0S @ p  X@ @ @0 0@0 ╧P L" 03/@ ᝧTz  SP7& 0 ,00!0C00!, 0 (00  C@0 (  1R0 S8X P 0S ==S 0S=9pP0!@0Wp  0?@0@0 2P  03/@ :0 CP7 10 10S n0S Sq(g9@?1z_ ^%z_P P// R0@-@d  0  000R  0 /0@-cMPa/.`@Pcߍ0R@-@ `0S R0a/@-@ 0  R 0  /0@-R@cMPa/ cߍ0P0P0S `p@-@`P4`Pu 1_P;^ps@-P` !@P @@-P3 08O-3#CDM   ݤZ0S00   8 < 8cP`cP$PP3 00@3 YPP PP00#3p[003 PP PP00b[ pRԢ(Hg V""0&5a V00 S"0  0 ,GT;YpJYW0P<"[x 02`  27>L0 ,00! ! (0 0 00`$ @p'1少 01 00` 0,p(@$ @l 0lQ!h1 00` 0,p(@$ P @y 0E 0 0!1 00` 0,p(@$ @y0E 0 0!0 0 00`,p(@$ @yDЍO>0  d W8GGz_x>z_,/z_z_hz_z_Ȅ@G@x Wz_쇂Ą<%Wz_\z_z_z_WNz_  @-@0Pb W8{_000V@-P @P\^\ l8p@-@宣P0  pXp@-``BBp ,ʠ,V P\ 0$000 0T00p倣T00T0p@躣)W@-@P`XHX 0"00000 00 t00 0.{_6{_!CeGG-P`r儢U($0 S*፣ [@P8 0,00=p S R lG0$ 0C#2 BS*p@TX@( 0`00(YB00C UB?l 00 0?P0` |@TU 1#1L0R@`$ 0R ** B[@P   2XX 00 000$0l0 PSp  p p0l U } 幢*&vG8$Tp@-40P (a[@P ,UP00p8@-@W`@Wp@-@000pX05000  冢00;00)000 Q :00`P =>09#900S?  0R9ڜ  I S `P r40083/J0` =V0 %%|CX 0S 1pp@|Q t  | x x |000900000 0S"!Xw0p@ ZxS0000 |  @|    , 0C1p@WTGpG8@Gp@-@P`Mp@"Gp@-@ݡ0  `<00 02H PU 0 00p@/0 p@Wp@>{_p@-C#L0R7 Ѝ10S  B!.U 0S V 1 !0,0X 0ᓐ R0 @0pԟ$0@D@0$@T&@q$0 S : S@xZ J$0 0C#2S8# S 0! S!Y P ᩟PPP40@ 084/O{_hG$X?T8H#p@-Pp兟 $@P 0P H:07GSll0p,0p0屟0 0BpG8@-@0@ (W8p@-@T` PT$0S@0S@ p@A-P@ `x0p#p0L0R @ ŌV rX <` TV@ 'T@eT$GG-P$`p() 0E@P' 0 P p 4D@P<0 >  P8 l0Sp p p0l O  @P  0P ?x E4 PllpA d0ic1p0!P00G8@-pM(pp@,`PP+ 0  0V060000T0#T20T20SrP V0 0 0 V0S PЍ0S P 0 0 0 rPrP@- (pP @ P@P $0 7<`P Ѝ`U0@0O-0Dp`8 P @ P/븀4@<0Yhs@P@0 <`P Ѝ KP R 10 V @`0@0GA-P`p 0)@P 0 p 0 0(90"AEAG0/8202/@o/ 0R:****0//p@-@|Pᷝ0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@ٝH@-P`pAT 0S *0P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 ` 8&W0 S(0 1D 0 (00a@00C@0兝U *AA 0R010 0A UHH@-@0Md)`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4a)0 00000Ѝ@МHX?HPp@-]@L ;%Pp@ PT0QP3Q/p@-@P|@0Sp(@\DLP00L0P00CP0T00T00QpHD?H20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0i "!W]09 0NP D!00000  `yD!000$YX)00`V`W`V D!@000t @YD!@000g ?`KV D! 00 0D!@000Q80H@-900pЍO-0$ML0  82p 0S *("D!000,$Ѝ@ FH0]`V CP z@ 1s z6 1sP` @M0S2  1 I00>0000@001 :#:0 1!sd 0M P U  MD!(00(0P` 0~P@ U 8D!000$pW.D!000V UH0PpD!000HO-d2P 0$MS ao@p,H0S< 1s{@2.K@IM0S2  1 I00>00ġL001:#:0 1!c 0IM P ND! @(00(0\$ЍA81T = !D!$00$0K2 @ *0.SY Y+0.S (0000S X 0 0CX:00"@ *0' ]>@T X0 0000$ D! 00 0 HO-Mp80 0 0S:RP0b00T @ 0 S1`0cV`V``FHZScWs yR` $@ 0 80)0  *& VX"V Q"| P0(  0P0D00`0D0yD/T a_6W 0 W9 .R6 .R3  ! `1y ЍOu 0=0P0 Q L  L 00 L0`V* ;Tᮙ*=!R 01a@ЍHHD?G-`0 S@Pap ZPp` Qq a&G#0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝx ^@-0)  0?Ѝx ^@- 0  Ѝx ^@-@10,(p$@ `@ @<08 >DЍ耈{_{_섀{_{_{_A-@P0S`Pp0S  ! SJQPW\PQ 0L 0000 0C00S  ! 5Jx섀p@-@TpP`Pz9 04R00 0 oJ00p耈hp@-@`T nH@ 0 StPz0S 0R00 0 0 8000R 0P0@<@php@-@P00C0p@+hO-`40@SPp0I  0SBQ  0RPCS 4 ! I$0 0S1z⽖1000 0PS+Gp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 00 0R000x섀hA-@p`PUddG0Pp `P00S 0 000$ 000 00Px섀A-@ `PY00pQ4U0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA{_섀p@-@0PS`#00\ p0S0S 0S0 0S0/P: P/O-EM0@1 `Q1P$ @1100(0,0`V4`990S00,0V@,0S  C, /  C@ UK0@TK@0(S,0 0P 8U 88Eߍ880 =P@@p@@0, (p@W=0S K@T P`= I@Pp@11 00S  pI@P yK0(0 :@0 0D02< (H00L0@P P 0+8JPP@ pQ@-@@P 0b@-0@S 1000p@-PPEUPp@ 1PpO-M<00`$008, 0000 $0 @0C@0000P@ <0$@S x?0S 00@0=00 :00000@T 0S 0   f?C0 P 00P 00001$@@Y 0 >00@ /Q 0S  @/0 = P 0S  @ 0 0T 0 P /0P /0圝00)0S 0p- 0PP 0 pQ  01 P 1PRx 0 {pRn uj0 D@00 00 R000 0: 00 00 0 /R RH@D  0Dp@T0P 0 0000`0"P0     -: 0 000C0+  Q  000T0 `0P `PO0 00  ' RR T噴/ D ` H [aH0S R 0S 00 C0H DPMH00D000S 0S0*000 0S C0S ..00000050SM /P 0`0` R   W~ UeTB`P .0`0 0 000` PH ` -[^ DP C Rf .      $0 R   000 000000$00 $0 10 0K0S `00S`0SP0`  I/P`  R Q0  `P8/P 0P 0//TٳY].DP` -[H <C00DH0D 3TP óI.SO009   R C R C0!.0D00H0C0S 0C0A 000 00C 080S0S 000(07S0$0 S$ 3000 (0@ j>P @DP -- .L0 `00K&0Lp`t0P@dp@l(0` l@@[ .px.,0S50S 1 40t.,0/@ 0 P@R 0  {R P0X@}T }@' 0/T 0X k@/Th HP`40  [ */T P P 0 "X0S 0X0SM 0X0Sa 0X0S 0X0S 0X0S 0X0S 0X0S 0X0S' 0X0SC 0X0S] 0Xu0Sr Plg:]96/T0X @/T P  [:*/T lPP/@/T0X2 5@/T2 0xP* 3 0 S* 0/T P P200/@0XO0S    -0 0 S%:-?/@/Tj 0X @/T T>P D.  [ */T( P P=/@/TT0X @/T "P40 1  [ */TPP/@/T: 0X @/T pP `  [ */TD P P/@/T$ 0X @/T P0 0 S* 0/T P P 0l/@/T 0X 4@/T1 P)  [ l*/TlPP/@ꔊ|_PG@~:_}_v:_|_O:_HH::_^^_|_\^X:_GG3:_^^_ }_w^(_}_/T0X @/T DPQ9C80\  T(F  [ .*/TP PT/@/T0X @/T lP/980  TF  [ */TP/@/T0X @/T  @LP98/@/T0X @ 0/@ /@/@@ 0}T {  R00Ǘ0 V00 0 Ne,0( 0 00/S+00S0 00 .R  .R0/S0 0 00+(0 0 /RC 0D0+0H00 00S D0H 0 090H@DT{ 0TP C0S8 W+0C00D0f+ H{+0D0SY P) H  Q   4 RK 0CSHC0SC 4+( 0 00 00C0>><:8+L5+3+   R& 0CS#H&+000000sC0S +H+00000000S: 0CS_F++00 RH R=0C00D0@P *D@D00H00 0S $0 Ѝ H R /&@-(0M00    0 00  i@ Ѝ0@-0M(0000 000000000  M@ ЍA-0@P0MP?PX/PPPR`(p,0P0,004P 0`,0P:48 (P@p`$0_:PP2804 Q0C00 0,0ɀ,.Q .R: :9,0k*0 0PS 3=00U P `0P000@0Ѝ4*0S P ,*P ,0 \+/ R0S ,0 0 -`P *VA- 00S : E0pP`900@   0S P )@00WP@.@P )$}_8}_0@- DMP ^@, 0^ 0^ ^P  LE 00 06U4PP00DЍ0@ ^T}_A-P`p@P P 0 P0 A-P`p@P0 @Ѝ0 G-P`ሀ#pK@0T00/ 0P0T~:3)P t@ ,PV  6/P 00S0P00P0Y$*P07@- 0PH @P  VC Ѝ0~}_p@-P```@ P@ @KH    0!pIx@-@Pz<0(H0垆圆嚆P @B"xp@-P^"@@ b"@plp@-PS"P@@@ Q"@p[@-@H"@A-P`P 00噅묀p@T҅00 0S0PPP@ 0S@/ὅV P@nIxp@-@Q `P @ P00S Pp  ` @V opplp@-P`'@G0 R000@00P0z@pp@-@%P 0P/ 0R 00/ 0P0cp@'0A-`@VPQp0000@@@IVA p 0R 00/ 7UPO-`M@'$Pرء$008P$8@!OCAd@ 0|P p?oU20SR XPUPrN0 S   '* pW ,PÚ a9pP : 'WP#( !=8p :WX R0 R (P H%P ڔ  BR*!('W ЍX?gfff@-@sA0 !!|0x0t0l000, !  ! 40 @PJA}_HzhzlzZ__ 0 Fx0Fx0(Fxp@-P`6 '0P0P0P@0㵄㱄㭄PP0`_ 0 0@0D9pIxA-Pp0`V)@ w@P h`00 N/ V?U 0WI=.Pd0$0d0PP @@I0(rFx 0 (Fx0 (Fx0@-0MS@PW@P@ 0  hWP W@P@ B&Ѝ00@-@P0VP0S# S  Ѝ0`@P 9qp  0uP 8`&VUP0P (`@0@ R/"A-P` I1@S0101p F@ 01$@5 0ShoAqAXAi Q PQ1@010xIp@-P&000@ 00,0$ R @@0@=@pIx@-@P H4 0$R 0 (@&Ix;s@-P`@P !0R!0RЍpA-`pP@PЍU$R0*bPP*R0*C-cMP P P8 P/d3qpTAH3 sr* <"( "qAS QP* 5@8T w?Ѝq o?@2@ PP( PPR D0Sd00Cd0L 3/d0@P0Cd0G4Pb@H0 4R90d00d0 @Pd #Ar.@T8h&0SKaU (?Q@TAT? ? P(1x ?d?O@ PQ-* c5 8%D0S d0 0d0)D03/ d0X0Cd0Bh@h0P>h@0 P $ 00$0%0$0@OS,M}_~_}_4E~_p~_~_譀^xI_@I~_ _^&_^%_;_~_u3p@-P|%`@P,P `ᖁ 0`  @@p@́IxO-0dM`删匐0@ p0 3@P dЍ0S @  @<PP @03 00 00@PM80 gpPp 0A @PT0P00L@$@(01T$@T8P @$@P @0S 3$@@@0!@P 8&$0 8000a0A8P$!P^  PB2 RB L0S=$Y: V V4@# V  V r ʀ $ V b V # # T [ # @0V# # 00 #0׀WA;,@P #0 0  hP0400嶀W |_Ӏj_@Ӏxp@-P`d\0@T Q   4 嘀p@4$ R R @IxG-@UpP3 P000=`@00  50'00& PP( 0@`000`A`0]W 0P440PP !PP 0?0`0V0PW_pW <k4>zV  #__7@-`0P @P  P N?U.00,V? $? Ѝ0x__O-pP0$M`! 90@P $  ] P N?U.0  V? >p V  V<V X<X L<s@P $Ѝx_^__ _@-@}< @N_@-$0C00S@Zd0P0S R 0 R 0S 0S/00x@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0yЍp@-@H0  9PH0 0\10H00A PA"00Q00@@@p蘊"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @E 0'Q!18 P0<0,p(`$@@ @/0 00!018 0<0,p(`$@@ @0 00!08 0<0,p(`$@@ @ 0!0P8 0<0,p(`$@ P@ @ "0 T @"~%DЍO0 0@0ꘊ_^j_t_}_O-phQ`PM@8YP 04PP$W ~d@T`@T!7~ 2P P 0 < tP { ~ PЍA @0 < tP03 0<300~0}% @ G O-`P0M@ B2 b061(" pN 0 00@ 0 I4pP}ؠd@T`@T})R0t0 D 70P s t0}0pЍ  @)R0t 0 D 0P  @G A-`00V@YPឥ 0 P3p@G}dPU}V 0t  &<300o} 0&R0S VP ЍP}T0SdPV}U22G_p@-P@P P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0Po Ѝ0O-P`㸀M v 0UЍ'J0J@V@ V d;   0PP Pz  R1_p@-@P`|p@|ꠊH0 /p@-@DP|H09H00 Q1  . p@|ꘊp@-l t0@SP Sxxtx0t H0; Sd0S0000p@!CeGp@- t0PS@ Sxxtx0t H0; S `@0St t0x Px@pd0S 0\`S S PP  0S 0@ d@z!Ce@-0@  R  R / R      + 8 R Qt蘊0;0/O-,MP0S`0Q@`,` p{0PU Wg@@hP +V   0'0R` V`p|@,Ѝd d{ w4` {d V Bd 0p@I@IG-Q-PBM:p(1SP5R`<1@0zN@P@)@ fvO?P@DQ . XP :Ġ Z P 2@Dn8@Bߍ & 4PP 4PP ~ Tv @J@- @000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`PE Ѝplp@-M`P@0(@0 0`P/ ЍplP0/ ^_@-@aM |q0U d40 H0`0L 0/0 4 m $70$S-! !Q p 7\0 0X07T00" "7= 70 00dt7`P`0FSX7 4L7aߍ7 ^l ^&^_ŀ_^'e^؀__1_Z_m_&_^_@-@P (70S7@0V^'e^p@-PHkzD0@T0zpPh@d00d0@I0P/p@-P@ p1Fx01000.%/&.%/&  N+VU +# + 1|0pO-`$ML@PpH NP06VN 1U㬁$10SI  @?0P 0N<\00  ᗢY  $Ѝn P1 ! V0[ V I08/P 0V+cW p 0V8/P  H0UNR@4PP0 05/P +`ؚ@[0@-p0MPU U@ UPЍ0Ѝ0@ /00Ѝ0@I0    4 6::0070/0/0/ᘊ00/ ^@-@/0 0/00/00/00/00/0 0/O-QMp0a@PB:y0` |a0S@l@@T&WXH!D1 @对4`y0  0S80 S 00BQ0B03!P 0S T( 8y (!P0   - x0S T xX?e7_@-0@/0040/0H0/@-L@/0P0/T0S000/p@-P $0D@$@@T@px$@ @T@x꼊p@-P@x{Op@x꼊p@-@,Px 0 0 0hOxp輊Q3^O-M  @ (R00@PBU1# (pU< ` P``0 ]@P 01@P( 0 1@P  ,1@P@  0@`0V 0U ߍ`PC-$M@`100 00(00@ 0 ( 0P1 0  !00 p0p1.p 0{.pP  # 7$ЍT    9p 9| ^p@-P@`M$ !|`~+Ѝpp@-@P`M< u!! k+@-Ѝp@-DMp `P>@P 0P,@@00P'4@P DЍ .@C-p`M!*+PP*0@S+   0P0`'0 *PK0  000`0&0)PK0S@! @ +Pi-ЍyKxA-Pp@Pdu` 0/S 5@P0 Ѝ0 sdu@ 0/S 5@-pPdw`k@ Ѝ0/S 5@P000W0@/S `5A-pMpP`@PE?`00\@4@80>'4d@P PpЍHPJ0S@0!0000 00!0$0100! `(0 `s,@P F*@P 0`F0`@-Mq` P9@P 0,00000@0&4x@P 0S ,M,0P@Ѝ@00@0$0, 00:#:D0@0)@P|@-P !M`#q @P 0,00@0000&4/@P @T ,,T ge@ЍI@0@0$0 0 00+8+D 00, @0m+@PG0 G-M⨀`P p@P @P0@0W&@@P($pY ,H0SD00 SD0 .R0.S 0t00Sp280x00L0 0P0.&L|@P0d``PSx08x0V +0tS00.S @cS0 .R0.Sm 0W@V0T03/@PP0 `@P@U `PUX @5 0R'S)XD X 0S#YH 0RD@P 0 8 *0@X03/  ЍS@@UV s+q+0X03/ +|U x8 + sq@@@8 @-DMPp @P`P @DЍ0,00000@0z%4@PP0!0S U@0SU  @ , f*@o @, )@,*UC-1@3p MaYP9+ 01@P,e@P'L10S 8 Bۯ0<00@00000%D@P (0S" ,<r*,(0P(@Ѝ$  ]P @PD0P0$0,( <0P0T0< P0*@P(,PG_@-@9K@ ct꼊O-LM05@`pP$ P.A8. $00pY[XX |0S0oS  %(p0|0|0H S4*| ` +PA 0S z$P6Y( LЍV0 (0P Tx4Q (6`(Pf0((0pP 00 ((q(pP$P `# `G |0S 5$P @ 00P00%P0 P0s0 M850|0j 0M( tZ[| 0  ,|0 P0Bs0S 3Jss $0  @2 0   0S 0p0 0%PT PO0s M8M( 0% 000010! 0 000 |0PV  p Z ( M(  A +#R"0sZTU 0 xP VC0040z   R +Un 0 \Pf V'000|00 `0$PS `- ^ ^'_w]__@- 0 0 0000 ЍA-pPMx@P 0@00<@@02#D/@P EPЍ(`?P(0 @@0P 0$@P 0 0@ Y@T(Pr0S Ir꼊s@-`y@PЍp0rP @00!*0@P000rC-P@ЀАpM0 0T `P hQ! T@ g/0 /!bR0 ܲ0SPU 0@ ЍxWd^QX?_@-@-3\M` @P 0P0 SWTWWWW`WWWW$WDWWWW, `c@P,  3\Ѝ PS @P *@$ PB @P$ ( P5 )@P  @P(  pw)@P( q)@P  f)@P@ `@P@ @ P)@Pp@ `D)@P @P@ 0000 p@ `+)@Pv @Pp  8*`@ )@Pd @pC+` )@P ;P x@{Z@D ^@-@M (P ЍG-@!MS$ ` p! WP0O80-yPP%W$! P?@0Sp 0Y<P0@0 P ᣙU Ѝ |P@ Ȑ  P00/S S 80SP +4@+  |_@-PX0M`p k@P 0 0 0{@ Ѝ ^p@-@`L 0P@P d)@~p @-PM p`E/@P  04 00#0G@.Ѝp@-@`LY 0P@P 0)@Jp O-1MP`@0D:`@ p>0 0kP*[0$0P 00 00PU@ @0 3/0P@UT@H0@00.x0ЍUT*0 0 0P@0 3/0P P P@ |_@-0 000Ѝ p@G-p`.@P.0 0 0S@ !v#PPY %$@@#0S&   0P  PlP @*.Ѝ @ T  Z@ TG-0Pq$@C!@`P  PPP+N}F!$  G\}0@-Mp 00000` 0s!@P.@P 0lP0S s%@-Ѝ@!"@f%Tp@-@MP `@P U?000,@@04@P @Ѝp000S@@!"@P5%10s@- Q@P $P@`X500婗Ѝp0 0p@-M 00000P 0` @P0 @P?ЍpG-5(M@L` CP@ q$$.P 0 00000 0H  0 00 0@P $ |.(Ѝ $0R  q.$0  0P$00PzP$$  D. C-p0MR`P0'lP 0 3/@lNT T+ 0du40000 000@S ,t@ @P0/S -@P0  Ѝ€@-p0@ @`PP @ (0 Q@ Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR0`00BS 400S03P R30ЍpE! ! C- pሐP@``V`31P01 0@PP  ЍB0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@ `J%PP00S!3 T` TSn @Ph0p@-`M 0000 0P@P @P T0P00L@$@(0T$@P `Ѝp8`p@pT  $@P`0 0S030 &@P 0S@3:%@O-P0!M0#q` 0000 0,@PcUPd  b,@PX  a@PF@T0SG  n@P  T @P  ,P 0S-@*# 0$  @P  0l0X  X m 0 P@P" 0  o,Ѝ-@@@- x Ѝ@-M pP 0`@P @P`@Te@Ѝ@-M@ 0P >%ЍA-M P` 0pr@P @Pp@T 00 00@fЍs@-P@P% 0`00@P $@ Ѝp O-P0M 0000p0 `'@P   @PpP @Ѝ0@00@<0`D@PN(`V@P$0 0АԀ0:#:T0: S"  S-  S0 @,<!,P6 V, ) S  S0xy,P0 P0< ( 0,-(P0< P@P ( 0 ,<D"@P ,<w!,y @-@# Ѝ@@iЍ@- c Ѝ@-!  Ѝ0 cT cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0 <F@P 0$S@0S 0R@4 l @$e!$wsHЍp@4!$ 0Ph PN ^ ^@-; 000c0 Ѝ@- 0;0 00Ѝ0 c1 0c+0(00@-DM @P$P0@,P0000Z4W@P m0S00, 0P P X@DЍ0  ,g!@P ,  0c 00 c@-0S@`@PJ)0P @ 0,Q@ 0P000 1/@)ЍpC-pM`.)PP 0) @Ѝ 0,Q !!1/@P N@@(00@-MA0 0@OЍ0C-pM`(PP 0( @Ѝ 0,Q !!1/@P O@@(00@-MA0 0@OЍ0C-SDM@`p- ` U_E_@P"00P,@@0y|Q4 Palbm 4P@P zWDЍpX@  cl`@`  @P O@0@-0 c Ѝ@- 00 Ѝp@-@M` Pe@P0P,@@00P4@P 1@ЍpP@ @-0 c Ѝ0@-MPP @@0cP ]"Ѝ00@-MPP @0cP L"Ѝ00@- 0MP 00P@3P 8"Ѝ0@00@- 00 cn Ѝ@- 00f Ѝs@-P@0` @P u@a Ѝp ^@-P`'@P 0 p`@M' Ѝs@-P@0` @P J@6 Ѝp ^s@-P0` D0D0 0@P B@2 Ѝp ^ ^0@-0 c Ѝs@-P`'@P0 %@R'Ѝp@- 00 Ѝs@-P@0` }@P  @ Ѝp ^@-P$0` L0L0 0t@P@0 )@ Ѝp ^ ^0@-000 c Ѝ@-PH0` B@P00 0@ Ѝp ^@-P` 9'@P @0@&Ѝp@-00 00 Ѝ@-P` '@P 0 00@&Ѝp@-PD0` @P@0 @ u Ѝp ^@-PH0` @P00 0@ ^ Ѝp ^G-M0`@S11\p @Tျ0s_x 0s0Sp 0PPp?X1!(PP 0 SP? P0UPP(0 s` 0 s pUZ0!(00PW  0S  lPP Ѝ 0sP0PP ^ ^p@-PM`S&@P @0 @0c0 f@%Ѝp@-  00 0 0030 SЍ@-0 cHЍC-LM@hPP$ l0S (P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` %@P @0  00@%Ѝp0@-0  Ѝp@- 0MS@$P0` @Px30S@ c@P!@P #!@ Ѝp ^p@-P@l%0P @ 0<Q-@ 1/@9%pp@-PMz%@P0L` 0 0 w@%ЍpG-PM[%@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  8@$Ѝ@p@-PM%@P0L` 0 0 @j$Ѝp0@-c 000, Ѝ0@-00$ Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp$@P 0 @ 0 @@P0 05@0@0S 0 00V$ЍPG@-,0@31!$ ~p@-P`Mt z@T0@&0S00P0Z@PTЍp07@-<P T@P@ Ѝ0 ^O- ` 0M&J0 S1 0C 0 p A$@P 0  @ PT 0S@  0 @#@Ѝ@G- `@ 0p%J0!S B   $@P 0  @ PP 0S@  0@` #Ѝ@@-@(%V LdDPD`P 0$0 Kd(IȊ@-@M @c@ c|$0l 0 ` `0 X 00  , $0 ЍIĊ__dXX0? _1S/p@-P`tcAT`d\@Q p0S `` ```@` $5IĊA-p` }P0@p@pPP0PPPc 0 0! AcIĊp@-P@`c0P 0 1S 01  0S 0 0000p@cIĊ * ' $G-PP0S0C00q0S K$0SB l$Gc00HGc`^ p@lp@J/@-M 1a 0@p<0]@0@00@00@00 0@@Q@3@ @@@0 0P @t] x0 0xd@ DD0D  <0<Ѝ@Hl@J0?h_슂_D?"Xq_h9Xx_x2Xp@-p0P t-@0 @00P%^PJ40P0p슂]p@-``P]@Hp]D00@ R000@00p@8JK@-@!^40@ t슂@-@-R 00- ]@<]J@-P7]@P¶ Ѝ@j]`pP`p@PV 0000"#R 30喝JX?Mbx_@o/@-@H\}P$Ѝ@0]0SJp@-PP /@Pp\ p@>@p@-@ PPp\ p@p@-@PPp\ p@Pi\0S\/@- yP@K@-@\@\@-\0 S00 00CS\0[P@V ^~_K@-@\@\p@-@}\`V  9P  \p\8P_\Ub &p@-@HN\Q  J @ C-@MP4\0Sm\Ѝ`0FSP`\0@؀X\ p 0/P 0P 7@-PP00@T  !PT Ѝ0@@-@\00\0\0 0CR\0 SPd\\G-`p$MP@vWp0S*lЍ|P ʄ:\P tP0S [}|[눠 8P [X[P PP0[ T $@JJA-@T{[PPH`Lp0S@CP A[0 JD?q_O-0M `0 0 IpQ[ @P 0Sg[A[[JPP P?@=t[hPP7 0@00000&[ P+4! 0 0AX[0 (P 05/PP [0 p 1S01  0S00MЍT D0 00074Z00Z D[[@J슂O-0M<P0p`PmP 0  8 @ ,` 06/`P ZЍ0S pZ SP"0 0p! AZo0 000TZZ 4ZZ@uZ Z~ oZ@J슂@-M @ Z00`040 @0RP 0@00000xSZ pP :ЍL0 0 P! A000000wZ@J슂@-M @ !00`040 @0P"Z @ pZVZ 0V000000 `!R  R  A P1 S! 0S Ѝ@@J슂7@-@PY0  1S01  0S00P00000 ZP ' Pl p0YT000000Y Ѝ0@J슂l` ^_0_0S/T  BRT @- /@q ^_@-@P@oC-PwYPY Ѝ@Yx0S 0(`_Y0Px00 ` 0qW PY*HY ]01: 010qD?J슂@Jp@-P@`Y00p@Y00/0S S\/ //G-S `@K@ VEQA?`IQpQY 2tCXtCXtCXCXCXCX`PX,6Y`V `$GlQ\n` N@PT0(0 (00 `$G6 @-@P` p 0  Ѝ0S0S@-l0  C0 $ , 0 P *0X崊X/Ӏ H /p@-@0 P P0h0@ P Pp p@ 0P0<ppOppH0 /@-@嬀]XH0  .?H000T@48<40O  L0 0 00, 4J `P @ 0 2"@PY[ PG YK8@s0@01TD00, 00@0@P=[  Rm  RW  &  ?  @P$CY 1@J ,0D000,F 0P0T0=\  @P 40S&Z5 0t@@ !01@ 20@  @@P KTX  X T Z O@0 2Ѝ O@ H-@ p@-PP@`V TX00CX0ZT P*p O-,M\`ကP@`dpP/0 0%!X0ЍS@@  +@PY 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡 T0 0C04Ѝ@-4M@L p  P  `H0 0 $ 0p  p0T @4Ѝ(+ p0G @ A-`Pp\0 ' -P@0 00+ @VЍ0 001/tp@-@`PP `!PP p0R X00X00RC-@ M0 0  PP唐Y0`!aY0 ЍCЍp@-@`PyR 00@T p@R>@ A-p᠀PdR R @  0@* @R@AR V  p `0 @R W`G-P8M`@\`pgU+ 000 00@T"P0!(@,00 0 ! X  ? Y 00 (0 D00 !8Ѝ@ 0_@- @dP HP ,~P  xPĄ_̄_҄_܄_(00S/@-@^@ PG_O-4Md`pXP\[ 1 00000YS@) P)@&0 00U@! P1$ P00(00 T嫌1 00 0@ E`0  4Ѝ_A-`PpX 1-P1 00@ЍO-P@-TV@Gߍ ^@-PGM`p0 l @P\0 /@P 000 @-TV@Gߍ ^@-PGM`p0 F @P @P0@^ 000 @ -TV@GߍA-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00J Ѝ@D-TV@ ^A-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00 Ѝ@ -TV@ ^G-P M @P&0 000 @PV0`W0 pG00 0sP P!00  Ѝ@ -TV@p@-PBM`0 r @PP0 5@P 0 @-TV@Bߍp ^p@-PBM`0 P @PP0 @P h0 @-TV@Bߍp ^p@-PBM`0 . @P @P 0@F0 @ -TV@Bߍpp@-`0@#2000FSPVPp0PpV00p@-@PM0 #p@IMp@-@PM00PP=Mp0@-P0M 0 0P@P0 03/@Ѝ0 ^@-000 03/Ѝ ^@-000 03/Ѝ ^@-M0<00  3/@PЍ ^@-M@000  3/@PЍ, ^@-4000 03/@P~ЍH ^0@-0M00 03/@{TP P}L<0 0R 0"LЍ0d ^p@-000 03/Ѝ ^@-000 $03/Ѝ ^@-000 (03/Ѝ ^C-0M p08@P% 0"sr`@ P`5L $qL0 ,03/VP T 0"Y0 3:UЍ` ^@-M@0000  3/@PЍ ^G-M ` 0@P P 0 pK $)LP0403/ 0` Zp@@T Y0P3ЍPp ^@-( "!0 803/Ѝ(^@-( "!0 <03/ЍD^@- 000 @03/Ѝ`^@- 000 D03/Ѝ|^0@-P0M 0 0PO@P0 H03/@"Ѝ0^0@-P0M 0 0P7@P0 L03/@ Ѝ0^@- 0 00P03/Ѝ^0@-T0M0 0 P @P0T03/@Ѝ0^-00$M0"!#!0 X03/$Ѝ^0@-,M\!#!@0 00P @P0\03/@,Ѝ0$^0@-P0M ( @P [000`03/PP T 0J U 04KЍ0T 0J 0i!@^@-@000 d03/@PЍ\^0@-,M080\ 0<0 $0 0P @P0 h03/@V,Ѝ0x^@-M@00l0  3/@PЍ^0@-P0M( @P 0 p03/PP T 0J0JЍ0`T 0sJ0 ^@-M 0400 t03/@PEЍ^-$M0(000,0 00 x03/$Ѝ^@-000 |03/Ѝ^0@-P0M 0 0P@P0 03/@Ѝ0 ^@- 0 0003/Ѝ<^@-000 03/ ЍX^p@-0M` 00@  00 PP 0 0@03/0P0T0SP Ѝpt^7@-00P00 03/@| Ѝ0^0@-,M!80\ 0<00@0P 00 @P003/@^,Ѝ0^@- 0 0003/Ѝ^0@-L0M 00P h@P003/@;Ѝ0^@-000 03/ Ѝ^@-000 03/Ѝ^@- 000 03/Ѝ8^@-000 03/ЍT^-,M 00H0400800<00@0 0D0$00 03/,Ѝp^-$M "!00 00 03/$Ѝ^0@-X$M 0 0P @P0 03/@$Ѝ0^@-M@000  3/@PЍ^0@-X$M 0 0P @P0 03/@$Ѝ0^@-000 03/Ѝ^-$M0(000,0 00 03/$Ѝ^-$M0(000,0 00 03/$Ѝ4^@- 0 0003/ЍP^@-(000  3/Ѝl^@- 000 03/Ѝ^@-v_p@-P@`P00@000000 0(0P0Pp而 0 //00// //0/@-{@-v@-@P 0P heP v@-@0$ @ 堦@-G蒇_@-0p$0@@-0p// // 1R *1 4SHP// 0 //0S  0S p@-@@0S  p0S  /00C SЇXXXXXXXXXX 0$ /, 0 007@-@00PG000U  Ѝ0@0 Ѝ0Hp@-0@ R R p PT `h 0pPAX0n0`S` 0`V,0&f j1 Sd080P0 P?!00(0S50(0WB1PBU\400 # (0(*40803/PPN 0S0h0 j" R 0 0S  0R dn 0S40S   X0?o2P00 W,0"&0:808 01@0P0 000@0000 0D$0P 0S $@jP 0R d1<@ p0& 0S P@` 0P0 00S8 00<08 `PS$0Pp @4\  0P 0SW 00, `YWpp$0VpW @d [00P0 0000000,00P 0S, j0pL00LPS 000 $0 T0h731|0X0S  O0P\0| L06D00D pW,0P0UpPR0pD0 0\0$pp00X0&PS&60DL 00Sl`,`000W 0 V,0"&0:H00H 1 0@l 0 0c60 RZQZ3l0000000 l0PPh 000 X0S 00S ᶝPL\G`0U00S 40S 0| D0  D / ,01/PPiL0SiP ١ 0Sv iU  %6`1f 0@ \0 |0jF P00|`00 W`001:# `  H pW H {Pl 0 0/, A a3!<0S W 0# . RP HH L P! @=*V"*PU SP0t00x0*sr2\0 C 00040St 2n`0x >0 `S 0&fji0H 40V Qi0`0t`xpGP0 0, RS00W00S0  00  F 00)0 C cl00182T TVT0 b8 QSQT S10 8<00P 00 06P 0S P 0S hP h 0X p0 ?o2"@  8 VPWY" 0@ Q 0  f`0ShP $0@!8+B 0D0 0 P ޸W_0OO-CM@001< @041 0810,09309L0081 0D000H00p$0D0`S H000 ?H0  d0S' @W $0S 408 03/b chPCߍW5812 0 SpJPP) Oh Lh`=눀X `@$00 g0p$08P 81 40/03/PP (000 (0l 81 0SD7  01 V 0d 81 0S0 0 80ط0<`@400 0 0PP "R 0[PȷL?X H0  0S0000 0S 3/H0  ᗰP d0S g(0, 0#R00SjH`_?i`V`fmWY $0S 408 03/5010 8S0 080D0S ,0S  L0jP0ׁP (`,g?g 6g 0`! 0  <1S<1P P0  S ,0(`,S XjO(g $冴(0 L0,0P0A000 =X `ɷP @ p 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030 000p0*V0\000W\ R Xp0A!\X00CP1  pp0൶\B?l1Ph0 aX  0S 0S#6:RNƠ 0X00 000p0*X000\ X0 0X00(0`0 T0X0S5X2 \ (`,0C6` ïf0X p0P 05/P╶ dfUX (04 ``X 0S00`04``L0pPX0\p0X ᒯ0P 0  <0P@0 R T0S  R ɳ `00S  Y  80 0 S㱹 ³ 0 S\ 101T0S@` T0S  e$__H#@-0 000! Ѝ 0  /A-@0MPb ,0F00 00YЍ0OA-@0MPb ,0F00 00@Ѝ0OO-X2$@LM3@P1`00 p     0  0AOoBBLЍ06 ?\0e@@e0 0 0 PPpe 咶0S@WeQ (T ʴ1 0@  @& (  6, ?(#<@$8 0(@P8 R  3T 0@ P 0R 0᥵ṲPG-@0(MP3 聓0b1Fa @_ 000 0  .p0 P(0 S00 ,40zP1~pp p,00 00pG<010801 1!&:XK:8V|1 0(0` 000 :#: 000 O8A0  ,KXF00000C00 000 0C03DH8 40P*qp& D8 40 ?y#p{00H < 04 H&\_x>H#Xp@-@Pc;0 p@;G-P`$0@p3/@PZ@00@800 4/@P 40T00SOp0Vz S P$03/@P P 0Sg P I @0SI00S@0SP 00L0D 8/PP H0U00S @@ 0W5 V5 P 0S  0P P  0S 0R PP 0S P P <0 P0 ЍP PPSSA-`Pp@ TW AO-P @`TU   T0 0 06/@ ЍA-P0P`0C?o20S@  UAp W U XUO-DM,00000l h 0  @DЍQpPሐ$0 3/@P`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Uu L8680 R R<SP )<0S 80R PU8<P @88`< V0S@; x0S@7U l0 0Rl0 @P*   03/@P0 @t 4/ 0tP`N@P 000,0` 0@ 0 t4/@900S3 0 `P @@400 @ 0 t4/@PN40S80 0,0B 0<0 0p0@000l0P00 @T4 P1 /<0 0p0 000l0@080 0,0008`<P  0 4P rPd nbZ 0RES@@0 t4/PB@ @0  4/@Pt0 @ 4/ 0Pt`+0t@Pr000p0@0l0 0,0 0@ 0t4/@P`00 0 0XS@TA-P `@0p0S 0W 0T0S A0@-   Q  O-pM0<0P0H00P0 8`@DL 0:@P& W0V04 P0Y04  0 ЍO  P0S P @Ѝ /A-@` PpP W $0 Ax<@- 00 00! 0!""##$$ @-D88Qp@-@ Q  88(PQPpp@KIp_^p@-Q@pP @Q\0@$0@0$0p8$@R8Tp\0$00$0$@p@-Q@pP @Q p7 0"68 0"p@-Q@pP @Q@p7d 0$ 0S (0, 0@@8d 0$ 0S (00, @@pY 0S/S 0 / E/0S//0S-/@-*_//@- _G-p@0S 00s  r M`p 0 r 0 PU S SZ` VȀ- //@-"0  @-   Q`  }`o    %`_/@- _@- 0   -`  Y`o    `j_@- _@-@M``PS`P/@-0_p@-@PD_@pB_  ? Ra0 ? /0S S S00 /$0@-h0pW0^(^<^___e_ `A-`p@ PP @A=: <900   P1 @0<03<O-@`MP@T@Pppp@-`@P,P (Pppq@- S S 0 00 0 0 Ѝ ЍPW@-0@0/PQ >Ѝ0S S S+ 0 / 0 ///0@-P M 0*@P 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< &DЍ0O_/p@-0P@T `@pp@-P`ᄮ@P @ᛮpA-pP@q`P$ `ሮV000000 0 0!!!!""""####$$$$|0|0弹 /@-p@ P`]姤 0000 0CS 0 rp` 0@Pp! 0` ЍC-MPp`04@P  0 $ 01/@T 00Ѝ   @P  @P A-`pPڭ@P  0 ˺@T 00Ѝ @P @P 0屺-/9 0T0/ 0X0/O-`DM@ 00 0 刀匠00  ``k pP 01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0b 0 DЍU P \ PU˰p \ P 0 9p Wʠ^ _G- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  1@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0 0SS 0 /S 00/p@-0` P 00CS0@003/@P 0 P2X00X02pp@-0@` 0P?2X00CX0z20p@00/ 0@-0@00CS0@000/<P /0 0000/p@-@PT0003/@P 0000pp@-@PT` 0R@90003/TP P 000pp@-@P#0003/@P 000pp@-@`0P0003/@pA-@P0圀p`0S001X X00CX01PP 0  01/@-0 W_A-$0@@@P0`00Zp$ZY0S 04 0 13/@Z@p^0     0 1/@-Y^ R0R0#3/ 0 / 0 /0S  0S p@-@@0S  p0S  /O-`'1@PpW  z{   Pu  +PpI1 Ѝ@@@-7@- 0 R R A@ + Ѝ0A@ {_p@-P0S0@0 0S p@x0\03/-Ppp@-@04400 # #$0Ѝ_00C SXXXXXXXXXX 00 /, 0 0 00 00ßs@-000S @D0 SJ^0311p0S0 0S-R00 0Q 0 006;oz@000C0 00C 0 R  S \r0pHn000S<(g0d0000 3pPz  Ѝ<1O0# 3R0 0 Pk 3R0 0 p^L/0L04(0Z0ꉾ꛾Ӏ{0M_ƈ_xs@-P`00@T H/P4(Ѝp@0 DTЍp0Mxp@-`MP  @P t0R R3000 0 刾 0@Ѝp3000 0 yވ_@- Y@Pᕽ0ЍO-84PTM3p؀ 00`S 0Q Q @PD_/Q Q8崳0S 00 0000 }@Px p/) 0S#0S 0S00 0P0w/0S ჾP000C @P U]/@TЍ0"弲S(4001 00 0 0 :OP@ `/ m@H=/T @!4( .0S1 T,/ @ߺP f,0 S00 0 0 :)P@. "@ /TۺP E,0 ST#080.0S3 ,aPp13 0 !p006/P&@ 8<(1#,0"п{ 0S R 0C 000C00S00>l. d ᐼd`P]003 0D p(06/PR@O0Mx_hrShd Sd@O-`|M[ 3#0S S@ h X TP 0 T0k r |Ѝ 0S0 0"X0PKl@ TLTH㭟H2@X1100140PĤ0j80?<00 0S 4;j0$D0?H0? @080t{p<0 @00D$00U, (0KD0 SH0 ?X1!U3T0000 0  00 0@ 0L咏LP[T0( p0,0pDWp!$ Wp! 2T̋[0SW04 n0!#?0 0APT000 0 0@6PEhd _O-2`P#0DMS Sz@ OP 0 Q0 DЍ0S\ 0S0 0l! 0FPK4@ TLTHĔi?0?00 ᠄0偋g0DpQ1! T 0 00 0@0 0D X !៴P 8000 0 0@庎P pW D0Z0SXꢋ hd _0@-PM@ P@ 0S 00 30@Ѝ00@-`P @P 0S-@ @0Ѝp@-0P 0@P` V $0@0  " ኺV@Ѝp@P D D0 4S 40 60CpS//)^0S@-0P/@- ~@  X;_&_xG-pL`HPg,"? !@T0@@0 @@@AP0p0 0`0l0,TG$0 R\ \ @0@0   0MxO-`Pq(2?0q #,@ T], 0R SR,P [|H,C,0@V 000S 7,00@+0,P,0@x0Mp@-`P+0 @T 0?ST Th,pP@T P @+,P@p0M00/0@-M@ P PT0@ D0D 30000∹P+(ⷅЍ0zd@A-P@`+  Q 00C0 0 + |{+tPtp0S`0 2?0!0S 0 0 A+ 00Mxp@-0@HPT+0`0@,0D0+T'p@#0M P  800P////p@-d 0@P; .04 p/pO-P2S 0}*` @PP X@@}>w0K*}.0Pd 0 ΂+"[! |*!/#1S%P @ LP WZ 0* (!P 000P@  P 000@P QZp 㰠夰m@_pW0: 00C@_2 < 2 ,2! Q Ѝ:;,mnO-Q`0p"ᛢ@ pP 0㒢 <2 S\02@P? ᄢ ":#@TP0!xp!9#@TP0!l!dƒ1#. @TP2,! 0)"0|| pP 0 0 T  (0TPp@0T@PpP 0 0 TpȠȐTP0I 0@P ?T @.0 @0<  Ѝ:QO::mnP/O-$0(P`Т@p(0bQ< 0R00$00S ?⃁X *;#$+4P Uc): 0$0@0D Ѝ(P U8`<:$ 0᫡ (001r00 !&! 6!@-0@00$00ˇPp@-@P`R/㱡PP`c rPp@-@ D)0!( :@ a@-0@0!80@0)A-P?@ `!tpR() W\00\0  WX00X0%0S`00S 3/050O)A-@`PP p)Sᣩ=)p@-0@pP(嚩@.)Tp@-0PS@p 0x 0000K\`(0 $A&" )0@~ Ѝ@!궀^&_^0/G-P`t@(U 1P0P0SG(0S0p 0SڬP嬐U=PP (03/( Z#Z P &ոϸ00C0Z $00(n(p@-@PPpp@p@-@P](00P 00$00峆p@(O-M00pQ  (@`TB  0 W : 0P 3βt 0U0Ѝ0 @00D0 0(8 0S<0:2<.`DpP.0 p70Pp ЍP@-p@-`Pp0S0X0S C\ c0RC ^PTP1#pyU_O-M`8 HUH$␫P@ 0PY+ἰ$,0( yP( ,0Hx00Cx00S  .  吠 H00\ ! ᑬx lH gHY H@`HAP+ ($G 0 4MHx00Cx00S  . R Gh 000 0RPpP{UWv 00t0 GF<Ѝ5_Yu^^_ąg_A-@`@GPp吀0T:GU0QU P XתP 0ѪP寕GA@ꄌA-0MP00p 00!t0  00 |@T`x00UЍ0SP*  (%y 8ɫ000 y*, y_/ (^`墖V 00 0@G-Pp&G@ᤐ夠0SuGT ቖ0aV X MP T Ƨç 0 P@ꄌ_G-@pPF@ T:tAG@aV X 0P,/G@T@@=ꄌp@-TF@HPH`0Sp@0G0Q 0S t@ꄌ_A-AQF FP ⑐PP C F`P帀PpU:AFQ  R 00 00 0\ S ꄌą___>__41L0S/0@-@ QM ZF } P7 P0. P  FЍ0 H P R PU 03/P   P ,Pąw__΋__$_O-M00Ph`pl0S6 0l0p0 00  0z&  8 0 <0$0 00  <0(,p8 y@ #~0Sl00Cl0  TЍ  0*@T0O-@p04PE܀0SFT  Ѝ0aV! R V ԨP 0WS8ZY T B?  <P@ᙓꄌL_p@-@l媨Pd`0$4SS @pDD$@დP CP 0@Ɣ^^ą 0`( "4`#/O-M n}90000 0 -PPr00 +4 40#400$"44 8##<004 8 40 80 < 0 0`$"440#4 0 0$"44 0#4 0 04 8 4 0 8 00 $"448#8=Sp1=p#'40p0("(W$3[L X0!<30C(r*0 0r;p0C0Cs V `llP0@[2 zЍA 0P$( c 0 $ (   0 $$ "$   $$ "$ pR0Cs WPp00 00$}PP !440"440-* ' P$PT!TXX\\``ddhhllp pt 1tQ00 0uP t0uPIP`1 QP弨!"44!1"44!1"441 $0$Q 0RP (&0 u u  8  u(PP0T8 5P 0 ,00ER{_PM_Ì_8^yU_͌__O-X`@fuM | X0`p#00 0?PP*0P X噮0P P! R R0wX8&  ⺄,T P00S KPkyuߍ XX = ,4L HZp2PFS Oy3 0ԥPE{pX P NΠ0 n :1 .fPP  0#v P 0`☲c᥄ #P X ◄& 0N& XJ  K0 0P070㚳#, u u $(0, 0 0S 1!3S$ ?6.~`0S S*Q #?0000.V A00 Z00 Xt P 6X0P.  Q#?0000Q 00 t Xt z PpX0 ioR 000X00 0@^dPb H^I_[_y__ڍ__T^^͌_/_a_T0Tp@- 60@@PP `QPUPTpA-@Pf/pᒒ<(00`S3 #01 1@ ##:!#0<,8  Ms00 Gs0 H0<0 0008|0X``00``m8 _(0 0<0`0,0$0@000(040,0AY꼪-_WEVG- 1( @"6 0UPP 0S00GAx꤀00CS$00 08 pRvW00 BR`!`1P0W   W  00C0A-` P &0)`@P@ |p UT00T0  UP00P0%0SX0 @D僢P@PWG-`<1@-0@ ($=P@꼪<_pR d0R \0X0R> 0/R-/00R>0/P}ft,@|f{f@~fp@-@L P & 0 ptP$ p,0 60S0!L0@K&\DK0 60S#3//0 R@#0 Q /R0h0//h]0( #&0  R /E/00S/კO-M`0 00000P@P= 0 @@@@p cPĀĐ@TT ,fTZ ЍO T1# ۝@PW01 #MYP0 "EP @Ѝ谌4!  \ / }: Xݎ_$0 0!0 00 /Hzhzlz0S  0 00/p@-0pPd3@1`000/(0, 6Q 0/(0, "R0@@V<p@-@0 00R 0(0,000@(p@-P`@P @ `T`0S $0CS@ R(08 8@@ p@p@-PU @`00p`h0P*pp^p@-@pPPp@A-APp0S$0C@PoobT  R*  R Pj$ R8@ (@T $0DS R @TP8 R8 0 RP`V@p@-40@SP 4-\0/,0S S 00 008@Tp`0 6/@@@-@P P  @  A-Pl(@`qTbH1x`31`0050S@y050N 0S E?00000P ոP и P ˸P 00P 0000xP/NB᮸@p@-@P` _ 0P6 #::0t $00000@0`0: 0p^A-Pp@3A`1`00 0S60S50S 0S E`LP Q 50S0 xlx050@$VY@-@BcD0S OP$@ @-@L50S0500S @A- pPPF9@0(0@P<1``00SgxxPl MPPPPPPPPlPlB# 00 0`S 0 , `7 0@PЍ`Y@_^@-(@,000S S 0 XAP 0S Ѝ@NЍ-\M0000Q 0S 3/\Ѝ F G-`1@p31`00f 0RPZ50Sxw0550B R  00 0S#P> 0 0 0  P{0 0000( H/o6"Q R  R   0 0 pPP #P 0SPU  P P O-1DM00P`p0 <0 a0,(P$  @<_<0 SB 400 ,00  0000a000'>(P0$ 0 _<0400 ,00 0000a0(P 0$ _<0400 ,0X0 0P000a0(P 0$ _DЍ_h^Y_]Y{_[Y_O-QdM@0 | PdЍdЍO_Q0 00000`0 PPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H l X  0P `J@ GrpT @DP@O-造Mx@P` p᥊0` 00l n,1 0(10$10 1H00XZ 1?o2P0SЍ@bYC-M 0P`` @|p0 P 00 00 0 0@Z?o2P0S  BP Ѝhp@-@P@T $@DT`-\\ 0S(@0 80 0EKP p@ @T^_DbY_A-0pP@TU,`T`1 ႞@DP08_D0S/0@-0 HA ЍA-@`p`P0(@S$0CS8 R (0S $0C `PA@A_p@-@P T-p\P yX@)<0@ @㜽$  p@_LKl荂@-<0DT 0 !'0  !0@- ! 0 !A-@`XpPUA00`0S 00  03/V<荂p@-@P0 0 0 0 00 0 00  p@O-pp34M1`00#212@T 8 0"0#!"4Ѝ00 030 %d`P0S @D R 9 R9teYeYeYeYeYeYeY0eYLdYeYHeY PP  C\0 : 70 @0S ( <X0000< 3SH L0SP0\ 0304 sR k "Pt"P\"PH"P4PPE_o$"RQ 707;?<  0C S0! 0їP00 R g7 7  zP( U 0S40S 41  00000C0( @D0P0*R;(  + 80S 40S 0 @PU 0 =PP220:00lpX 7/U P @p03/LK@ZXA-P4,a @T @DT@T $@DTA0S 0Sj @0S&$008P0(00S GpP TTI<ᅳ080倳00:(@@LKO-@,M,00@T `88@DT,ЍT <0RUSL ((徺0 0 0 ɺ P0PP9 Vb000pppG 墺0 0 Y ``0 媺0V` F/ G0 PPP# 0Sz,~0 0 0 剺`00@T @DSP0P P060S500C?o2 0 0 Laq 3/ 0``S :@MbA-@p `PBM 2SJ@ @(@0 0@S  /02 100 0 0P`5Bߍ$`Y@-0  Q:0 0(0 0QS Q   Ѝ[$`Y00@-AM@0 0 0 0P00! ! 0@X 9Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp p* A5#RH L0S0P  9-CM       rCߍG-P<p@|`/ PPl00P(P$P,P0$008P$S( (0 { 0 pGQ@LKp@-@,00,0PS0{0,P@8PUp`0 6/PO-(@4M3p1P`00 50Sxr050`V :W 729 `(00 90p9W 1C7CWr 0SY 00#212d 900pWr `$pGWAz#2!128W M8W4 0CW8W 8W0CW  0W `4Ѝp80 SyYrYrYrYrYzYwYrYrY$zYrYrYrY8zY(8W 0W 0S 00.`7W ~;C?>CW_ >0W >C 0CW H4ЍO7W  ;CW0CWx7W 0S  ⬙`@7W H4ЍOh6WJ 57W >C0CW`즟 W 6W`VlX 㜰0 W@0}Pd0  `OzDV  V fD6W+ #17W 6W\ 000 RV 0 E0 0A0CS…Q5pW $pGW`5W ;00p n 0S0Sh%0 R01 5:S 000  ` XX  , `P $ P {`xPl7 5 `00`. 2j Y' 0Sb 4 R7`P0400 R0S 0 S. `00  0$  ` 0 (00pW $pG`,c  0S R0P ` 3S R (PU $PEU` 0 B R`2X1 J`P,0(S(0S呯P 勯P`` 儯7`F 0S S 6000(p YP1XL*1` }@?P 01 l1| P 0S 0 00( , 0 !(00,000600008000S080<00S<0{0@0x@0D 0D04`000(<VX  P040Q 5Lwt@HpB@f@pB{B@X?T?zB@LKoB@|B@~B fB@oB@}fkB@|fvtgBBfBwBh@BQ_/P/@- ŗ0`( "4`# Ѝ0M0000# Ѝ/ǮƮ/Q02 //000SCQ00A\% 0\ @-^0Q  Q0 8<0 0(, 0  /0\ L\ @-0 AS/0S 0 /000S000/AP/C-Q@ P`@A0pSS񟗓؁YYYY Y(YY Y$ 0,p(`80kOPP0 00!10 ,p(`$ 80< XOP@ <0< $  00,p(`FOPg 1000<0 ,p(`$  4O0PU     '. ,p(`$0 @ 0< OPD @01Q[P1S ~?S?11S1O@oqM$YЌY_׏_dY _YKY_^__8_YA_O-DM@c `d` P@; K lԭ |D1n00,($  p<0NP@ DЍ 0!<0$   ,(@NP 0!0$ 0<0  ,(NP 0!P00H00,($ P 80< NP ĖYY_׏_I_Y_@-@Ph; k @ 㑥Yp@-@PG` Q    ,p@E   RP PP  @<0 <0x 8RR00R0S 0S/ 2+<긕YYA-`pS GPTP@ p :0V`` BY`Yp@-@PVp0p@/A-Mk`B~Pxu@ppT]ЍAc R *P ~a@K@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@갌YYYYYȌYЌY(Y$Yl 0@o/ᰌYA-P`pD@ PUAD00S7/@P@-@400( R @@0000@܆@-@00$S   00C0@@-`pP@MPVP@ЍT@UP\0pWU  Y0S   L@PpPE`?@܆0L NKO-0M05p  /PP, 0 X`0@"40/00  / x$0(0`0`ЍXY0@-@m0Pm@ ,/0A- 0 `   H0D0R@UDp DPU ?D02SH H0 mr0AĕPH0S D0SH0D0H0SH H0 mHp0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`Vp|P000p@7@-0@S NPP0s00 Ѝ0p@-@`P5 0 50 0Upp@0\0 L |K0S/ L KA-M@`P0p0@P00HDPP@0ЍA 5.oPD@-3M@03XRp\D`PPxQP80PUЍb#9`Dq0S00P00C0R*,0S 3/XPdG-VM@V/ nwpjN }?@c KD 3"0 2Q  ! R!ǿ(0S Q050 c,W b8ᰢ䁄刀 2S u8  妢0 2XlRU DPEU RU& DU# 0ZHP !0 RS 娻 R H0 3/0,PH0 PC.&U$1PU"  %-8'P Q001,YVߍ40S 01Q 403/0SXP0S    H03/,KK܆N_Yd0L |KA-~`a@pT l0S~_@DRPP 0 R DO!P@3 P 0S !PYp@-@`P@P BpA-~`PpU@ l0S~P3 DP@ 0 0R DQ l!PYp@-@`ᶾP@P ҾpG-pW0S !S* 1S l Q`~`P̐Ul0 S DP@~P 0SP 0 S:V ` ,  D}.P܆Yp@-@`VP@P rp@-@PZP@p@-@`;P@P Wp @-DbP00SDaA-@p`P@P i7A-P`$V  l0Q R D6P@ 0S 0S  P Q  P   0S*p0   D갌YA-@p`ͽP@P P/@-(0pMPL0`  @P $(0, SS  3/ЍXYp@-P@} R80S T T0T T T00 p@00R  0000b00KA-`pP40@TA80S 3/X@dA-pP@HLW`40 p0H0(0DtP@A\P Dn 0 0R DdPL0S i$DN@-@@M@-@ @D|0/0/0/0S/  K0 R0/܆@-Pl 0R谌YA-0` `00R@S 0`8`0}?`>MCaajq p%%a ab劽UbXT! 0$ $18!0 ظ  0R200 `p00S0p SV x`p02P0Q:0"PS%p`W !.:`"0 AЍA0܆KKt_|_@-@m@0A- P @0L ^U 0S 8~`pk@hpT S 0S0@A9l0S ⭆P ~Y@Yp@-@`P#@P 0 +pK@-Q@MP@`!pPP@ \ V0 0@Ѝ 0 <R0%0 P@@0A- P` @0L ^U 0S û~p@ကT l0S CPX0 ↼ѻ 0S0@A~@YKO-`0M#08@Qr 6^0Qp XXP  03/NZXP   03/NZoWP  03/0S  P `@P@tWP  0# 3/0@WS8'S`Vp (]0 00000 0gX ($Z ~X PUP Pdr4 ~pl>`dV &.X0PCP Ѝ< <0ɻ PS_0SCDP `5rXP Uڐ P⚲P0PEѺDPp  Ǻp <ⱻ~`XP `~ ٺUڐ PrPPE⩺D?< 去44)454P$SN $#(u (PPL\0S$PP4 <P <sL0$3/PP 0S- <@P W3|`|0<P03/P H|` @S"0<#S 80#S %'B BS #S #S#V8 0 0 0P 0WP, (q"S  S "S "S's |"Sx"p"S l$'a S `L" R@1"30 P0S- PY `0 ` 6/ NZ0 0(`06/  "  S`c# Z  R @aP-  03/[  _ 0Zy S#B%B}e Sb O!"'S s[ SX *.l33&iȀǀɀ@zixiKxi Yiiiii{iFi@ui niiiϖo@ɀi7iiiG-PpN~`@|T l0 S 50S0 0QP80  U~j@YK0  K0 gKA-p`P$@P 00S0L ܵ @ PP K @  ˵ꐐ__0 岣@YPYN 団hYp@-P@Y40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@QPM `?1h0Q o0CQ 0Q 3QN `Ѝ3Q 3Q31 1}0Q0 00P0 0ީ`P0@S?` SRp @q? p6`P @h2Q 0CQ 0Q2 0CQ00l2Q 0Q XJ`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`q1#  `1 3 1#>0880R 3q0`N`H0@0< !N D!0/H0L 0/QP @0D P @㽚qP 0?S@ Ѝ@蒯S``iui vi iiiG-x Qp`PM \1Q-@UVDD奵 0 00 00@P ލ@T3T @ P  0R (뎷DPP1@ ᩷ 0Q D @P W14 (0W-@ 41i i^_C-qM@`P)  03/PNU# 0S    Pp@0S   n  0SЍ=1PpP  ɀx0/p@-`Q@P R 0 0 0 0! 7p000SP0PP00p*R !0 0 0 (`0SP0P0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P0#3 R`M3  mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP $Ppp@-@PqPp0@-@0M0S0S@P  SЍ0ϖo_p@-Ph@ᖠ1 01  hp@蟠@-p0$M03`A0AS P R R R0 9/@ O MRY R @ ߁000 S""44 0 #RH L0S0P  0 0 001   01^000000000 0 00000 006@P #T@$Ѝ3  9#0P0C@0@ 001 0 S 0 ~< 0"448#80CS=10 001   `1100000000<1000 00@P @j0 w 0H   C Rw0C0000 0S(  (  ( 0   ,0T0 0 !0 @P{ Qw 5@t2@7@5_33@-3A0@S AS S 7<2@S 3/4P@*O-Q,M0 #21 2@P0 40S `0` " !",Ѝ0Sbb20ڗpH2V H3ЗbVRUH#0 0X0\N90PPU:0字0 00 ᇀ P0p@-P`@Tp P ໆP @A-0PXMP- 00 0XЍA/`@p Q1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ荂\0p@-:PL@0 R 00 Cp.APAAꫪ^ 0@-PQ@M 0 +040060000 $0T l00p0 200P000 %U 0 00#0]0PR,R02t0HLR0h00 P(05/L 0 ; DЍ0ဖL_TYdYY^荂_p@-@0|0DDx0003/HRUHHHRQp0S  0 尖20C2ꤓR荂D+Q/D>00S/   ! """ ^0p@-0PSp O T  RQ40S47/aC^-9S 0C570C03>C<A \0 S?paN^ >9QC< A(.S,S :S 0S7p/pp@-0C QAC^9S000@N TAPNU>9^C<7A@-@ 0R R% RB 0 ~ R ~   ^           R R  R  R P~ D3          /^^^_@-`Pϕ@H  `P*0& 0# " &P 00 0 ~ ~0 024`S 0 0B02H02Ѝp`HT ᖕ@-@HP  a`P "@P 00CS 004`S  0 2H0C2oЍp`H</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@N1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S>703P pKPpp@EPpL2!4<010 " $"S $2p@p@F8"Rp0S 0 0 8Pvpi1iii2i(#iX8i(i^ 2 @-$2@0$2 P$20$2/(2S@-$2@ 0$2 P$20$2/G-@ეpP(ᰀH(20(2p02P0H02(Z p@2S,`Yp`V v H|(20C(2,2S0S,2?02HW kD p 3/`P  0S0S0 0"p@-@HjK,2&jPUHp R&U R?,"02(2H0C(2s@2S(2S+bgp 0S0S0 0"P 3/A-@` Pp0H   CR0C0000T7@@#RH L0S0P  @0(00(00S/@P  j{0'  $ ! "$& $ "$ (?Q0@ a060^@-0S 0 P P Ѝ0 $"$# &  $ "$  $"$# & {#0C-M 03P 0 SP0ht`0开cS0 $00044@X 0@ DC5(00X 0  R:0 3  00LP  F0P<<00   0:00h(b(0, O 0@,@(0hl0#:0#X00S(DD KP `0#DDH$H#  3  0 0P0 0 A P0S `0#DDH$H  3:#:SZ2T Tr & 1T (0Sp0 00C SF0 ^  T 0:01T7?T+ @P  e{:81@ R  P0-%p'  H/o"!20T  T  0T00S 0@000x0@000 04Ѝ~ xG^ Ld5݆P1O-0Q@00`pDM(00 0<0a0,$@ @@ @<@:000< 0a0 ,($@ @ @: 0$0\00T0000'>a0,0( P @< :DЍ'^_Y^#Z_A-@`pP0S 0Q  6/P Pp@-@P%0S| |0 @Pp@-@ @6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P 0S| |0 P@pC-@4 `lMPe540"p  8PPpC 0S࠳ࠣo\p^ 0$0\@X`8pP@X@\`w80T`!C`<0@0o$0@(0$$Ф@`x0X?ZMbQ'^9_O-8SM00&@ pt Q  G[P`SߍO@  4 orf RYZ<ZZZZZZtZlZx  Bx 8 2/M&R &˱PPU@  && &[@ptp@PPTX \  &`PX \   V R x  Bx 8 2/pP  & [`&@` P@` &[@`pUY 4?Sߍ& R^ p[@&v? @ P&Rpڰvp 5 HqHp, $2/x RLL R 2/ H 2/ 00 00 ;/Gv 0 4@4/&R% &&[@ & pP&r R nWx RL R 2/ H 2/[@ `[@ @ P} Bx l  Bx g 0O-@0pP 1DM@3`h 6S0636S0606)6ᬀS 5  R !\q8 `DЍ08#8S06đ6đP0SPp  0Sp0 S5T00T06#` V@` 40@`A`X0\ 06S)ʲvW&06  q,03/@,) @00@ 4/,GPJ0P0hT00CT0 0@-@P6S@0 L0!608#86 S0\ 6X00 @ 0 0/003" /0S S/S /Su//N/0H00ǥLG-`p @0S'RP@ @P UL p0D妥!P P_o@00@0peQ<@PPPLLO-0p#MP2`12奤@0t0P D sᾤ@@0S  zЍ1 3/@LA-P@`p~P0L S0@;p|0DC0@ \ QQ 0LP  #p@00C@0P@ALL @-F 0LQ_Lp@-@x2dPS|"|"|2x" DZDV8DRDNp@ L, 0P/p"Rt"R/xLp@-`P@P @pbtR N u $ 0@Sx2| 0|2pLLp@-@P0 p@A-@Pp`  Y  QA-`pP @  0@ 0 PP@TT 0 p@-@P pO-@Qp00,MP 0 `P 0#212剣0P0`@0Sk ,Ѝ褠D  MP㗣00@0S  WRT 000ᅱ  ;/0P0 R0SPLNu/0/@-@l000@-@@[@-@ @|  L@-L܍p@-DP@n1 01  p@w   @R0S.`R0'Sg/@-8@0S Al00Q"<G-M0@P`` pn` 6ZD噳0| 0S(,0 0$ \0000 00000000`x*Ѝ"Z@-0, ($ Ѝ@-0, ($ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-<0Pp@`L夌!0 1L屌Ap@-P@ E0DP@Rp@A-`0@SP Y pPPጌX@ ` 0\HP@DpیL@a 04@SP P0T T` P LZHZdZL@-@\K P0PST T T0P LUDRH@XDŽL0M00Ѝ/O-M8p ` @mh`d!0S X!SD P!SC H!S0 00!P : 0x00 00 000 0@hPe)oPQ0 S S S S !lP @tplPq00Ѝ0000@T0Z8ZZLZ'^p@-\0P@k`4#PP H6.p  0 400 ,p$@ ` @+T00L00 ,p($@ ` @400 +<Ѝh_ Z^`)Z_x Z_0 @R/p@-P!A` ! 0RpC-aMPpᾂ@Aᕰ0p 0` k0 0000P@``000*|'PគЍl+Z@- 0S0!Q\ ^010 BS   " ď0 S 0 / \P:/p@-|0P@`T   1@PHJp V00 000P`0@ď_0 0R  0S/0 R/  0Q/@-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊑ PPU @X0 0 0 S(PI 0 0 SP +P  pW 0R  Z 1P Pp[p@- 0 BRPNP0@ ` T0Q@:T:@ #pQ p R\:p0@-S>"0000( $ #0 0A-@P`p/ 00  Q:00 ^ Q0SA P 0` `0S: 0  000 @ ``A@G-(r@P0T@`RT` P(PЍTV Fh Dh0Z* sR Q HX TT BfU 0  P  pPP 0PP  0@ 0 LU h 0 bpQ` 庚PV *0`S R0B1 08C80 00 00008C8 QHR 0ď_'^p@-@Q`P 0 d0P @pqPTp0SpPO-P0M`Q@0  EpP ` @Ѝp0 0@S0VV0p; 0-Q V Q P  P P [[90   P QPP V@  `    pR5PUP 0S(0S' RP0S000  P0SP00S 0 SQPPUVy 0Sv p0S00R0SpPUea0 S0 0 P尙QV 00 0PJP3Ppؒ_A-P@k`P p   BnP TO  fP@ 0@@T  R Q 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@3Q -  BR  \R\Q 0 Sl!0 SD 0S0S0 0 S0Q00 R Q RSR ݘ0Q `U P0P0 RPPQ AQ  0 _'_ďs_P_0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ l~0P@  pďA-@`pp R( `0PX 0 0`0d0(0 0 0P0000 0ď4Z;Z.Z4Z0S p@-@Pp0P 0p@/pp@-Q0S   Q S PpP@$XP0   uR 000P:hP`P` @TpP@ 0 00}ď_d_Џ__A-Pp`@ )EPP000q10S0@@`p@-P@0`S   00H(P}0S p@1/1M/ G-`pP 0@T UK 0 PAG3!0R"1S RP  lP P  lP 0SU P 3/P @P 0 P GG/0 f0  fA-PpS`  0S mk@1Q0 S 00 03/@P8/@h8@Q9@S 0A/0S @- /ד_ B 0P//p@-@P0@UPP :^N3A"Pp( Ep@EQ@`@@40 0 P/@-@M \ \S R   koЍ@-@P 0P P 00000 堩00SA-p@W 0S `ᢙP0P 00ộ0/G-`܀P`U-0G < 0$p+Yp 0S   0R0 0 8n03/U0S0C0k@TP_X?DZ@-@(/|G-`PI @T@G0 0~8E:뼀80S`prD (1LL0C(1HG[?@LHL 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/Hzhzlz@-@  Ѝ%ޗH020PU DPEU L0S H00P @G-,0PS`(X @P#0QWY0  XY W@0Q0  P@ 80S 3/@P 00,@S 000@-@PBP 40 0 C 90p@-P<@g 0 PR0L00p@@LHL40, 6p@-40@NP@`L0S0L00|`3P0t?P80S`P@TwWp0MI/L@LHLLLp@-4@40@P6400DL0P0p@O@Lp@-P@0P 000P 40pP X0 `d0  `d Q0`5d 5 p0@-@0P  o  900)@P  M08 ` 00@S0000ЍLEZ1_'^^X?DZ菂/A-P`p@T0S  0 0S   0R0 0 8j03/0S0C01:_/A-Pp`@Tf@P70S0@S   0R 0 0  0S0C0p( HMPu'`p0S 0 @ P 00@ @ 000j_YW T/80 R\P/40//0p@-P@PPpPpp@-0@SP  Q  2pP pp@-P@Qp`Pp 0` C p0A-@pP`P +P U00P AP U000 $FZp@-@P PP F7pO-`\MpP @T@X 0xPP3@ T #@P P0P @$QPPA RGX_ PL[@PPP7@n@P P3  ZD0S0S) MP  @P P@U D@P PD40@PU !L[^PSU+TR P(04 R0 040L0(0S  3/Y  RB@D 0\ЍP T" H0S PHP[ (0S  3/THP T@U0O-pM@M0 0(5 `(#212=0P0` P,,T T T[,PU00us,^PP00j3`V  @ @ P  @P 40LP040,0 P,00,0(0S  3/#Z(10(1 @8hSs0  ]E0 82<"嬐YV 0 VZ8he P ``0S   0R 0 0  0S0C0 ᢅ@P  JV4 @  P P  y0 00S H|7`DX  tP:LP<0S0P0$QtP 0 PP 0 H0开↓~1.(0S  3/  `P  k,50S A0#2!12Ѝ0S , ,Z @8g P000V  @ @ P Z: 8g6`T6 T T.`0__LO-`TMP|pP %30#P00S 0xPL0S P}@Tђ@P'P)4 J0P $`(HpDP0c@Q$P3lQM @  ,ǒPFA@0S 0S40;   [P4Pట TTv@P Q㰰 2$"0 2$"4 Ix0 800 $`( TЍ40< P 040Z @#!3@@-@Pp`@P0$`S- P0 ]PX0S0S;@0Sp S S $L"@P $0X\X\ (, /  X\ 0?0::SL PP $0P`H R R: `$! p7/` Fr450",p 00 gV F $ 0LTpP- EKP0P0<@K@i|!$0P000T00X0 p 0$L@Pn 0SPQ @f-@db@`@^꾿LZ x^`000SW ᯿pWPRU 01VP00H0a WVaA_ᐿ(^^Ȓ\ P/0 !8 0 0 (  , !/HzhzlzO-QM 0 ~ЍO\ Ѝ\Q|x0 0|P Qm| x |  0d  h 0l bp t0dpWWWh R   0SK GR&7YD RA| R=d ` EP 0S U d FPdP`&V4004 0oA43!"@40$0$`0 0V1 ~oF0V) P xl 0p lS tA0Q 3fh0S "S]2(0(0SX DSV <0 00 00d0Pt0嘐S, PU) p0S&W W W<PP@C<B030SB 2 030 @0 0tgP/t00t0坉P2,0,@T D@DT*᷉0000卉<@1808`V} ~oFydP PB P 0 d5/Y NYY<o0S 0 0S#P၉0W00000D000 d0%P.t R R pQAPPH0404@ ,4 Q㸐 QԐ0Pt Pt00t0PPs:<.NP 0 0 d3/dUPPXY  00/@!b fqZ(^ƀ@ĀǀgfffA-P`,k,pp@%t `P Wk0040 0(0 0E` 0@00ȒtZp@-@`(PQ $kp@*p@-@`P pp@-P@ pA-@`p80P0 0 00,@Ѝ$wZO-p`@PS pPL fP44VP( oP= 000E(P00  cU  E?p1GS ! R``B``0H0Q  FT0?Pp W(0S0P0 ЍB@)(^?_1(^A-P@`pM4 ^?  Z?2 0!0 qЍA-@PP`@pD0W H0L P0 H0L #A0 `0<0SP@0P8P0 8>2 43H@008 0 0SSY Ѝ 0C#[ Y0CS!23 U !5% !D!C aKP  03/U`0 D`0@00800L01H0H>2040 0,00131`000S0 S000 0 ,cP 0, V W 0`x 8000`400`>h03` ,1`0p02640h00x0x0??!@G(^u_Ā0@- 0E Ѝ@-? Ѝ0@-  8 Ѝ@000S/-00000 0/p@-&@0@ PM R00P w`A$1Ѝp@3p@-x P 0MS`  0S0 0 0 @T  @  0PG0Ѝp,@-l@ 0/O-M`p8PPK 405S0(L@ 940 S;000050< 0MZ0<0 ~  M M d@M`00fl0 0 00  00  kl 0 Ѝ̔7@-P`@KX0010P @P Ѝ00S 0S 00~A-@p`P@P /@-`0P P: ЍGJ GPP!ЍG|40!  $#21240 0 P 0  Q 0S (!4|3"(Ѝ5Z:400204048<0S0H/P4074040 0 0H00&0PtPT0 0H00&40740(0L0S  )^__@-`S`PR@ P$1 03/PЍpO-`0Mأp P@P 6ᬀ 6S5 J@Ѝ3 V@433 d$1 0@4/@X T06-@Ji0 0 0 Ui@>'P0! {@P  0$1 03/@~T0@ 0 8ЍO̔K_)^0_V_O-M0( $$0P0$0p@0T0H ]`PH Lh`0d 0 `0d h$$0PP 3" (YJ6 ,SJ$00  XLh004 0 004 h(,[Z Htn~0 0 H 000@T @DT)Y Z"|~ 50R( @kh@0D 0 @0D h( p{5 0 Dp {T \⓽  Q Q 44@(\ >@P #~`P! \p>~` @5 +PP【"|jWhh0l 0 h0l bh( p9Lp0 z(J~@hX0\ 0 X0\ Khx0 #448#80(0Soȹ*hP0T 0 P0T 5h`V`ZhH0L 0 H0L &ht9X0S``V (0Y SY$00 9 06 $/P` V OP40"p ` ` 8 Vp  0 0Up0  lp80Wz 00?0 08 Sgp0t 0 p0t g7X0S( p 00"0p *z,0SC Stgg(0, 0 (0, g(0Y S  Y~87X0S``V(0S Yr(p 0`Pm$1 0`6/`[ V06 00 5 OP 0 0Ŵ6(0A >gx | x |IgL0S ( p p0yȠ̐ 0 ]  p80yR PZp5 X0pSp80{Y _e80< 0 80< 00SX@P  "44X ;C R.>e@0D @0 @0D HeL̔_-/0@-(0,0@<,00S 0S 3/0000008004000 $ X R0@tꀫZTZ$Z P/@-0 HT@yG-0S@@P0  R 00S@PP "44D!;C R zp᝽`P 3 zG40S (448#8SX zG X\0S `0Sd0SP Z0 X0 jLP 4F  F0d0 䔂0O-paPd00\\M `\0Y. X@P 50("p r1  5   EZP 0? 0'#P @d0\@S300E0 <00⸠| 4E EЍ X?_䔂A-8pP`@d1!01@@A"d̔p@-\0 up^0 RP0Ƞ@,Ƞ00   ! 0 p@w 0, 04P)^_+_0 wp@-@`P< 0  p@O-<`Pl2M@0 0 00D2U5P0``3XXy`@P 4l衟< lPP q00PU:gyЍ 0 S S R 000h  z0S4pP0p Ly @$04/p y@W  z W V hz z` 0S 0 S S Rh  yy @$04/xZ@  y00P YV  hy y` 蔂Mp@-P`PUpx@@8xy @⾷ Dl0LP0pMU___p@-@0@TpP PȀ` €p蔂O-$P2M@0p@ 0/!>540@P吢H0 0@X0xT DdP< d~`PH00`VMxU 0bh@Sw Yt  $09/ SyЍ 0 X S R 000h  ,*y0SDT0 ox $09/BxY  ,*yY U h"y , P 00T@@@ppe_G-P0M`0 0` @p=0 P 00 0 0 p@?o2P0S 0 S$  Q0Ѝ3 0O-DM(0 0P`! 2 ,`0800P$  @80 <00!1 0<0 (`,P$  z 0'!0tqt< (`0 0 ,P$  pd 0!80 (`,P$  pS0 00!08 00 (`0 0,P$ >'(` `08! 0 ,P $  p`* 0 ,00 ! 0 0P($ DЍ辙_[__Zz_3}_@- R0R0 &*R#,ZZZZZZZZ,ZZ ZZ,ZZZZZZZZ,Z\" \ 00SZ `\ \ `00SH00S0 80Q L\00S R0 Rp@-0@P&* R#ZZZZ8ZZZZZZaP@D T00SpT T,P X0P0 SpSp$00S000S 0 /@- tt`p@ lh` `\` T P` HD` 88`ZC&_Z;_Z;_Z;_HZ;_pZ<_@-0@`` ```@`P@- P0@ P@ dd d0 0X A@P HxlЍ0AA@P klZ_z___@- B 0RS d00S Q PQ @+_P ,,0HAPЍ0__@-B B  \03< x00S @_P PP0APЍ$00S ^o@0__ 0O-`Pp@DM(028 0p0 0`,P$  80<<042 0p0 ,`(P$  '~ 0쑟_?@P (k6_k_8_0Z;_Z;_›_@- 0 @P Ѝe__C-MP00`0p0 0` @:0 P 00 000 0@?o2P0S 0 0 R S00 ЍP C-MP00`0p0 0` @w:0 P 00 000 0@\?o2P0S 0 0 R S 00 ЍP /0@-M @)aP  pp0?P TP0S 0S \PЍ0\0P궙__DA- BM 00S Q Q# Q ЍPሀuU ``ScV @\TPAy\TQs\UD@- $$^ @ ^ZC&_D@P @Ki 88 (00=@P @ЍX_G_,_a_///0S/!  @-@A00A-@`PpW0PV0SASW 0003s0#0S0  " \ Rp@-#10lS0! @. TBopPP P. /0S/p@-0@S`P `UFUp z8 $00#00p@ l8 #00#00~PE@-@0M 0@# Z#Z ZnZ ZP >P Z#Z ZYZ ZSZ Z w>P ߍ Z#Z ZiP & ZcP  Z/Z{ Z{\ S>P Z#Zl ZHP & ZBP Z^ Z ZX ZX 0>P Zi#ZI Z%P ZA ZA x>P ZQ#Z1 ZZ+ ZPZ# Z# =P Z4#Z ZPx & ZPr  ZPlZ Z =P` Z#Z ZPU & ZPO Z ZPG Z Z =P; Z"Z Z =P+ Z"Z ZjZ Zd =P Z"Z ZP & Z}P  Z s=P Z"Z ZZ Z ^=P Z"Zw ZwZq ZZk Zk @C=P 0^0^ 1^1^,1^<1^L1^\1^l1^|1^1^1^1^ P0C /@-P, 0C C-Q`@PLM 0 6/|0 p10 0萟耟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ 6/  00\H0 00A00A 6/_^^P/Q //  00  00  00  00$  (00,  0004  80<0/@-@M@P @ !C-PXp@DMp P` 0@DS DЍ@`%M@ WpO-0Pp@<4U 0 i I3il8`Y`( ZU0D0 ЍIP\80S   U@IyU@DDAD@\ZU@DDAD@P C-\MpT@T @DT00\Ѝ``HPP@LP000//o/00//p@-@M P@`@`L@T@@L@T*@Ѝp@-@M@@`PpaP(00 0 Ѝ@-O 000ЍG-@XM`@@`P>p@@@DT00XЍ P@ FLPPU @Dt@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP9T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 01dPEU 0 R/R 01^0R/@-0CA @R A@BT R LP^@- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @@-000 0@0 ! 0#2 /UUUU3333 @-// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00c/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?@- ^ S@-0o @-@oQPO-(p@@@, P`T @.`VPW:/@P WRQp@-@@P@T@ P`Q@d.PPPpQPp@-``` P@T.@T`PpQPA-`` p@PB.W PU`@@@-0 0(0000 0P 0@Ѝ[@-0 0(0000 0P 0@Ѝ[@-$0000 0vP Ѝ[O-pP.` UH@P Z 0 21@ Ѝ 0)10 $1  ;HQ p@-8R@P$3U @2C AQ   0 0#01R,# p 0 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,J0 0##Ƞ#\#40Q <1̌ .0#,B/1^0A-@R0@P0`?S  S *S R :[S0^\PP^1(R$#R& `0Sp0 R0 P P P`0SW pЍp]^ S -^ pQ[W 0]S RW00P0B?o2^Lo  S0p@- "!A0 P#.. "P!Q" Q Q00#&" p`04`@N8<#<# "^@E!10@("$"[@-@  /Ѝ@-@P $/@ ( 0"Q^O-@0$M(`00p 00P0$00D2 0@00  k/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0R^0 : #R?0V FA#E@P7@-@P + !? 7R8 bx b8   X  Ѝ0@"V^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  D! Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T\-M Ѝp@-@ P` !LN! !@ApA-`PP#*p @P P  NPP 30PPW` *P$`)PV@-MP@@@`@pT:Ѝ Pp0P00 E__00yara0tcid 0 꼭 0 꼭yara 0 꼭tcid\ 0/\ 0/yara\ 0/tcid0S 0 w/Ἥ0S 0 l/Ἥyara0S 0 `/Ἥtcid@-0p3Al+`P @ O0*.P 0@PP yN@P0(ᆋ Ѝ /p@-@9Pf)0PPptcidp@-@-PZ) 0Ppploob@-@@ @-@@ @-@@, @-@ @C @-@@Z @-@@f @-@@a @-@@\ @-@@W @-@@R @-@@M @-@@` @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-@P((0P pP pgntsp@-@`P(@0P pP TpatadA-pzP(X0P `Ꮚ@P  P @ᡊgntsp@-@RP P/(pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P3 p@p@-@PI p@!P0/dV^^@-ZZ@@P\DTPP P" P; P\ÀP0 P P\(:P0P0P 0P 0 P@\0 0 P@ :\0:`0` SP$0 S 57$00$0/@-(0$ @ BR00C#$0$0,0(0@-@$ P *  L QP$00$0Ѝ  p@-PQp, @Rp$0( 0CQp$ >!Pp00@-S@ @$0,,0<000G-@P8MeY@ , `0a0000P SF SF Sl40 0 YPP`P@pWK FW Z:W =W *W # i@ Q l ` $0SR00#  C R00  R00  CT$@8Ѝd3`3 S R 0C# 0   Q b@0S00S > #@ 0  0 SbW fW ?R0@SQ(0?S R  P  c5S CP2QPm C0  PU "q  ?Rw0@St` b6b` B@S8a8  C# c,1 c0 0FWP;  0  Y=  0 fP0U0@  0R< XS,=W 0  Q  @U& 0S# Y @0  0S  0 P  @v $0S&R00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` rRPp-@-@`P fRP@ Ѝ/p@-@P EYRPp-@-@`P MRP@ Ѝ/A-@`Pp >RP-@-@`P 1RP@ Ѝ/00/0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-P0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;04 8T`. 00" <0," @" Dp" HP"$ L@"P(  ", !X0#\`&`+d*h(lp'pP%t@$x "|)0#`&+*(p'P%@$ ")0#`&+а*(p'P%@$ ")᫿ +! ! +$ό, ό. . ,᢯*p0?0#`P@$pP% ` /`&pP_pPXP\` "P!`+q~Q^D`XP@P`,\pP.s%}S&]P``PpdpP% ``&u%{U&[`PP`,pP.wxWX`PP`*pP"zuZU$`@P P`*DpP"~%r^&R`P0Pdp`!4P&~P+r%^RP`Pp`% Pp,P%yvYVPHPp$`"LPtምP*{T[P`PppP% ``&q%Q&_`QPqp$P#g%iW'Y(pp#৒}rpp崐!p娛p+{tppȐ"p(p*'t|ᤀpp$p#'t(|ᄐppph "tp.l*|s,#,੪ሥᨊቅ .),( 娀!଀+ !)x #|媼 $ᩜና帐< .༐ ,஑ጞΌP0#T@$#:$68@P0 1. @ @$.$JA@@D 0$000.0@0@D010$0 10.0 1@$1@00$ 0D00.$0 1$@00$(00.,0PX0@\0 `00$00d00.40X0@0\P00$80 0.<00@0X00$@0\00.D0`0 @d0 00$H000.L0P`00d 0#P0 0*T00,0X0 0#\00,0`0 0#d000 ,h 00#l00 "0p 00#t0 0 0 "0#x |0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 00  0#000"0 1 10 " !0#0!0 00 " 0#0 1 10 " !0#0!1 10 " 0#0!0 00 " ! 0#00  "$0# , !1Sw000 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|0000000000000000000000000000000000000PKߍV^W^-@-(00SL ЍЍ/Z@-@ / ?!BC @p@-P(?@P !0P0 0ppW^00@-@0 0 h8A`F000S DЍ0$wTP p`dA-P`0pS 5@P ` ptlgT` |!PO߃<@@ C҃ĭo[`dp@- @  pW^P 0R @-0,QSho//ᙶ^p@-` @P"P "P p@"p 0S " W^HA-pD@P 6P``P!@B` P-@- p$0 0J@P Ѝ@Ѝ/`@PP  $00J R^@-@@ Ep@-@P@p X0R0 PP  0Q p@%W^^p@-@P L0R PP (0Q p@ pW^^P/ 0R /W^P/ ,0R0/0P//W^^\ ?o@-L2^0S0  Q 0Q0 /W^^P/ 0R/W^p@-@PPp 40R ♂PP 0Q}W^^P/ 0R0P//W^^A-@PЍPo0 RQ R0 ` 0`epP  H0R Q0 , I `pPnW^^"e^A-@PЍ 0R0 p 0P6`P 0< S0p, I P`PBW^^"e^0P @-?o42 ^0S0 S@s /W^P/ 00R@- 0Po/W^^P ?oH 2\0S 0S0QS/W^^fP 0R0P/W^^f@-(0pSM W`@V `0P ⴁPP 00 0P S Ѝ`0S 0 "R00   CPm_P 0 0#/@-0 S RS R RP/$0S @-3@始̭xy[x@-! (M@ d  `0P\   H DN P(ЍP l }__*_W^p@- @PS`>px@- @ ` hx X^ 00 S  \: P03#/S  \ P0///p@-P0S 3,2@P dan<@P tTLPP z4M0=@pV@̭y[x|X^@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@HX^ /P/ 0R" 0 !SR* R0:/@-0  ^: P*0  S :/@/ //@ X^P 0R//X^P 0R//X^P/ X0R0  S *<C<0/  \ ://X^P/ X0R0   S *8C80/ɓ \ ://X^P/ \0R!  R0 * /@-0 ^08 /X^P/ \0R!  R0 * /@-0 ^08 /X^P/ 00R!  S //X^yP/ L0R0   S *00/ S ://X^P/ P0R0  S *8#80/S ://X^P/ 40R ! \0# %//X^P/ 40R ! \0# %//X^P/ 40R !   /S//X^0P @-?o42 ^0S0 S@/X^P/@\   JQ\//X^P/D\  Q/S/Q\//X^@-@pMPW  ``0S$(0S!0+ C 00 0S0xSW  000000SЍ  wPꂠ_0BR"SO-G@`0P pE UWpp-UPp` +UP`00UE00XS 0 A B0C QRP@`T@@Ŀ 0  000E ^aE\WEAE\ 7E T0S0:0QP00\00S 0!0PT@ @0 pY ЍY S FHX^_0BR"SO-``tG@`0P pE UWpp-UPp` +UP`00UK00XS 0 A B0C QRP@`T@@ğW 09 p 0 j 0h000E Xa0ESW0EA0ES>70ET;W% P=Q PPS^3 .QPT@ @6 0  0 \Q PPS^ .[ ^F Ѝ[QX^_H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@`pPS2U @R'SP U @0C @g@OoU0@d08D/o?o0CS c"U@SB BU  V 0f0?o c0B0C8/oo@p !1 Q  a4Π81@0 @V@TΏPO0QU  @@a4.Ό8?o/o0CS 0  0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/Q3 /p@-M@NP PPP$PPP(P0fS^ "S4 [S. + Ch 00C S9dtS3 {S]1S/  P3/P0 0 P0 ?`PT PU 0S  ` H1000"S0(0 10rS PP0 P$ލp0uS0eS 0  00( 0aS0lS0sS0eS 0+0Cd0 0`P6/0 0`0 6/Pm 00[[w[[H[Q@- o/@-IM@pQ`V P0P P Iߍ 0P PP 0P5/0 0P0 5/P 00  0p3/P 0 0p0 P `\X^A-`Q@Pp p0<S 0S !S0-S0E?o 2-R0SP/S8PEU0SP ,P 0B0S*\30HV0 S bP0/S0(0U0(00>S0>S000 0$0P>R/R R0S 0S  0 A R^"C "R R0  0 "Q 0@$00>Sy=Q QrQoO-0S` 0p@P0S "S \S0@0%uP mP bP /P \P "P n@Pꬔ[ [ [ [[ [[Ĕ[fP 0000@V 0c XPU 0 0 0 P ;8#8 S:0Z Z 0͕x S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 PUcYPW@ Ѝ0S <SK &S@ aQmQ#pQd;Qa@V X\0 lQ gQ0tSR0;SO>0@0tSI0;SF<0@pQA0oS>0sS;0;S8'0@qQ30uS00oS-0tS*0;S'"0@Y G-`WpWU P fP 0>SSS0 P0S 0SPP4Py$S0S EP  ?PP P PPjyP(0SP 0p P V` P PP   Pꧠ____7_x RC/A 0\R#R! R/Ao/0 P R   //p@-`P xPP@p\4@P y<4@P P(u0 P`000ꀗX^ap$0S @-*@ԭp[@- @   耗X^G-@pP`VU@ 0@焑uPU@ `F¦`@-@@|p@-P@@sPppp@-PP T0Rvx@P@p,00$00 0P00 0X^[̢[ X^0 0C0s@-@P 0U S lxl5Ѝp1PP`P 0 0SPP0 0C0PPꀗA-` pP&x@P W @` !* @`4xC-P0pS`@M>0}S "S x00Ѝ000"S 00  0>P 00S80"S0:S@@0 P  {P 0 P ,0Sw0h P ,0S(0S  ,ZP TP[i^Ҡ_p@-@P `\0 R@VP! PPPV @pkX^O-P0p@S쁟0SY ЍO nP@K ЍWP `P 00 0;P> U LL0 S 3 P0R $P [  0P 0S& P 0  03/P  0R1#P Ps 00C 0P ,7@P S^X^X^U_0,S<S"4ꈘxh@-@ tp@-P@Pl 0 0 0p@軩G-@P 0R@ pUPP`ᥩ@ 0冡ᆁ!b ` 0冁 0` 00V:000X^0P ,0R@-P000/X^p@-@P000p@mp@-@P ,0R@P @^pX^p@-@P L0R@P`0S@#*+@DpX^p@-@P@6pA-@P x0RPϨp0S `VP 0J`P pX^p@-@P @0R@ P`᫨ v@pX^ P /o00"\ RP0\`/X^O-@Pi pt2 R0~  /PP @p@L0S ' !PP S0Q=P8u/E P,U<UU xE1P` hV  @P 4PP O".PU@x Ѝ:` V P 0p000000 H P [K !E 0P0 F@ B! 8 0 P 0 0@X^ԭ[ptxh Y^G- p`WP`u 00@ >PPu0S0,S  0 G 0P @-?o<2 ^0S0P S@/X^@-@P+ 0R'P`㑧0 ?P 0 0 B! 00C0000 Ѝ@ŧ ЍX^0P/?o( 2\0S/0P S/X^0P @-?o42 ^0S0 S@/X^P/ 0R/ Y^0P @-?o42 ^0S0 S@/ Y^PG-@6 @`TPp P*  0 S @a_  S 000 01 0 01 $0 0P@ @0SA-pP`x@P (Q@>t0P@ A/X^p@-P(/@P 0P0 0pX\Y^P 0RR @-po//0Sb G- 0PSGtW h@PR  pPWW(G0$ 0"!00 Pa#R<`P%c?P6 0HP0 `0BP* P0<P$ pGP唀W%10``/P R0P&RP0&P Wa<`=0P =P/|Y^\Y^@-@0P s0XO-Pp @`QU A R<QYm L[" =QX ,PC Y ꐰ[[[([U T8*@U0 W- @ " @U0 W @ ! @U T*0@00@0`<S S CR=S Q"0S 0CSR30 R Y Y( 0<S@(0@SY^A-p`PV@PrPP  P `PQp@-@@0PPrP`r@P0p  0P @ PQPp@-@PP@PP @p@-@P H0R00S f @P000@\Y^P/ 0R /\Y^P/ 0R/\Y^\ ?o@-H 2^0S0 RRQ 0 /\Y^p@-@P <0R Pp P frPP q \Y^0P @-?o42 ^0S0 S@/\Y^P/@-@@T ?o 2^0So\Y^A-0S6 (P@U2pP& 08!P( $0S%  h$ 00 R`rPP 00  0tP r 0iPЍ 0V dP V rPP PqP `_^^/P/?o4 2\0S0SP//Y^p@-P00S $# @U 0D@fpܭ[Tp@-,@,PV0 0QpHY^ R0A Z^@-@P 0R@@Y^P/ 0R/Y^0P @-?o42 ^0S0 S@/Y^0S(0S @-0@ /Z^00C0/0 P R   //A-`P 9qPP@d,@PKqD,@P P4pp䲣0 P`000`(Z^@-@@PG-@" @`TPp P* ᔣ ᑣ0 SS 000 0! 0 0!@$0  { @̣ʣ@p@-P@@iPợpp@-PP T0Rp@P@p,00$00k0P00 0(Z^غ[<[G-`0@S,90SዣG P@~P PP 00 0 /pP  00C 0hP l@_P0 03/P  0R 1#[PS^HZ^s@-P@ T R jp`-ЍpADAP`@ 0 0QP@00C0@@`A-` pP'p@P W @` !+ @`5p@-0`SP@p0]S @0 @P  Ѝ P 000$ FP ,0S([_0 /p@-P0@Q  0 Q000pPpp@-P@PP 0 0 0p@蟢onA-@P x0R@ 9`PP` ቢ@ 0qI 0q`0V:000(Z^@-P000p@-@P ,0R@P @ap(Z^p@-@P ,0R@P@Op(Z^p@-@P L0R@P`0S@#*@5p(Z^p@-@Pաp@'pp@-@Pȡ000p@p@-@Pỡ@@@ pp@-@P @0R@ P`㧡0S 0@Ap(Z^A-@P `0 R@pP㏡0@0S@١ 0 0a000 @(Z^p@-@P <0R@ P`e@ᶡp(Z^A-`pVP @Pn l 00g 0S]0,S00 AA-@P 0RPp,0 0a Az 0!1 0S0C0000kA1 (Z^0P @-?o42 ^0S0 S@ /(Z^ 0Sp@-P`@P (0S p@:p/HZ^0@-!00!!1Q100 000000 0#0, 0# 00!R0Q000 00 0 00R0000!00p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0r!000p@i000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG-P`0pX@S\@ @!  A@@ @H :/0P ?! Q@ \  !    A@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/@-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!0000\ !0000000T   " 0S`   T" qW qW2 8 T&aa..1000T0\00RqaaT  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-4@`0P pE UWpp-UPp` +UP`00U400XS 0 A B0C QRP@`T@@i^ 00E \a0ESW0EA0ES70ET P  S  R 0 PT@ @  X`FXRdZ^_  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/9  0RR! R/P/0@ 0A0S,*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//6A-M Wp @00S 3/P0`;P V 6/0p cPލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0 `` Q-0 @0  4/@P T p0  P$ 00 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@I@ap@-@ PQ aPp0< 0 Ppp@-P@AQpPpA-0@APS`B DaDqDQ? <Q? >QC &QC: TT0DS[[[X[[[f@\P /T \T "T T0 ( P Ѝr@t@b@n@@TP___ _p@-@P 0Sp sPpPQ@-@@ g|Pp@-0`SQ p0p<@PSPpaP U>D @P QPp@-0PSQ E0p<@)Pp/!P 2P >p@-0PS`Q@p@P QQ p@P<P@P /P >A-`PPQPP0p 0SPUa`@P  \`Pu`<WP0 Pp 0 03/P P 0S PP|PP`PM`T T6P P(VP PlZ^!_[^p@-@P` n*Ppp@-@P c*Ppp@-@P`E X*Pp@-()/_011/A-@pP`P _Pp` P102 P @-@\& P QRS  T00_LQ R S "  T  00 A- % M222aWV&6z "*t0n\h\C=,b chfmإ5sXd+A,TwX뗪@fja^0!냏cI49< 3Q% 30S#* :3#Q% 53#Q% 5Q *cvML&;~|jt Kze냤?ffqbfz0  v08S(N&x`6| O`RR 3R u@00@0!HU pj2p K,|8]@0e~x}egg@s$0\"  000P@P8<4it Rif>cʳ[\LBrT^P'TF1%h1@T(2i@⛻U V 1 @10dx1U P. l'%0 000rs/h!( A0( ?A3c01|pWh@X 0Xq0AD 0gUPXh00@hķo|>D?,/@? N'3 7_̀<\P7_Ӏ,M)7_Mb@ӀX]1_OH7_X7_4W`7_@ 0A @ 0H @ P `@ p @ p@ @ zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846>@,>@8>@P>@h>@>@>@>@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ \ \ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    Ac@f__@`@a@a@Db@ēR4c@Sc@Rlsllsrasrror e^f^f^^f^^f^^@ f^$f^P'f^$f^`+f^^_M/f^3f^P 9f^=f^Af^_@ Ef^Jf^P Mf^Jf^Rf^Wf^ [f^Wf^_f^Wf^ df^Wf^hf^mf^pf^mf^tf^yf^|f^yf^f^yf^f^yf^pPf^f^f^f^pf^f^pPf^f^q^^^q^^^p f^f^p 0f^f^p `f^f^p pf^f^P 4_f^P f^f^P @f^f^P Pf^f^- G^%f^f^%f^ f^f^f^f^f^f^f^f^ k^k^ f^k^f^f^f^f^f^f^0 f^b^00g^b^00g^b^00g^b^g^b^g^b^g^b^$g^b^*g^b^/g^b^ 5g^^ 9g^^ ?g^^ Cg^^ Gg^^ Kg^Og^Rg^qf^Rg^f^ Vg^Zg^ Vg^^g^/bg^7f^oeg^f^0/Af^7f^p ig^j^ng^sg^@vg^sg^{g^g^@g^g^g^^g^^g^^g^^g^g^g^g^g^g^g^g^ ^g^ h^g^ @i^g^ `&g^g^ /5_g^ g^g^ g^g^ g^g^ i^g^ 0g^g^ P^g^ pg^g^ h^g^ g^g^ z^g^ g^g^_g^ g^g^g^h^h^h^ h^h^h^h^h^h^"h^h^ &h^h^0*h^h^@.h^h^P2h^h^`6h^h^p:h^h^>h^h^Bh^h^Fh^h^Jh^h^Nh^h^Rh^h^Xh^\h^ah^\h^ eh^\h^0ih^\h^@mh^\h^Pk_\h^`qh^\h^p._\h^uh^\h^yh^\h^}h^\h^h^\h^h^\h^h^\h^h^\h^ h^h^ h^h^^h^h^h^ h^Pg^0S_Pg^@h^Pg^Ph^Pg^h^h^g^h^h^h^h^h^h^h^h^h^ h^h^0h^h^h^h^h^h^ h^h^0h^h^h^h^i^h^i^h^ i^h^i^h^i^h^i^h^eqnecsccmiplvsvchilsgeltgtlenv^^e^e^^^e^e^^^e^e^^^e_^0.01.02.03.04.05.00.510.0daiadbibedeafdfafafdeaedsdeppmz\m@dm@T_bus_dma_busaddr_to_paddr_bus_dmamap_syncq^T%\2VAIq^T%\2AVAr^T%\3VA#r^T%\3 VA*r^T%\3pA1r^T%\3qA8r^T%\3qA?r^T%\3qAGr^T%\3qAOr^T%\3AYr^T%\4D `r^$\4D gr^$\4i or^T$\4`Rfwr^T%\4 i }r^$\4qAr^T%\4TrAr^T%\4TtAr^T%\4TtAr^T%\4TAr^T%\4T Ar^T%\4TAr^T%\4TPTr^T%\4T`A r^T%\5TE`A r^T%\5TE`A r^T%\5TE%V r^T%\5TEWV s^T%\5TE is^#\5TE $is^#\5TE0$i,s^#\5TE ,is^#\5TE0,i,s^#\5TE .i:s^T#\5TE0.iHs^T#\5TEAiVs^"\5TE!i]s^#\5TE !ids^#\5TE)i]s^#\5TE )ids^#\5TE-iks^"\5TE -ids^#\5TEAivs^T"\5TEAis^T"\5TEAis^T"\5TEA s^T%\5TE A s^T%\5TE`A s^T%\5TEJ`A s^%\5TEJ`As^%\6J`As^%\6J`As^%\6ZK As^T%\6KPAt^%\7ApAt^%\7AA t^%\7A/A-t^%\7A?A:t^%\7AAGt^%\7A/ATt^%\7A?Aat^%\7AOAnt^%\7AA{t^%\7A/At^%\7A?At^%\7AOAt^%\7AAt^%\7A@At^%\8A0At^%\8ApAt^%\8ApAt^%\8AAt^%\8AXV u^T%\`A u^T%\XV u^T%\?A u^T%\@XVu^T%\ Au^T%\@X/Vu^T%\}_.q^*q^3q^:q^Iq^Eq^Rq^Nq^[q^Wq^dq^`q^qq^mq^vq^q^q^q^q^q^q^q^q^q^q^q^q^q^q^q^q^q^r^ r^r^,u^3u^9u^?u^Eu^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^u^u^u^u^u^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^u^3u^9u^u^Eu^u^u^Wu^]u^cu^iu^pu^wu^~u^u^u^u^u^u^u^u^u^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^u^3u^9u^?u^Eu^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^u^u^9u^?u^Eu^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^u^u^u^u^u^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^u^u^9u^u^ v^v^2v^Cv^]u^cu^iu^pu^wu^~u^u^u^u^3u^9u^?u^u^u^u^Tv^]v^fv^iu^pu^wu^~u^u^u^u^ov^vv^?u^Eu^Ku^Qu^Wu^}v^v^v^wu^~u^u^u^u^v^v^v^v^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^v^v^v^v^v^v^v^v^v^v^v^v^v^v^v^v^u^3u^9u^?u^Eu^Ku^Qu^Wu^]u^cu^iu^pu^wu^~u^u^u^@y^T@y^@z^T@z^H@+z^Hz^H@^z^{z^H@z^z^H@z^z^H@z^{^H@*{^J{^data_abort_handlerbadaddr_read@````` ```pmap_map_chunk ERROR TIMEOU DFwd_flushcachewd_trim^Մ^E^U^l^y^^^^3^E^U^l^y^^^HKAJAPA_A8cA^AP^AS\wd_setcache^^^PALAHKAJAxIAxLAEABACAVAwd_standbyHKAJAd_A$_A_AēRUSHPP^AS\$iAtALhAqAgAHgAجCCCA@gA8gATAatastartata_thread_runatabus_threadXA،ARRTAēRUSHPR #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ Y^ag^Px^~^ ,^@P d' #(-27<FPAA^^pxa2x0_i2c_intr_sub|ByB`^p^^yBzBRRBēR<{BS{BR58\7\56\5\=8\7\=6\5\V,5\ 4\V3\2\^^D2\81\^^p^0\/\P\/\P.\^_^-\,\t,\h+\%  8  @!!@! ! #/ ''w0 g'' c0c ^^p^HT^^z^^zا^ߧ^ ا^ߧ^ ^^^^^^^ ^@^^@9^@^9^G^^s^^^l^^^p^H^^p^^^^^^@IeII^è^I0I0E^˨^֨^ܨ^@&II  I^^^^@"I0^^U^-/^^^0^^C^^W^^k^^^^^^^^ĩ^^ک^^^^")^^uE o@o @o @^4^=^@^P^^^p^@& 3BI@T^]^ @(#0^^TB ^-^_/^2'E9^@^G^J^b^{^^^ ^^^^^^@^^^^^^^^ ^8^?^VVwh^[^^o^^^^^^^^^¬^ˬ^P8soo P q q sMklt^^tt3^^ hC ^^ h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~BBBXBBB(BB0BBXBBXBB`BBBXB|Bhey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 ]]_] ]]0`] ^]a]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./A D^expand 32-byte k^ D D,DD0 D%D D@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&\z]z]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q\z]y]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHz]z]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHz]z]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@z]y]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decap^DDDDDPDȊD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^DDD(D,DDTDieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update^^^^^^^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupb^.Ft8F`7F8FCFEEh]FtGEE,]GF EE$]FHFFpnFEEh]CZEEh]xZ)CZEEh]xZsCZEEh]xZCܥEEEh]lEE`ECpnFEEh]sF     }E#(D(@AAA==A*ip_outputnFnFmFPrFlFqFDpFTsFsFmFmFlFrF$sFlFlFxFlFrFtcp_outputsyn_cache_respond @@@@@@@GGGG?GNG0FGLBGGhDG,EGNGOGFG'G0G4FG8FG@GAG AGFGGGPTGRGVGtRGQGpTGRGTG@SGQGYGLYGTGdVG|XG""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwGxGDGGG܅G,GGG4GtGG@GpGGGXGTG0GA_|G^G^G^_G^G^Gicmp6_reflecticmp6_redirect_input_icmp6_inputicmp6_errorin6_get_llsol_addrin6_update_ifa1in6_join_mcastgroupsin6_if_link_upin6_if_link_downin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocal)uHGGG:CG,\H(\H]dGuI$\H \HX]lI\F\H\H$][HHFFQI,\H[H]<G+`I,GCZ[H[H]xZ)CZ[H[H]xZsCZ,\H[H]xZgCH[H]HCQI[H]0PIip6_inputip6_get_prevhdrip6_nexthdr(@AAA==(A*ip6_outputnd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startnd6_rtr_cache`ILIdJINILI,MI@NIlJILILIXLIJIDLI0LIJIJI]I KILIsa6_recoverscopein6_setscope__l_}_}_c^}_}_h^}_}_}_}_}_u^udp6_outputdjItlI0gIjI,iIkIiIkILlIjIgI8gIgIgI@gIHgI|IgI4iIAI`^i_LIIRR`IēRUSHPRAI_A I}_AXI_     !A  !@@@@_ _/_R_u__ _ _ _ ,_;O_.r_____!_4G_l__5_6_ _ _ A_ <^_ ?{_ ,_ -_ _ _ &_ =M_ :j_ _ _"_6_$ _: _ ^ _8 _P _##   1 @tII,ItII,ItI I,ItIxI,I 22     * #hhu hhh _III _ _ 7 _V _0III _ILIIU _U _U2 _U3 _U1$ _I III _U5I _IIIIII x _{  _IIIIII? _^ _} _ _ _0III} _}) _}K _ILIIILIIvs _v _v _v _v _v _n`s _IDIIX9J_III4IIIxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zeroH J,,J J( JT%JJJJ J(JR_0J0J01J43J3Jx3Jwsemul_vt100_output_c0c1@JL:J4J5J9J8J(6J5J ?J8J5J8?J_EJDJ;JDZJ7J@Jt@J@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!___ _&_,_2_8_>_D_J_P_V_\_h_b_b_h_n_t____ ___________wsevent_copyout_events`J]JpJqJ4fJRoJēRfJSgJRABCDEFGHIJKLMNOPQRSTUVWXYZJJDJRJēRJSJRrasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?*&8+&*&]]o]o]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]A]aS])]2]]]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠPXJ JTF\JPJPNJRRxJCEJSTJNMJTJCLJ0PLJ0RE`J@RRxJCEJSTJSLJRRxJCEJSTJERJCEJSTJX]]]AJ_]L^0YW ^X ^0\X ^0\XT^0\X, ^0\XH ^0\X(^0\XD^0\X`^0\X^0\X^0\X^0\X^0\X$^0\X@^0\X\^0\Xx^0\X^0\X^0\X^0\X^0\X^0\X ^0\X^0\X^0\X8^0\Xp^X^0\Xd ^0\X ^8K ^X ^K ^K ^0\X ^0\X|^X^0\X<^JX^Jt^X^X^0\X^K^ X ^l$W]L^0YW ^X ^0X ^XT^X, ^XH ^pX(^XD^pX`^X^XX^X^X^4X$^X@^X\^Xx^X^X^X^X^X^X ^X^XX^,X^X8^Xp^xX^ܰXd ^X ^8K ^X ^K ^K ^X ^(X|^X^X<^JX^Jt^X^X^K^ X ^l$W]L^0YW ^TX ^J ^X, ^XH ^Xd ^X ^8K ^X ^K ^K ^ K ^X(^XD^X|^X`^X^X^X^DX^X$^X@^X\^Xx^X^X^X^X^(K^D K ^X<^JX^Jt^X^X^J^K^K^ X^K8^X ^l$Wp^xX^ܰX???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ蘸%K%KX$%K(X,%K XupdatefatsZKXKYKXKPYK,\K YKXK\ZK ZKU4]AdK&_. .. <]L^0YW ^TX ^EK ^K, ^XH ^Xd ^K ^xK ^X ^HK ^rK ^wK ^lyK(^XD^X|^X`^X^X^X^X^DX^,K$^X@^0}K\^Xx^l_K^ȏK^}K^X^lK^X ^X<^d/KX^-Kt^X^X^uK^H~K^hK^ X^K8^K ^l$Wp^xX^ܰXAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z KxK KKnfs_sillyworker,KXKK X @]]]]]t]`]F]*]]]]]]x]V]B],] ]] ]] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  ]]]A@L_8]L^0YW ^X ^0\X ^0\XT^0\X, ^0\XH ^0\X(^0\XD^0\X`^0\X^0\X^0\X^0\X^0\X$^0\X@^0\X\^0\Xx^0\X^0\X^0\X^0\X^0\X^0\X ^0\X^0\X^0\X8^0\Xp^X^0\Xd ^8L ^|L ^X ^WL ^КL ^xL ^PxL|^X^@M<^KX^XKt^X^d|L^0\X^{L^ X ^X<]L^0YW ^X ^0X ^XT^X, ^XH ^pX(^XD^pX`^X^XX^X^X^4X$^X@^X\^Xx^X^X^X^X^X^X ^X^XX^,X^X8^Xp^xX^ܰXd ^L ^|L ^X ^WL ^КL ^lwL ^wL|^X^X<^KX^XKt^X^d|L^{L^ X ^l$W@]L^0YW ^TX ^iL ^L, ^xLH ^WLd ^@M ^t}L ^X ^WL ^КL ^vL ^hK(^XD^X|^X`^X^X^K^X^DX^@M$^X@^6M\^xLx^P8M^!M^cL^ M^yL^vL ^X<^KX^XKt^X^d|L^VL^{L^{L^ X^L8^{L ^Xp^hK^ܰXffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snapffs_isblockffs_isfreeblockffs_clrblockffs_setblock]]]]        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?+NPN(XTN Xffs_newvnodeffs_reloadMdMȹMMM!N(&N ffs_synct]]]AM&_'_T]L^0YW ^X ^0\X ^0\XT^0\X, ^0\XH ^0\X(^0\XD^0\X`^0\X^0\X^0\X^0\X^0\X$^0\X@^0\X\^0\Xx^0\X^0\X^0\X^0\X^0\X^0\X ^0\X^0\X^0\X8^0\Xp^X^0\Xd ^`N ^|X ^iN ^jN ^lN ^N ^,N|^X^X)N<^DNX^$!Nt^X^X^?N^M^@N^ X^ȂN ^l$WP^M^ M^pM^(M4^XMl^xM^X^X^XX]L^0YW ^X ^0X ^XT^X, ^XH ^pX(^XD^pX`^X^XX^X^X^4X$^X@^X\^Xx^X^X^X^X^X^X ^X^XX^,X^X8^Xp^xX^ܰXd ^N ^|X ^iN ^jN ^lN ^N ^PN|^X^ N<^DNX^$!Nt^X^X^@N^ X ^l$WP^M^ M^pM^(M4^XMl^xM^X^X^X\|]L^0YW ^TX ^ JN ^hhNT^tN, ^hNH ^ iNd ^DiN ^|X ^iN ^jN ^lN ^$N ^PN(^XD^X`^X|^X^X^X^X^DX^X)N$^X@^lrN\^ sNx^(dN^uN^xN^hN^|zN^}N ^X<^DNX^$!Nt^X^X^?N^~N^@N^ X^ȂN8^N ^l$Wp^xX^ܰXP^M^ M^pM^(M4^XMl^xM^X^X^XX]A$/N_&_h`]L^0YW ^TX ^X ^X, ^XH ^2Nd ^5N ^X ^X ^X ^X ^X ^X(^XD^X`^X^X^X^X^X$^X@^X\^Xx^X^X^X^X^X^X ^X<^T3NX^3Nt^X^X^2N^4N^$3N^ X^X8^X ^l$W^LXufs_inactiveufs_dircompactufs_dirgrowtZNZN[Nt[N[N\N[N\NxbN4bNAfN'_ ...TēR >TS@TRpr_phinpage_checkpr_rmpagepool_initpr_item_linkedlist_getpool_do_putpr_item_bitmap_indexpr_item_bitmap_put0123456789abcdef0123456789ABCDEF|/-\PTLTvmem_rehash_startTTU TTU0TTAUr_(UULUUU\Ur_\!UU,UPtUU|UUUx%U8%U-U#Umemfd:s_LUKUPGUJUP8JUXGUPPxIUGURR8IUaUUUlYU]Ud]U@\U,hUDdUHhUdU0t_P PPPUUtTUXUPPAZUs_lwp_parkRR,RpRselectXselect@RR,RpRpollt_UUDUPUUU4VUHU`U$UUxUUxUt_U P;&_2IчHyU_|nQn- q+yU_ZIчH&_|nQn- q+&_SFU0eC쬆&_IчH`_IчH_-чH_-чH(_SFH0eCE_S'@ )Ѹ_*1@ )Ѹ_1x )Ѹ_3Dh&Ǫ_=rGy=iG}䯎_|nQn- q+_?YQAY@YDYdDYEYēRUSHPRAY@Y?YEYR=YRtHYȓRHYHYGYēRUHYHPRKYLY,NYLYLYēRLYSLYRPYNYhVYRRRRēRUSHPR_XY,cYoYPUY8TYRYLPYP_bpf_mtap_softint_initA0aY_x_AD{Yx_ifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer._0Zl_8Zs_Z|_LZ0Zrt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0ȇZZmZhuZlZlZpuZ̈ZZmZlZlZpZXpZlZlZ(Z$mZlZxAZpZT(^kZ̒arp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvet$ZZZin4_cksumwqinput_createwqinput_sysctl_setupATZ_AXZ_ATZ_A0Zۜ__ p0PpNY^+^w_+^^+^_+^^^+^!a^+^!b^+^Qb^+^c^+^dc^+^^+^c^+^^+^Xd( L |hH$#8# #"""\"0""!!!T!(! ^^___^^^s_^^_w_!b^!b^_Qb^_dc^_c^_^^d^d^^^|\<ܬ|\<ܫ|\<ܪ|\<ܩ|\<ܨ|\<P/^h0^0^/^@0^x/^/^/^_u^_6_u^ܟ_y_; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_yU___@_"_'_&_&_`_*_0__^5_E_:_____C_'_H_N_R_Z_^_(_d_____  gntsn[`p[o[n[m[m_^^p t__lz[|z[rbmn|y[x[x[x[x[(_strtoullstrtoll_[Ǡ_[̠_[^p[i^[_H[m_w[tcidܜ[Ĝ[P[[[[ؚ[`[P[ Ҡ_^^i^_e^ie^_yekd[[[ ֠_hߠ_x<_,_atad[[̭[^ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/X_loob[̷[[Z^Z^!Z^!Z^truefalseyara[[[[[_Vu_Zx__` _strtoul _Copyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025, 2026 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700src@cvs:netbsd-11:20261025122236-xsrc@cvs:netbsd-11:20261025120011 NetBSD 11.0_STABLE (INSTALL_C700) #0: Sun Oct 25 12:22:36 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 11.0_STABLE (INSTALL_C700) #0: Sun Oct 25 12:22:36 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 11.0_STABLENetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %d "couldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain; first aligned sector %u%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed %s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenwhere did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d[29~[28~OAOBODOCOoOnOmOlOkOjOMOI[2~[1~[8~[7~[6~[5~[4~[3~OpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using NUMA allocation scheme UVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTYexecargsshould not happensigcode kernel mapping failed %d *fexecve*pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%d.%d/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'Loading plist from %snoautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uaioworkaiodoneaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group found only zombie processes load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayvflushbuf: not dirty, bp %pinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d The multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqumcpmioemcfancttyphysconptcqmsofconsvndtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3stringpropstng%lliintegerpropnmbr%s: invalid base %d?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noatimenodevnodevmtimenosuidnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 11.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: N, (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.0_STABLEzaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'entropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX /netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700modulesbasegamesgpufwmanmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD11/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1181: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnusedPri GPT tableSec GPT tableSec GPT headergpt resizedisk %sv6v7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646tolowertoupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d -i' 9ëmݮMٳٳ= Zt"(.`4b>D1J%{9WMadyjyTt{q}&َ9+,M6M6M6a7a798;?`mA EH1VgF T \U U@@Ya ^ @@d%j Cmm  ry x @@ ~ @@%unblock and -DNO_CONV?hiii`oToiPih100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %skeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink( ( )&)0)<)I)<)I)I+`)t))E)Z))))#) )_*^*F*<*>#*?6*I*PATH= 4%4tff.4d54.4s<4cF4.4mM4.4l[4b4r j4r4p|44n4.4v 4b    EOF reading here (<<) document9999999999998g: ::::#:+:3:9:>:E:I:M:T:[:999999a,9/11x1}-+?=B1D1N1T1G1J1P1<<<@<<<<<<<<@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.' E0?C1?C1?D8 ?D0.?ED0]?D0d?D0k?C0t?I?8??? ?!*F|N1H>B1p Q2 ; +(I? tޏ? ?  N?T                  A?$A? ?-A,2A&<ՙ>08AY@@ADA@JAPA@6Y1&RA)XA\A`AfA!AkAoA@uAY~A9AAJArAr0сA]AuuAM AAE?E4@A7MAYAAI]Y ArIDDDD DDDDADDD D` E  E  4E:ZEEFFiF FF&F!E.Fe2F=6FeE:FAF5EF(Fi"JFPFeIGGhI G@G@GIIGGGFC$FCFC$FCFFTF[FeFdFjFpFvF|FZI G@fAFFFvH}HFFFHF@F@F F [HFHG@H G HI&G.I.G'IH 6G@*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_addressDRasetifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatusQ܋$printallmainzi@ڌyiRARARAV,RARAlNPLxA<i\< Q<Q<.9DP\ ht@ 0@ǍЍՍڍލ  @܋$init_current_mediaGQ܋media_statusmedia_constructorzdzjee `ǏϏ@ǏϏpaddr_matchN!WaR!WR;WSwWCM!WL!WLsettunnelِYҐ0print_link_addressessetvlansetvlanif&_setifssidsetifnwkeysetifbssidۗPڗh8hpfps* }hlQhMs* ܗ rr1rppAbinvalid major numberinvalid minor numbertoo many fields for formatffs@ N @"-4g;D V ^q~ @ 1@Rkpv}bnorripbgensbextattbnojolietbnocasetransbrrcaseins f :Y'<4,2A'08 >F NTض`@hot}  f :Y'<4,2A'08 >F NT <@ض''@Ĝ`@ȜDbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror f :Y'<4,2A'08 >F NT<@ض`@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsg f :Y'<4,2A'08 >F NTض`@XAD1 @ !&*. @4ŞϞٞ @<recvrpcrpc_getportrpc_callsendrecv%s: can't read disk label; disk type must be specified%s partition type is not `%s'ͦ=wЧ0Mtި9aة 4TyWTWTbSS vzDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY $Mw+]%MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbhw.disknames(J***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]aQQ: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datao\ ( 4(";D"Q"Z"fo""~"řЙܤ""}" """%-":."AH"R`"\JY"e "o"%"%"ܦ"Úۧ"Қښڨ"ۥ"٩""#"-"9"J"Uc"u"""collectlfNAME=ZZ«UUUUUUUUUQUUVVVVV(Vj.V2V6V:@VDVLVPVVVZVfVvVVV>    "#$%   "#$%    "#$%&'()*+.   05eMg1Lcs UUUUUUUUUQUUVVVVV(Vj.V2V6V:@VDVLVPVVVZVfVvVVVghxHPQ%SO1SEMJRKaMJuJ[OXmNL!G-L_SUWGXK}KKJJUUUUUUUUUQUUVVVVV(Vj.V2V6V:@VDVLVPVVVZVfVvVVVIp----------------------------------- - --------------------   "#$%@//tmp/usr/var"""" )4> Details for index GPT part - UfilqvJYZyPVZ.V:«VVmV<}9U[wy# 5Aq9JYZ .VVVR !SFH0eCSFU0eC쬻6VHah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+ |nQn- q+'2|nQn- q+V=rGy=iG}@;Mt?LWmWC 3KOObnyD<#*=(z3Dh&\ M}-@Mjy֬-чH.V-чHVVZIчHJYIчHZ'IчHR22IчHML6 %?aY^S'@ )Ѹl*1@ )ѸvV1x )Ѹ ' u     [ Y[ u  Y  ] e aQ  9!  @Tl{n(VA ======***************************************************************************************************************************************************************************************************************************************KELKKKcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2lXqXdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_configOb_cd eYf_g~ZhZij_k`lem `nf7o`p9qfr`s#`+`t[u3`8`Wv>`w VxE`zU`y\`Ab`Bo`CYDv`EEF`G`H[I`J`K`LwM`N`O`P`Q`S`T`U`V`W`XaZUM1a4a6'a1a_|Ba~Na}YaWa`apaaaaaaaaaaaa]aaen]aaaabbbbb"b/bv\b5b;bCbHbXb'_ab_mbybbbbb e e rt_new0 rt_buildrt_deleteQ Q aeUeeeeZ_e`b`}ebemake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_osgggggggif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfdhcp_initread_leaselog_dhcp:qEqQq`qiqdhcp_bounduqo~qqgoqkj qdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa/ / / / / / VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BeG }G G G G G G H -H EH ]H uH BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~pk ($( @cs_pathXT bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_maxؿ`x4L-o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::pAQMb|c@DHLPX\`dXhlplxXMTP9Q THY ^U0           < 0<P`<8ԣS S gntsdR `T $S f ~  lbwjjcfhklmooppp qrضu}tv w$w1xxzz:BN+CJKOUPdSkTvV~VXZZ   (}5](iae!}5/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin8}-+?=###%%%}>>j6at6|6EV6e(F6I i6L6l6m6C6n6f66p6b6u6~66qs77hv7VV7x@@=d d  ZZ ... ...^ppD 0---4уȃAabCdhlNsuvW:w:z (01Lxhx:9͌h ?Čhx+8DhA,,T<|L@;Б6ge@ 1;8xLhXp$hXN8xxL99iipU8_VVp8}Lp;LNL5hX8  pU8Vp7N i7 17 6l lk\5HGeGjH F``Ґ(pTpWXx_y_. ʗ8HdۗۗUcc bܗܗsp* pMs* h }HtKFxMxRyXx`yxfxwl-xsyxx|YyxxYyx%d  '@@ f :Y'<4,2A'08 >F NT<@ض`@'......dA..##K@FJN D M y  V\Df Yl6vNz !"#$%&'()*|+,-/1123456lnnp7%!x9p-wY]u\yfQ\vxx\A1j-}euxvq9GxލiiUkb%mvfa{z-{<vd\qIhb61iAfu vQ\#j (Y.r%m4q~;knDcIs n%mJe\Pi Xe^c]e^c)%miuynyLqv |9z%m%m%mMig-hwY]rDvt!}<bbUl}Uvs{PY]g@AՃ!u"4Ee%]u{=~\}fAQ[Au6=uKiqgDzu@$!56 1  4p bx z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJXf)Xf29A9L9S9_9f9q|9999999 999(9/9;9C9O~V`goxXfD!9,|?k C_~`)ot,,,@@@h,""@hhh    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ is a directory is not a regular file (use -f to see it) ('8+z   Ff 7AlN  & 2<G$T^nx:z">z; -7   #28% /? K(l9]i!u~9%& Ff)5e:!%684   +$ ,6 -E .X *e n ? ~ E / / ' F+  WmkRkRkYcWbkCkc kG ky wb YMYrWca "(((b@") )-)B"L)q)c")))d") *A"*;*D(P*e"]*w**f"**F"* +g"-+L+w+h"++i"A+,,jYE,S,J!\"`,~,kHH9KT",,LX",,m"--*-n""6-M-^-o]~-Ox-ppHEPh-qX"---rP"".&.\.sH!"..S@!x"..t8].T0.u("/-/I/V Mw"d"_///x(!//XAp"0&0y"D0[0z"|00"0~!h"00?#Q01Al"1*1L"@1b1P"11H"11(M,2<"@2a28"2224"220"3=3$,"5X3l3$("a33x$"33p! "34h!" 4)4`!"?4r4X(4P! "44H"44@"5@58a50"r55 "55("5626!t"H6d6"y66"67+7"B7m77"777 88"818E80:N8(6W8l8{8888888888999!9)979C9K9U9%[9a9h9x999+999999`9/-M;99:::(:5:A:N:\:h:t:::h:4:::i):" (press RETURN)[``ltags643{}abcdDgGhHilnNpPqrs tw xy !:#=="="[[%]<<NU\!h2<a!A>ABtApB|7$E;Cq<+q<c4..4.4<?W?spQ>?}]O#Y?L"E"FlGPcalJFshL" !"$'(+-.03569:_t?gt6T5`N$I`W$]`mbUb1bkjuu`QItbbbbQkijbf_R `&_&_'_6T_N$_W$_'!t<')tb'1t'9t!AtmcUc=c%ctcccauyuutct1uIujtktcuut}_JY_ sssu_ssdcuvutsdddqdYd5dkjdftsgggghuhehUhGh9h+hh]_e_m_O_sU_hhhhss^_&+i'i(i)iQiif{iqi%AiiiiaiiĜ1^<I^'_^'w^'^6^'^'^K,+9i H+t% +*^*u * _(x* _{X*I_ )g h)aF (QgqpF8(5gq ( ''Fh'arF'mgirF&grFH&f s  %# %' %F $J}aoF h$Lqao$ 8$; ##Qw2$H#&f2$(#&2$"& x" 8" " ! X!U!T] sF dMsF8 `5qFdaas(=(M(\(v$ `(f(h|9l(o(s(}(O(((O*l*Y,s-// 0W01*1<1RB1W1[1_1b1e112}3 5P6m6z6΍6666677.7H7q7788888%9F999999dDR:N`:g:::::;&;;;;;<)<<=H>s>>?8AcBDEaFFFG+HHII]I~IIIIJJ)gKK.LZLoLLLLLLMM"MNMZMlM!NN OOBOxOOOOPOQQRfRR\U\l\~\\\\m]]]]X^^^__2aaFbbDccccd dd/d(d7dOdqdddddd ee&*eGeSe`ereeeeeeeef5fPffffffffffffff gg8gMgagngsgggggggggghl h!h+h8hAhPhehyrh~hhhhhhhhhiiDjjkllllm$mĎFFmTmXm[m`mjmvmmmmmn0nMnlnnnnnooBop&pppq.qMqiqqq r;rKrjhrpr'trrrrs*ssstVtZtdt|ttHuuuuuv v5v!BOA??@?A?B `$ AC ?D VV?E ?F ?G;?S1??d7hg1]1s=]1cuks=][Z[EZ.dAvX hm0  C  ""  9   + . : 8 HVKOSW[_cgknrvz} !"#$%&'()*+",(-/-<.C.//d 0j 1N2R3X4]56b7h8n9w:s;}<=>?@[\\] ^^&_1_:`G{R{e|s}}~   ؐ @@`# ### #($4$<$D$H$P%X%`%ċ%l%t&|&&'''((Ȉ(Ј)܈))** *+ +,+4,@,L,P,X-d-p-t-|...///6ȉ;؉;00011<$<0=<=H>T>`?h2p2|2333978̊:4445 5  ! 0" <# H$ T% `& l' x( ) * . + , - ȋ/ ԋ0 1 2 3  4 5 $6 07 <8 H9 T: `; l< x= > ?  @!@"@#@̌$@،%@&@'@)@*@+@ &`,'`<,@L-@\.@l/@|0@(`1@2@3@č)`ԍ4@5@6@7@8@ 9@0:@@*`P;@`<@p=@>@?@ `!`+`Ў,`"`#`-`$` .`0/`@%`PC`ClDtDEEFFccdd̏eeЏ#؏#&&0$(,048@HPX`hpxĐАԐ $(,4<  @@ (4@ H P X@`@t@x@@@``ć̇ԇ ܇@T 833333333<<dī3333IJȲPHUTC33. / y* + . * 7. * 33&,Pd339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž^^^D_ 33UU33UU33UUc80_d80` hd80Pbdc8%lX`lT\x   @ 333333333333333333333333333333333333 33 33lh  0000000000000000 (&3333333333iii (root)`33 <Chhhhhhhk@\tdP`4HLT`,,XTService unavailabletA*aeabi 5TE  1\7xܭoAYrV`.T`0 AP:D"MP(onѽ Kٝ7k/וRv֠r5NeoW])Ky}툼''r3Ea {|L?w0j[1VoG݉Xm5K9_k.rø_\|p-.{s>XχOr_"-gw>/;A>q8.ϳJw"_:[y㵌|kyV^}Tp)k*bL ׽3z;o.\4}iqa~ć| c(Sk\#Z??ۼfsmG"ȯEzډ|Z?ݮF>GiREQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+`gramdiskbin.debug捯.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink /BH\^PįVį$bgt\y(llp&p+DMSGTXTS621 4984 5009 5026 5048 5051 5056 5064 5071 5079 5087 5090 5093 5096 5100 5112 5121 5134 5163 5178 5725 5759 6442 6730 7438 7494 7568 7664 7839 7862 7885 7891 7900 7922 7926 7930 7933 7936 8041 8244 8483 8924 9362 9397 9412 9424 9430 9442 9491 9511 9551 9568 9585 9600 9647 9685 9733 9815 9939 10075 10116 10154 10191 10226 10236 10285 10435 10441 10446 10450 10470 10580 10600 10606 10620 10632 10643 10680 10714 10738 10840 10877 10899 10998 11053 11111 11122 11138 11190 11358 11565 11736 11800 11852 12127 12680 13212 13647 13985 14318 14431 14446 14455 14615 14786 14936 15100 15123 15147 15162 15237 15377 15554 15709 15721 15801 15902 15948 15974 16044 16055 16064 16077 16103 16118 16134 16147 16202 16213 16228 16432 16665 16694 16709 16778 16852 16925 16955 16993 17047 17466 17492 17521 17625 17731 17916 18028 18143 18247 18934 19193 19333 19369 19539 19580 19716 19739 19776 19821 20072 20168 20222 20321 20332 20369 20406 20433 20442 20476 20483 20508 20535 20570 20584 20598 20627 20641 20658 20667 20689 20707 20724 20735 20754 20780 20798 20821 20838 20853 20868 20886 20913 20940 20962 21001 21019 21051 21279 21353 21396 21442 21589 21745 21789 22068 22095 22454 22638 22790 22971 23118 23276 23297 23345 23355 23363 23374 23385 23395 23402 23417 23429 23470 23500 23539 23592 23650 23671 23678 23697 23718 23725 23751 23773 23793 23815 23846 23883 23905 23919 23965 23994 24028 24068 24103 24131 24179 24188 24197 24202 24211 24220 24237 24241 24246 24252 24256 24269 24278 24305 24325 24348 24367 24394 24416 24448 24464 24469 24479 24502 24524 24541 24558 24571 24580 24589 24595 24622 24629 24653 24674 24698 24711 24730 24755 24778 24794 24800 24812 24842 24850 24890 24901 24912 24923 24940 24957 24971 24988 25436 25652 25916 26188 26240 26276 26312 26363 26380 26418 26432 26439 26456 26459 26464 26473 26485 26496 26505 26526 26568 26606 26622 26653 26678 26713 26769 26809 26830 26850 26891 26920 26968 27201 27236 27443 27462 27499 27560 27598 27637 27793 27808 27854 27902 27925 27961 27971 27981 27992 27997 28060 28108 28152 28213 28246 28347 28365 28504 28526 28649 28663 28673 28696 28801 28857 28973 29004 29009 29035 29074 29084 29127 29137 29153 29168 29186 29209 29239 29260 29286 29483 29526 29530 29536 29542 29547 29558 29572 29601 29633 29645 29692 29742 29782 29809 29825 29834 29877 29883 29891 29895 29915 29932 29944 29975 30231 30280 30856 30883 30915 30943 30995 31001 31007 31012 31033 31049 31071 31100 31241 31375 31388 31524 31526 31528 31530 31547 31560 31578 31605 31609 31615 31620 31628 31634 31674 31676 31686 31701 31718 31752 31784 31822 31851 31880 31902 31945 31971 32015 32151 32225 32227 32229 32268 32335 32352 32366 32370 32377 32499 32568 32856 32994 33135 33216 33263 33269 33292 33338 33341 33367 33410 33475 33537 33607 33675 33768 33987 34012 34016 34052 34070 34098 34140 34184 34248 34298 34374 34396 34448 34492 34531 34565 34595 34626 34651 34660 34672 34680 34691 34703 34722 34746 34795 34812 34836 34879 35201 35204 35218 35231 35243 35250 35261 35268 35275 35284 35294 35311 35327 35377 35385 35393 35403 35414 35432 35449 35470 35492 35501 35511 35538 35544 35554 35573 35589 35607 35627 35636 35647 35654 35671 35690 35711 35721 35738 35744 35760 35775 35790 35811 35833 35852 35862 35867 35872 35890 35909 35928 35934 35953 35973 35993 36011 36016 36022 36039 36055 36076 36089 36097 36117 36141 36158 36166 36177 36198 36204 36216 36238 36252 36261 36282 36300 36309 36343 36366 36393 36425 36448 36468 36479 36511 36527 36538 36551 36574 36596 37104 37134 37165 37193 37207 37408 37630 37797 37884 37901 37919 37936 37965 38012 38023 38042 38064 38143 38335 38363 38481 38503 38644 38663 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_STABLE. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_STABLE ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_STABLE ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_STABLE InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_STABLE ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.e a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.m running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS621 4984 5022 5039 5054 5057 5060 5065 5073 5081 5089 5092 5095 5104 5116 5128 5137 5146 5172 5183 5722 5749 6315 6615 7256 7303 7416 7509 7543 7562 7580 7588 7597 7622 7626 7630 7633 7636 7758 7943 8171 8691 9042 9071 9084 9097 9102 9122 9141 9162 9221 9238 9252 9274 9319 9345 9386 9464 9582 9696 9750 9779 9811 9850 9856 9889 10012 10019 10023 10031 10055 10137 10143 10150 10162 10176 10185 10218 10237 10249 10359 10421 10440 10559 10610 10662 10674 10693 10745 10949 11157 11348 11408 11457 11727 12189 12858 13284 13606 14031 14163 14195 14207 14385 14582 14743 14877 14897 14930 14944 15013 15126 15298 15433 15453 15565 15657 15680 15703 15762 15777 15798 15813 15834 15854 15879 15893 15917 15929 15947 16157 16407 16428 16444 16497 16565 16638 16675 16701 16777 17234 17260 17282 17389 17496 17697 17770 17854 17954 18449 18687 18838 18872 19007 19051 19190 19231 19276 19323 19567 19700 19762 19856 19861 19895 19929 19944 19972 20005 20012 20037 20055 20081 20088 20103 20118 20138 20178 20195 20215 20236 20258 20273 20293 20315 20330 20343 20357 20369 20381 20395 20418 20441 20459 20502 20553 20590 20775 20838 20874 20923 21014 21144 21197 21457 21504 21865 22015 22184 22324 22444 22576 22616 22663 22673 22681 22691 22699 22710 22721 22735 22760 22805 22838 22871 22906 22960 22985 23004 23026 23031 23037 23070 23087 23114 23132 23153 23175 23194 23204 23234 23260 23287 23336 23364 23391 23444 23454 23464 23470 23480 23489 23509 23513 23518 23524 23528 23541 23550 23581 23598 23625 23646 23666 23685 23711 23724 23732 23748 23779 23810 23831 23857 23870 23878 23889 23895 23919 23929 23941 23959 23970 23990 24006 24032 24054 24070 24082 24102 24128 24134 24164 24178 24192 24215 24234 24253 24271 24289 24707 24908 25148 25332 25410 25465 25532 25572 25595 25629 25640 25648 25671 25674 25677 25683 25694 25706 25719 25749 25793 25806 25819 25856 25870 25881 25892 25903 25920 25931 25978 26001 26050 26291 26324 26579 26600 26633 26686 26712 26739 26895 26901 26944 26964 26983 27012 27019 27026 27033 27038 27087 27125 27159 27216 27244 27289 27306 27407 27412 27489 27503 27513 27537 27660 27741 27851 27879 27884 27900 27929 27937 27978 27985 27999 28012 28020 28039 28072 28092 28112 28328 28359 28364 28371 28378 28382 28396 28408 28423 28456 28469 28524 28582 28618 28636 28654 28672 28709 28715 28723 28727 28748 28765 28776 28798 28976 29020 29722 29746 29780 29799 29844 29851 29858 29862 29886 29897 29902 29965 30086 30209 30222 30356 30358 30360 30362 30372 30381 30394 30421 30425 30431 30436 30445 30450 30477 30479 30492 30504 30519 30547 30591 30638 30654 30676 30687 30720 30740 30789 30889 30943 30945 30947 30988 31079 31096 31110 31115 31121 31230 31289 31540 31681 31808 31876 31913 31920 31947 31993 31996 32017 32062 32113 32172 32241 32288 32393 32536 32561 32565 32599 32616 32640 32692 32743 32815 32881 32979 32996 33027 33063 33097 33121 33145 33178 33198 33208 33216 33224 33234 33245 33259 33285 33333 33356 33376 33417 33716 33719 33733 33745 33752 33771 33785 33792 33799 33808 33818 33835 33851 33899 33907 33915 33925 33936 33954 33971 33990 34010 34017 34034 34051 34058 34071 34106 34123 34142 34162 34172 34188 34201 34219 34239 34260 34270 34290 34310 34323 34342 34355 34379 34402 34415 34426 34431 34438 34456 34475 34494 34502 34521 34541 34566 34584 34591 34598 34611 34620 34641 34654 34662 34682 34710 34727 34733 34744 34775 34783 34796 34818 34840 34849 34870 34888 34895 34918 34937 34964 34982 35002 35015 35030 35051 35065 35072 35086 35101 35120 35665 35698 35726 35755 35763 35800 36112 36289 36366 36383 36401 36416 36438 36488 36498 36515 36537 36596 36754 36778 36908 36933 37059 37077 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_STABLE. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_STABLE ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_STABLE ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_STABLE completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_STABLE. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_STABLESalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_STABLEEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can creatMSGTXTS621 4984 5020 5037 5052 5056 5060 5065 5076 5082 5088 5091 5094 5097 5101 5113 5125 5135 5165 5177 5610 5637 6213 6573 7258 7319 7397 7492 7532 7554 7572 7578 7587 7613 7617 7621 7624 7627 7749 7934 8162 8691 9109 9138 9151 9164 9171 9191 9210 9233 9276 9296 9315 9338 9382 9411 9452 9518 9630 9744 9798 9827 9859 9898 9904 9937 10015 10021 10025 10030 10071 10208 10218 10226 10245 10259 10268 10300 10341 10354 10479 10537 10556 10675 10731 10783 10794 10810 10849 11099 11271 11443 11498 11533 11786 12193 12495 12766 13127 13307 13626 13646 13659 13848 13992 14188 14322 14342 14375 14394 14495 14650 14838 15025 15045 15124 15222 15260 15283 15373 15394 15417 15436 15460 15490 15534 15567 15590 15602 15620 15888 16207 16238 16273 16337 16412 16482 16513 16543 16635 17126 17156 17173 17313 17454 17651 17770 17917 18084 18642 18938 19119 19164 19327 19381 19516 19552 19612 19662 19953 20062 20119 20216 20221 20256 20291 20306 20330 20363 20368 20393 20409 20432 20439 20456 20471 20490 20522 20526 20546 20564 20576 20589 20607 20631 20649 20668 20695 20722 20734 20755 20785 20815 20840 20873 20908 20946 21199 21268 21323 21384 21502 21661 21715 21976 22027 22403 22558 22702 22842 22950 23135 23165 23208 23218 23226 23236 23248 23269 23278 23284 23316 23360 23396 23434 23471 23519 23543 23555 23569 23577 23585 23616 23633 23662 23683 23706 23715 23734 23746 23790 23828 23855 23899 23927 23954 24007 24018 24029 24036 24046 24055 24089 24093 24098 24104 24108 24121 24131 24161 24184 24213 24235 24257 24279 24306 24318 24330 24349 24383 24416 24437 24461 24474 24486 24499 24505 24531 24541 24552 24576 24586 24606 24626 24643 24669 24693 24706 24726 24760 24767 24796 24819 24842 24858 24873 24888 24903 24917 25348 25539 25774 25962 26004 26054 26108 26156 26178 26219 26230 26238 26262 26266 26270 26279 26290 26301 26316 26347 26393 26406 26419 26449 26463 26475 26487 26499 26517 26540 26585 26608 26668 26920 26947 27209 27227 27254 27303 27333 27364 27496 27503 27552 27575 27599 27628 27636 27646 27654 27659 27712 27761 27801 27867 27900 27944 27967 28068 28073 28150 28164 28174 28198 28321 28402 28512 28540 28545 28561 28590 28598 28639 28647 28661 28674 28682 28701 28734 28754 28774 28990 29021 29041 29047 29054 29058 29073 29092 29118 29127 29139 29193 29251 29286 29305 29322 29334 29369 29375 29383 29387 29408 29425 29436 29461 29639 29693 30384 30403 30438 30468 30514 30520 30527 30531 30555 30571 30577 30652 30802 30921 30934 31002 31004 31006 31008 31018 31031 31048 31075 31079 31085 31090 31099 31104 31131 31133 31146 31158 31173 31201 31245 31292 31308 31330 31341 31374 31394 31443 31543 31597 31599 31601 31649 31739 31756 31770 31775 31781 31884 31936 32182 32343 32498 32569 32622 32629 32656 32706 32709 32730 32776 32831 32890 32959 33006 33111 33254 33279 33283 33317 33334 33372 33425 33465 33541 33606 33700 33721 33759 33799 33835 33859 33882 33921 33951 33958 33967 33975 33983 33997 34013 34041 34093 34110 34131 34175 34517 34521 34536 34547 34555 34574 34586 34593 34600 34609 34619 34636 34652 34706 34714 34722 34732 34743 34761 34778 34794 34812 34819 34837 34854 34861 34871 34902 34921 34940 34960 34970 34989 35002 35022 35042 35063 35073 35092 35111 35121 35138 35152 35175 35199 35212 35222 35227 35231 35249 35268 35287 35292 35311 35331 35356 35371 35375 35382 35392 35401 35422 35436 35444 35464 35490 35507 35515 35526 35557 35562 35575 35597 35612 35621 35642 35660 35669 35713 35737 35764 35779 35796 35810 35841 35865 35896 35903 35917 35932 35951 36496 36529 36557 36586 36594 36631 36943 37120 37197 37214 37232 37247 37269 37319 37329 37346 37368 37427 37585 37609 37739 37764 37890 37908 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_STABLE. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_STABLE est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_STABLE est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_STABLE Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_STABLEExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output froMSGTXTS621 4984 5025 5041 5059 5063 5067 5077 5086 5092 5098 5101 5104 5113 5123 5136 5144 5155 5180 5192 5704 5736 6228 6517 7062 7108 7212 7298 7334 7349 7367 7375 7383 7410 7414 7418 7421 7424 7535 7720 7948 8424 8758 8787 8802 8817 8825 8839 8857 8878 8929 8945 8955 8975 9021 9051 9104 9161 9272 9393 9437 9470 9509 9543 9550 9583 9660 9666 9673 9680 9709 9821 9827 9838 9855 9872 9881 9910 9922 9932 10033 10095 10115 10235 10272 10328 10342 10363 10400 10610 10785 10934 10969 11021 11241 11558 12085 12450 12740 13133 13268 13281 13292 13438 13617 13748 13882 13902 13935 13954 14037 14152 14293 14418 14432 14540 14633 14662 14682 14758 14775 14793 14809 14828 14848 14865 14877 14903 14915 14933 15134 15373 15400 15417 15473 15535 15595 15626 15650 15709 16055 16085 16102 16210 16320 16460 16534 16610 16688 17180 17400 17511 17542 17669 17705 17833 17860 17900 17946 18162 18286 18354 18454 18459 18495 18531 18545 18568 18601 18605 18630 18649 18675 18680 18695 18710 18729 18754 18766 18788 18805 18818 18830 18848 18872 18887 18904 18917 18928 18939 18959 18988 19017 19041 19076 19111 19138 19325 19374 19406 19454 19551 19684 19730 19922 19952 20274 20403 20543 20683 20800 20935 20979 21022 21030 21040 21052 21064 21072 21083 21110 21144 21183 21214 21249 21285 21332 21352 21369 21387 21392 21399 21428 21444 21465 21482 21499 21517 21534 21547 21578 21603 21634 21665 21700 21727 21780 21790 21800 21806 21815 21823 21838 21842 21847 21853 21857 21870 21880 21909 21925 21951 21968 21987 22008 22024 22037 22042 22050 22065 22091 22110 22138 22156 22167 22173 22179 22200 22210 22221 22239 22261 22278 22291 22312 22332 22352 22363 22376 22398 22405 22430 22445 22465 22477 22494 22511 22531 22550 22860 23040 23251 23439 23505 23552 23607 23651 23671 23700 23712 23718 23734 23738 23742 23750 23760 23772 23787 23806 23842 23853 23864 23903 23915 23925 23935 23945 23961 23979 24028 24049 24094 24338 24364 24618 24633 24659 24716 24750 24785 24927 24944 24993 25014 25030 25059 25064 25069 25075 25080 25119 25154 25184 25239 25272 25318 25332 25411 25416 25470 25484 25494 25518 25604 25652 25758 25792 25799 25814 25841 25850 25889 25896 25918 25937 25953 25971 26003 26022 26039 26196 26227 26234 26243 26251 26258 26272 26290 26309 26319 26331 26372 26417 26446 26467 26490 26509 26547 26553 26561 26565 26586 26603 26612 26631 26777 26819 27329 27337 27361 27379 27423 27428 27433 27437 27468 27481 27490 27536 27662 27753 27765 27829 27831 27833 27835 27845 27859 27874 27901 27905 27911 27916 27925 27930 27957 27959 27974 27985 28000 28028 28072 28119 28135 28157 28168 28201 28221 28270 28370 28424 28426 28428 28463 28539 28556 28570 28577 28583 28682 28738 29014 29138 29249 29311 29349 29357 29379 29428 29431 29452 29497 29552 29611 29680 29727 29832 29975 30000 30004 30038 30054 30079 30127 30163 30224 30278 30359 30381 30420 30457 30489 30513 30540 30566 30580 30588 30598 30606 30620 30633 30645 30669 30710 30736 30753 30782 31106 31109 31123 31135 31141 31157 31169 31176 31183 31192 31202 31219 31235 31278 31286 31294 31304 31315 31333 31350 31363 31389 31396 31404 31421 31429 31446 31470 31489 31508 31527 31537 31548 31562 31580 31600 31620 31629 31652 31672 31683 31698 31710 31729 31748 31759 31769 31774 31780 31798 31817 31836 31843 31862 31882 31907 31924 31930 31938 31948 31960 31981 31997 32005 32025 32045 32067 32075 32086 32109 32116 32130 32152 32169 32178 32199 32217 32226 32257 32273 32300 32319 32339 32357 32378 32392 32412 32419 32438 32453 32472 33017 33050 33078 33107 33115 33152 33464 33641 33718 33735 33753 33768 33790 33840 33850 33867 33889 33948 34106 34130 34260 34285 34411 34429 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_STABLE. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_STABLE zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_STABLE zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_STABLE zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_STABLE zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_STABLEWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_STABLEUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty sync# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...]_^%K4"#'(),-@`^T8@@!a^x@ @+@-@-@L(@,@,@a^|D(@(@!b^8<.@L/@L8@`C@A@B@ 8@Yb^\Qb^(7@:@lc^C@D@ \\pO@L@H@H@H@dc^pG@H@4P@8P@PP@W@0Y@Q@Q@^h7B >BKB$GBHB(GBlKBLGBtGB|GBGBGBHJBGB|MB^@\gBXfBmBjBiBjBjBjBlBtmBjBnBnBjB^B(B^@hBBBBBb^`XBBBIC^DBBB^B,BB@^"BBBh1C$CaCL]C^C CCDC4CTCCCCCCtCzټ|Ff梂 &Sk@5 5\-gӿ6C* fFq{ Ց ^)>ttmk%Czټ|Ff梂&Sk@5DFDKD LDl^XNDDODND^=^A^E^I^L^S^9^>^C^H^N^^^^^^^^^^^ ^E^^^)^5^^^^&^0^R^]^h^s^s^~^^^^^^^T_^^^X9^]]iZ $EE0EEELE E]XdX@d@ h h 8"'-T39?? < ddi(dG bGiG`GnGDlG$XdX@ X@^[Ht]]iZ@<'H$)H)Ht*H@)HdIX]g ` I I$ I I4 IpIpI `$`^IIIII _IIII _lIIII~ _lI8III _l(IIIIC _lIIIIg _lIIII _lIIII8 _lI8III _lIIIIm _l(IIIID_l@IdIIIi_lIIII_lIIII JJDJ_J@J_PJpJ,J]$]>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lBJlJJJ J+]]ؿ]ȿ]]]]p]`]P]@]0]m_+">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||_KJJ`JRJJ JtJJJ0JtJxJKRPcXdXHX\XR]&_(oK0`KDdKdKRHaKaK`K&KbKcK%KX&K\&K nKRPcXdXHX\XR]@_H RL:LL;L_=_?_=_?_=_?_=_?_=_?_=_?_<@_]H@_]U@_`@_]m@_]y@_]@_|]@_( ^@_]@_ ]QQ A_D]TR`qR@H@XcO@ oB_]Qр?]rB_:`rlr xrRtL_QtL_Qr:uE9==osystemDuearmvtQ_HRQ_Q_PRES_PS_dORaS_kS_tORxS_S_PRS_S_QRS_S_`QRq (root)`%n.core~~~{|p|| }x}}(~~~h{\R@B[_0u`S4@HPXȓRhp[TX[T[TX[T[TX[T [TX[T@[TX[T[TX[T[TX[T[TX[T[TX[T[TX[T[TX[T [TX[T@[TX[T[TX[TlXTTXT (e@Hg@q_q_q_q_TT  @ RĂ̂#v_UUUTUUU(UDUU+v_UUUTUUU(UDUUdl_^^,cVsx_V,VV^^ @P W8 Wlockf2  _XXXXXRXXXXXRXXXXXXXXXRh^}u_}u_HYYY:_l3Y_8Y^CYCYxnYgY`Y_G_N_R_U_V_]_a_h__l_r_v_f^|____^_`^_______Ý_ȝ_TН_U՝_Vߝ_W_X_Y_Z_[_b_c_dV^e _f_g_h_i"_j,_k1_l8_m@_nH_oz_yU_f_O_T_k_\_y_̞_`_ y_ _ d_^^s_^k__(_A_e__`_z_M___ o_!<_";^$s_%_(_._1_2ih^4m_5_6_8_9_:_;_<w_=_>ž_@ƞ_A˞_BО_F؞_GGݞ_H_I_J_M_N_T_U_V _W_X_Y_Z_[^\\ _]&_^/__7_`;_aA_cG_d^eN_f^gW_h]_ic_ki_lo_mpL^x]$\^$^D^^HX]'\^^@]^]ħ]]U]{])\^ (\^]]ܞ]&\ ^U]^`^`^|-^^^,^ _ _Ч-^ _ _ԧ-^~ _~ _ا-^ _ _ܧ-^C _C _ী-^g _g _䧀-^ _ _觀-^8 _8 _지-^ _ _-^m _m _-^D_D_-^i_i_-^__-^f^@^4-^{:_b^4-^_^-^_^Ȧ-^_^ئ-^_^ 4-^s_^4-^^^(-^__X-^w_w_d-^d^d^8_d^-^^^^^-^^^-^^^-^^^覀-^^^-^^^-^>^>^-^w_a^(-^^^8-^_d^H-^^^`^X-^!a^!a^h-^!b^!b^x-^Qb^Qb^-^c^c^L-^dc^dc^-^^^p-^c^c^-^^^ȧ@-^@ @p@@ @@AH^X.^c^`.^^dc^h.^c^Qb^p.^!b^x.^!a^^^.^_.^^w_.^>^^^.^^^.^^.^^^8_.^d^.^^w__^.^s_.^_.^{:_.^f^_i_D_m _ _8 _ _g _C _ _~ _ _ _^`^.^l^[^dg]B_kǿ|v^:IMRKSygk6=L<$},~AjOI]O:I_IyI/)gϤOzܽTKd~l~YO,IҝshgMeUY=ŪS !!'>Seʡ'Nj6J者yv*e^]O}rr7Tv.kT;gm~oI~//K_zcI[<.?c~7JROzz~trq&iǜjo yd~x.ycx@fGeYOSoCҗK*~{V7VzCt7tI+N}]o)eW|=ߧU{i9{|Tc|x fiN >HXvHٝ2u~YE=*h=:.M+}>PU_SH*Rx~jTw{I?%}ŴObxi?UO EGojWgi1|g=IU{1΋:iژR ܧt3/C}&2iwjMvlVzϏϖxÖݠY%\B'\xZP&#ɽ횺E45I:Moi+^_m>\W1)sޟ_ A7'ϝ$CE=YM.UoWǪb-P]$~kҟ?IIz\͑'>r9c=Wv64]O(nV*44|שG}4}_.K.K~ q$=>]ӵ@`ޫ~Ǔt^USGotv`~ln5kkA|:?7ǖܾdV'S{}}ׅk$4a~[хvʇ_yqүsULӉij*:!* ۊOҨ`a%EGߓlQ㻒 ;Uioߠzhɢ5ЏHSLpvޞ)e8+l]1MO4p?i&sDMiQ4fu;=I%H}cM'?f{lkІ^09I/U&B|/RK__lLg{o({^'Iρ1JiRy4i"MZk)]Ji>]JeuJy-MIj^W=N}o1M-=h= JA?}M= ;#߂\Rk-Mǭtּ uJvlSs /E h~uz\C޵m=0yo!H#JGJҹiݿZG?PriT;IۅH#U<*xggZVC]RӪLke3J򾮝X=Ӄm'5#}L49~(M5>ϒ)%zJUO 3Ksr{ qUU秜٥+gg]~{yX|7Ǩ7&f{xOtӀ]v3`E$DgU^vu`>?vk!Ŝ}fjU' ~3xeSK>!|y{o ^Q~9~KWo[3˦szvy|'eap|H=K[<[<ayf8cP͙Ϳ~<8w.ocMC-eҺP9; Z|xSķlPo~g,57vO7>Wa=\cq;bmP˕<"ڌk߯԰\{͠n/k@My2Sy 8Leޖz|oy^Q?K򜞯Lo pM ÿ%{nٜwKurF91vN߇>_*f9= rC^Tbu~;;>/Y;Vʠ mڮaX!?ѽ|[t-bYW\Α շ}u7xss;KaZ'x[8W~nزf祉˦Tm*8陥^K{d.8u~v)ԕ1\nTߕ|f}ԋ/-ks5D`kwv\5 (u>XmJԦWs\<[Wzso~9/ymt| Lq[{vSe s*~y vz֯*MC/}w{GmzD=o L\^k䡽}gU{vO<]34N>#w|^ự>co[1? ǜ/{5Xgok0?A\}2y..d XQNz›Ma)]ܞ:jS=9_B 5*tY:wE hGb]s+%]˨@ e*^zkz/zg;0L;f'6=,q9\.Dw}8^lu4O?~>(|^y}Ͻ~Cv#CU9Ck}A k~k#~>(T2i:lc5T'2lxA`z>!v o{7Uֺ3~wڮl|gsQo6Ng:_z=1vGy2[:͇}7zڽW_fat> 2{uT nAu[ιW4ݢHId~7u`N7zm:l?~ߕ9gy5hHAx~3'=?6ǑMB+ӁyXfLoJ.B}NV't/wе9p<%|3Di>g&mY޷:4~S7.ǼQ+ yg/'& 1O}CcU[,lehW>'j/e%֫ /7M0{KuT72+0}&>iC-q/;`cH(2V{ͽR Obq>g'KekX.c#qNINo>9^x|c[َieL=y[}4ʠz.kKiZֲˆN.[ȳA?ޚo;]ueKlsS}qN녥_^WE/ߟr Ew6:^1-5yn;3K6Z-霤cU MH9ˁ/Wgpޫ~9 xqyL>(Յ/ԏ3N{By;V99<>_>?ѵ3J ;fi濢t9#-_l+'@空p;ު۾؆xN߹ky<ldHTe Y^3f^ F:EN | !wrbItUi]"8c>jjnsd9ۨ6Fn C~sfzδ \juHٞbވI^d83̮/]ۜ}21/`|l6_MMúx^<-/K6 |{׽c:֞}y|k #8;ɼ궓ٗ/tIx{iw]gH۰ߗO=ų,|IIEޘb + U 'olc6}tu̙|_r=yV/ʴc{_Ruks{/G4psAS?kf16`fcOtj?\"oI5z쓔b5?6̧Zf.Vkx?esO5 ldUeeF^0 aMAvq[rlbiHe|1=nE#Gz4j,tӀvm~ϧn&> tzaL|QGׇX\g _> L\}pLOm{@w~q G];iʜM=ƙ|o~}.|ߣ6=a1a^Җf&Ϋ!?f^\*;9%Qևg k9qOc&{H}ӐuSh'_d:e7U< ז91ܞ՗j&KKޑ!1X umfǷG tI.'Gao∠"Jd?&!V}!8׎[&6Ixw>17"0q<M)~՜}L vwvnt Un>Ĝ¿[DIc꙯t5 "O{hC /Jqy/d4b:ZpM#t.Zʣ_4w4Th8ʌ̿\b'/ Ӕ,<(3h×h/F>}c#N3X;ܝ?fd#yly{:/a1;/]0~1b 䬜_t|X>7Y&18c8w[ʳdㆨm\.Lc`N}+qL\Fۤ6|0*M!׍5n']8bޟ.b{CfwrydGGc]PvRx|[=){nloNl 6hbki۠}8% q`P*3ЯK?ͪ#VKv??Fc98 TM= ^Z^K兛Alg~k?lB7LLeܷ_<{:bɻopS0?͓1y 6 gGzg2)bv7kzN~pt{.oώ_KTZ56zgǿ/zͤ\#_f2gG爐Iǰdkf<]VKYO>O9%ڪ)@11lOJ8 Qߵ=m}ޜXsC[$Y]qF=S.M/v Zvާ1;y'9e>ﺡmqbFr_(<9QΧyJR[E":|{''/ʴhZ,x]:*KO:^H[ۚvM#=os=<"G5L~Ώhs:?Qk#GsVetLsӭ4<}i?i*wLU&][&Uъ[w} Hҍ^tD3yoLޱ?t~/]zRtcʤw[w#_IȊj҂n(g>v+<36T܆X˚9Vߴ+YV.r:=MKh{\z[xvvXO܂8`oy/=hS]web| aq5zsXRe/ߕsko=a! =y^}[~ cGޏD}y锼}~H o?\lC4 {ǤC:I[\KDw6%\CE˻9o3v\'ү`i=߼ ?rUyCj;/I̺Mv͵זBt>D㞋lxA .0>29v 4.t3wIA8/yOo))X3vtbhNAHB/eih?2.>'1ډ=GZ&aGZ&mim.}XQx/ 1b ׫݂6&CwqO˧\X(ϑ嶼Su|b6ӂ71=f=><}*#ӛLvZvX[1,.+N+'/L^j9L::vN 3(.쾈4_| !m^԰tMЮtLX3ͅwkH;-41:k&s6|^ B82)}?c:G"JgK:Y|/xr=RtTO::CX8ח6 xE{$횤9T.hED3&,ij"/7aџmbs3X='01&}ϲ.x!/^%z_~+9m-w>nn zFrp:sswӰ4a]=ga}X7I61q?ix &ېr,HMk|%5=>hܬ M~sƽ}{3rF~ށ1X qcYo ];)wL7>pq cO6nNa]#n)uE:1|+cLPo4mWOI/mM;dU&1ڪg&qr;=4iaaz0+ן zqu4~ik9K6<ϸM},li3yfsri2T7DW=&HX*ֲ ʦ p-Okl|w&6`g).s7@ur_U4uj%8L;s76FuN2v?ey8g1Lnak_%WkPՉQ{,u觽63]7W4m,U{f:nLڻ]u-ثo{K/8ؗpR6 ڶ}7KFx el.<WX@.T- G}z 9*V0*SM1rn mmR;VYPиTTnE(i llkoA]X)M\m2R>Sy w8w?ybcǴr1V|)ghl\?(f90yS}#U_q3 Oe}bl{%nmЎt\o|;z; -*a, 9Kv!K/sDv"ɢi@4mltO =7 a]MCu<1i-VMyK/bE5B^:ًJi̓m m-nK#ѪCʺ.:;769:h{FTlH4Re_d6b`Ɯ쑶cl: л!956pQjtg_Ǡ[ R4 ̢ ~3̻U8a~˼5/sv|17ŧEiBy4-x s^{ dyd=]R-/q=H_MuX^ y\l~?؞9>O)uwC(؏)t~cQJݽpc?MxtˠN=*c|^%pE3-1ISi]l=8-祥Ni>8Faº< 5+\Hg>.Y#4}_ksIPl> S,v燦 3M-gtoK|^_:7ϼw[`T.gD%Ê֓(;*jm|B!e"/JZqf6pNd6Jo.h@֬?vW7G~)G6}^ʭ^7׳HоMyY."Ri-thM˷Q83oՄuoMz~lauqФY1cm7oߑ 56eS/94FK&:X(9mH|yٰ`89yzآoo܂y@ĜTq:@iq2h] 굩o`Ϡto|?de g'=!@YW0HXIsה9= A~EX0΄Ie(qtv!сB9l/_^t-$aHʓ9G= ]E]М<2FYY͡ ɷӘՉq)O84vK>9|9 U 3xR %Fe!9[/壘.epȜkox&v'e/^ʱهy",W"R[ N6XQ4.L%I/kqj^vx 2 "h6!a{yIyjƱGUlK;ئ(ǠzV:y}Bf–9ZQ|0G|ldʈпԇeȷM'XjN5 ieĘ43|խ⟡As,Λ85I{mQ}^ɽPQяW|wOCBSIbg(sOa6.LfQ5Uc<ۗ`˿ݳma.mKD߁g7JWY,b;M4!6dbUX_Z.{5wB8z6¯]T4|Nt^MD{R1l,7M}%hˉ1:Pv#3ì}`lN6Iq=#S;M,7ɏн+LQAӤ},T1NձUWd(w`g=.)oFٿ\Ʈ<~K~3i 6׋xg>( SߐGR΋u-D>S0ul#Rt y#ߨxHpXX6=\6k^g2akudi AIޡa?a}ԁ|n"y蟫v.nr+=dz, IwdXk8 %y Ȍ(6._L~Pdlװ6SH6v\OsՄ@͌zd0ۀ>8;䳶zt޲$vo^Zŗh? N}42/k#J\4 |ZуȟRO` s#աmS~].67l;cdL[攳& G⪿·kD#o_"*?l6Y6@Zl\fsK^#tw)13:ҧ"3^W:F711F`<%L NO}W`;mܭrMK|sش]Q}ӖWKȢzg ו/7sX2(͙֜P;6A>)d=Q%m<.1éo:j?6\Ks|!VtzQAql@꧳46}s?'E~zAl1_3|wc>.W+%$YςII/H?JB{(%m{P_bbxe>C*2`П^Zgu Xe~.=erNd_>\yælv O }Qo_} Oi=&`׆:8i?Ot8xL^w bT[~ȵ~(gqΨfmFxqvqp4}>79p| 8같b=ˆ*L\o\/(h{Τ5&ofr"5.UG!$;ÊA{ *mdObT+v9'81sxy{Nb uƦ-CYf}#TqprYl2P57K}pmcoCI_}%W $m,}7OͼuMցG'ԕUt/o||<6> ~95sO:FƦ U&SBJn{ܯ[._-cL9|tD;@l1ǁ D3iQv!!2YK>3#CZœ`U |=chUGi#ͬIثQb%e;gi@޼Uz%qҾ(x 7sq.wg]8Z~| ۆM?{ݜȮ;@8 '|tSӁ~3} ɼTg1jJ52{.ev~颒9vh<"/_HN_[ %ۧehc+?w}9eo*.PmC2G/L ` 6tԦy7V(BŗM3d'\V2qPww'~pC0קyK^gUtNECe`}ͦ4NʙKiϱIo6wx*@6%ak'}~)0C_)Oz!}tc3m7Zp i(~@a}6կ5!=e WJ9\(yheNZt*6!LeG8.tW$ \c)ߕ,ӓm@ԻLGe(yKg`bt`}]G?gZ mxD<'v^Uόnà#ۊPQk&9d`(w6$$쟶8ktەēڮq'l';Ah_pxO06˘ .{PbT!Ƌ'&qlֳiY'tZ*v[aG}lx֟}/Fj{:ZSżCh3a10c-#mw|8ZWYrKkEh4m uy OZ=$ٚ$,σ3E'cP-@([M^XC)~M6r~n}e[Z`"U4&i,WrJmj~U}DmxWо[/|;\ xi?`$'dzbۍ#)Vw^`K40\)asGC%Zpp%VRp ͽW O\cC](mIQjZ+ !e8OHYZ7mx{%6M{dflbQW; t^Qุ0 0,=ذcL>0!Ɛ <ϻC檍޵!؄g;q-_fu6 >Uc]lc?-1AQ{8ںO7+ 3;:/0:6e(GG(ԮcQ B,u{zh~![8261P9+T>K͊mm|-C > |<ϮCDl:ςi8˄_X'of5멎+O4G;0kx2) Iꧤ+%š5a/2܈γ~V> 2`dKDo1Uwa_ 2v&]-P0/s})Ӄi95P々#}lYS':uaL\mH\Y^}恒 f Gzܼ6IAdj%簁YHS,l^`l8Ơza\<À)}:/I4s/[!gqvݸȟ3Ѫ l#N˜0O+qhhNCLuqll\[>tIYo/z2dΞjh{|5౎~ 9oh{>OG>k JGŇ9MtfQ\[(I< /}y<{Df倦`t}=<ᵂe5Kc/7 ?L\?F|YgitLd6{Ÿ~_"N4 -k 1h ]3Xx5=>X꒑~r7edK\`a\-$25`{NlsUߞgcH[HFIڰd&dw ?fR`b{cWi҂!E݂?nX s3hMWlOehyʹ;F e]q'.?YLby]ΖZB=+l }Na0`9w]1)ǜx!6er4I`J?@iS/yYCL%|EvId 9αfҥ/*"{98ܟV4[&жю4#b2~  "_GO-qIY:7TXӉitW {~c{ڱ  m3}Dܗbzîҟڱ`>p='8vNang\?$ ״M;z:~qBrJҀ5MIv;̥y`@=U&Lߧ&mnCVѶ.uUkg7ͱO2>^@-ԯMK(&kk0h7FU5 -Z#Qaҷ]\5w"'s8ErIS .\+IF|(AWor7MQg>tC޾#QFq7S?p!es,I>pMkW7(C'УҞ|b=.9isz`vb\^1cyAS_$cI[${1)[˫vcPfjaώ_h7"2h|i2i>tw_awz_A%'$-Š_(g3fїj- lۦ0v=[j!_fD?:|ۊ樐T;=|SV-+J#OEĽCv P}y1VwL;-ƪU?|FulaێLra˶̇Q97AF&Va$p=Vq1̫ Y/qV 7gDO|ĤC G/R-NlrB18)_!;lƜ <2 L;/sXEHxMh$Ot,m5b._ofI^Aa 6[ԏ z/b g@ޫ܍w]/JӘ=?}KxWdŀL~,KiF^)kTs|{>-kdbW8m(<ԟ69EC 6O {ro"% l4%^'YCӇ>,S{a_0}yAV^ü&,4H6āB[=vHdJ "Fgzr';6)ȟ^vD|Xy>2n/7oX02΍1Itc۰>xmbF>iđ[Nip|rf_)q> iWl{k!. uGa1|ng816mj&U6el̾+},x_6u3L10Z'HvY2q ʪ^WR'׽ScT_e@3F܁Ş`7qrVpd/v۶n%SewOm [nd)Go(_lOArI09  <^L?m_sp*>kXdn/$erRLɪ׆ Hr>'D۔w?|؈ɺpbYyI3oK[bآ>mxenW/LM)`ow~X$.%ĸ)JCF8 sa,G9oom=yEG,N5Θ}F+Vv=< ;aNO,.;ESƒ3ۂ7FҜSrt9~d,X7VJb3;Z~6SddH!Mtq+|z,q0(= gi `{6Ch7dȶ%^7j*á;jd9W X^QĪ9t XlE[sqRքڼZ@E/ ` eqEGl9msoc, \؂ȧ<$Y&URS]&6]YBXn?nsޑ:ϒ{}hF#>džk X̻};F=V3YVNĿ_j~;|UƷ O{Wݕş>UM|=3snّa/,X?S-{Dn_uXB~;lV<ī|/K 1{/ULZ~rŀ9,m nLܣ-кt:f;Wŀul߱UUAw5mOg}@lo~__CoN{>fK i":|q +{?aUnž{c<Ƿ0*1d޵ ~TB< ۣ6$lEO9JkŚ>y෯ֶ5=%Ӹ-zlG~qZ fg4VyC#`{x>XjFk`\Â+uCTWl7ZRkEّ<,WYmJ*wDR55mG-u2-g6<:lB@@9wئL@̞^Z{l;R0HkpNNmzpzCr^~(76& zfNz9 1=>[8%g\a|yC{8'"3|f{Z#7GcWExWŬIwɻMuݓ eX*>LwUepV@a|U?Ws;X}WŀqBy=n4Nk elDgǣy!:KmגmrJxk:?;zgl ".6=d-țO;%rhuS}yMvfhǹO# ɥ6} _V`4ю >1 wBGCN5`_ E$6*FoV4,lL"bA_F>՚q{Y{g'?-8Xea}bJ]kJÅQ66 Z%/ׇFK l+(!爣O`xؔ!~]Ij?ESy7 :#,#ѕ9gŘ\/62Dx| :MC1]3K?S8t2*]XC2.&^-1 }դ=9B1=Xr/{SγR鷾Mvyg _ EQJWgZe࢟'2)~0lײ!o=}Y7bәW0ylIL óz=+sKX +/c)^&*hy|^вN1/%#쮰 L=]CHmDAՐOi9wBKcL*; ?O|M^){r=g^{E† ^j6qYYAمVk?{YÃ=✽"^F=7:\fU3yT% eˆ[̾:nm,?BŖwX](O`8;".MrwaÒY?)b-(m{2XKc,g^X~g]b~7Ǜ獹l<.)%{qa;62cs9tp'̦T2&\2~c܇>*8ٸ2 X-rs#ksk{Jæ`CrPp'>JV&>=#5glHtGi&l@>ʼ?@6psNR^np_"uJ2ī٬|ιろSʲǤ<b|>䯓JPw[e,KZ>bWڇ8wL|w WY`^>h/#3#ľA=6lnL"_o6H8SHY6}ǴGyvv\ Zg'#Xp@x0kG9pb\Ku?Gz૔܍} >"eE*7 l/ݫrr^-X~$7!;<`-p9{!#klGn lWbeGm3e:;kJ+}>$.-b,2k]q0Wk綉Wd 6r]o ]ϽIl Qmxi |Rbĕ_zwG™E^'' Z<.d7]s!uÙV\(Wč=7Jc"nHKqP6́oA`뻴qs\LU\4n0dټM(WkMX#=`G CySIۅ7|"60+ , \plm(˔u{Msu:b7,Gug-f,xpe؞Q FbCE*O:x:bc%s0/{7UΡ[ /̲<3duHy]VaqRu,~T''k֌Y曔cWmҧ(vR?/FAmE7rB/4e &ز6;ѠrfSR?u!mYzDIyVaXa6?ٜTLfe,c"5TF)~*cc_֓y:8dq9e0^TI:{aAj!n+xJYi d4`aoi_JrC1N9S-et Hĺhep'=wmd&Dh9/#γyݠ2If#˦9Q42g!GrGΦ//1  U3(@2 v_ΜwA|ے^/ƀ}];A44\{H©   ]b});&%9"(o) ;ϳ &YZXg>o%m6خW &u,g[c}г &wǤn{*il o8r _. thz%|Զmy3n5>dzFŤtšfmHܩl˛W9{7 RAvN?Ƈ^K/1sK؆b㉨_4mfC)}.[m ypJ®mj Il6C#<#V,~x+{6,z7 }05Ha5SHFq$(@77U2yOA\QwEɔ boKrm sr_)lrs\cƏ:b-k}'͇W@\/xȗuheoX׍ecҟRv2v$J;fa ! ;;0i1j\E~}/چ :4_'d7T캭[M=J=>K6UA|}!=\qx0JB,ڼ'- 4s9^_l MBWpT#;cLw[|hO| oR{¿ Ɣոhͥ\,M7yG ܻ[%{P.Uv;ċ'4PLM:NR4-VH2_Vj6f[O+hZE߶1ʦi9"ΰS38 R}}!Fx*ިM~gǕmYDET`bќk:3^DZh g?;aumlڊMrvܣ6iHNo @u@{vn=J_x|ܫPLR-~IϒELĽ`/p']%a gW2φٱpDI\-n?ke6"0\9>vu^`µaM"bv,~Y$y ;4cmTD !~0YƒDY&>ES4+[|fq"|K~ 1fl"f|";A`b w&:fslc@7Mym3 ?ػ-rV=Y$^%kş;/ )˘LwN,AϭKnDOrYw&ul x5YNG'1C8WaY+}1QB#Tzb; 0 iÁ{2 o\/܏?9| |{ p7EG`DLQ@;Âa֚N  ʦb^`b<3;E%)т+Y{*}P$ *Uz轃 & ;*Xްco9sv^{y.y;;;;S g0b?$g(Yeݥ`*'9֧?÷2߿&pg:d~93TucϲK[BӠt $9ɐ w|6oq--:Hq)].L۶Ugm 7ưE NmuсsDR{肂tـ.tn` $~; ᆝ6ts\|L#>&[m|6x|S^Ik6ͳ纇FtbHԹjy5d~SdIa=eP4 F_ ߯. N=&!x^[+N mwΈ1~{E;qsֻ{09TKopfkuItgZ^ٶܹJg~vNS$jc6Dّyirٳ㦢Sj"O).V>l.Rv-T)ڶjQsb;d-aȁiCȤoow;mϑtŘ_'?1urv.97F.re?琍όgk}Mv_ެ Zkx̯ ꯎ闁8ԫ#2`L=̝k?~V)܇4ix%!|\mJ3j@^arOVHeE=闩{WLSdF|k@%{V=ޘn_YL^9:~^}D&˷XWhzƻ>XMC')y-}@^{kg*)Ƀ*3evϳ^ya~[N.]_^M廂qS>S(mČOxjV77!U8}Z-* Q4uv6Dƫlګ|%W'~֏ɂt_],fKsh e? 2rs!gG[><BtLs&W _>N[EgB hUӜCa v1g^.|Ձ]ۉ2+0oh 9+#F[FTGOJ?,/m!<T;qٳ6w뿠˺!\{I;Wǽ:i?}`dKǫU1545'N`G{@̟CӶE0"@Fq<FN˼]m7_A=L5/`eaƚ1htAug621A+{҉zDt+l^\6П-8TVz<;c`uc MT(<ׇ*˴}?#$S*jlN6b)9^ s0BT6:`nc6yp=^NV^'9$cł[N_0k, ]-!yqsYn 䁱12Cb+ ]9lߋA[kDS [;֏)Ƌ\ nO 8`nC_27ylN.1={:UNU ڎzFb"?@Ohb(˰3ND,Ò :םu_$U'\Ž :FFrGY#~T=>qĽO]U2-oMwt^;:bKR΋;{ dzcX6{s.O?6Z/Tu:~!MV^*eUoxW&gf&j/}3M2x}T<.8(fr u4cla2urG0_ldO+7.bהkrf'G ?|W`QDY^}Ig\z1._X>L*o,C t|(_m/qQ&[!bzGWj?Đx0+ukc'OCR$Eg3ge[LGxm )ۛ ~j⃣Fi}I\ޠ7d56);8>ݾtUL*}JĞGM?Iaҥ%>߰ t+aJt2pP|ҳM^ƞZαCFx}~G}ԑ^i-+5ShtEUt-;^ѬQ4>ą·*}FyAKI=CY_+o69IӢVmA3JK@lƧ 5תXSMI;/W IW̼*~[b>{sc.t~Ww+s}fG(8@ 6Ƥߟ$aϳu_Wo8__x.+<:KUp4wK,<.«g b["Z(y]%ͬә>Zg1S%1ϾzvN>떟z~aa` [s jyl]\ۑ=>Ia{F Y=YFϽ|AmnYǓ_ϫ Ssemccq{d9׾RHGLuנ.òk_?8};# ɯU  +CΔA; \u~Xq_65u/\˕<{O-p<K ?rX~86M~ ae(.}߆X)dy ڧWNw8Y&e9_os%BȽߞ `"5v]x\FIgP{T?JYo 'Ryw/y.q4<ν1{S0sib-n ӕs ohYm~/߯w>C9DnJcO݁hj $⇲#˷(˯ Ν/'$x.mEFS0 g9%`/&mD {N"IÐ\ͻ?QB[t]3??RQ"o^(G e3 1Ž 6/[ b{_4sds<=#q[)!T ~?S)fe![sJ=_reDϘuc23+e:@?N|Xmv4?X1~Z#g˞p 9=:lc~:ju$rWlKmz}揉G6" "wy./c}Im]2tw>d8Xo'᾵8rn$52f'p{]{;*(ٴ\f}/cw/:axxLvīT cU|K|=(!E@a RF$sQt);o쵸^n=g=w~?:Rd nF1#Kd(aQS[jtvY˄ލs}\y Rgm{1.!K9%1'׳{_UW~ѓ'reH%m<ʟ򗏽.Ϫ.'p md*y<͘ٹ_^ԋ1/I5a1_Do5xu dUjܳu{, ǖr/ߖe;o FING.+Ʒ. E Ix˭B[Q,ƙUވuEhQL|)9u|eISb|ʜӅ}'\-x }o >N z9f}!e;߻n?U;FSz`̭O?ǘނ^㌷c wH0ᄻ[ H}Rhx{"-ed.fY,3\>=h-_!? ?+'+?)dے7Q)v992! ,J0m۔yq03{$ʫ |'b%ZvE$(rt;6rti I8 "$E3ɴ$ZJ}lBAf0;#i ''g0ܜz7؛k _Ј*4k^#oK/h%~=X'6:s<VP 7(12xҷg?4)O|rj֯ul`ZAÂǛ2|tc66w߄@9ϻ -R0hOZIB*P#wgM{ZL;ER?$~yqx&s֧L9"ϫ@%<< _0mzGﻆxOd>Y7P|tyslҙύyi=%_yT^Λy5C시Ayd2,/>Gk?8/#GǾّ|+J~Lk*2ͯ":b7lĶHs e9ҙFV:HcRy,{EE*2,v+2X!"[*2Y~?[ފL߮᱿wFP YLf1,Ͳ~9}xo =(,2A~R0S˯x֟WKi)~- 7Ȗq?)6A>:"2xҟ3qJ&ex` |ο;d{kBfކ\,v`³eoSpi µ+? F|A韟}5sBù!5"υ}8U܎\1 w #D\9sMV+ŌR5 ]=9̧ϖbn3nd8.1mOrerxkkrו*\.{g5%߾s sCM+sSOsy4W@/'pnZm.еB#VbRq\/|Rn<"ͫ$Sc\YQt-52miP^;sh'!|3T'WR[;<׮DY?S{5fҋ:89a}s=sq,z z| ƽMc\Ƹt&pKo1UyO?3`4XSkrEOxwGƄZ0W-O O=˶5\KAށςȣ~8sdxPz[<)*1yEc]){AWA{1m}8G0R2gHr}{3y^Ϗ1OWWoSX[7wU**+Y\L:964=OUK/*ooǦpGt@yWUՓ5;*O@1y/' {#{#E~EߐToz'[]M+Y۷Fۗc_zA0: ߡ~ŸAh'Kpe?ҘB/:Wc>خ;J!L#M?'6)w 6dgY{ITjBqFJ5cRف5-?JvIsLo;6zKLMU? _=^+9Oq|goBN}94i5ɣ%'q4hghOQZ>GB8:=h:(3+:| e3c\pcm`||}mN: $죍v4[ mȔ`"=Zm cnUзVg*h˫ML4 u"߳r̹L+invu5,u+:l9r`̑ Wp.Gnqps#Wg=R㓬A|̑j5~kpnŇYCQI3|{uyZ ] F\QC5Th0KwO;{W2hy]Vwn['kE٭Ƹ?SC9EcL?1 Ƙ٧Ӛ!Zƚ(k`!1.B?d~ q-?gVdtj*8<{-9+07.ɾb g >g/>2 ƞ@CNG`5y,J* ęB5U>|QXC1<$xP7@ޝPP s/t ޔ>eKZֹ;,@,U-32)-PIZǬMI1J <ο0 f>:@/"|̃ˌ :[ tsҀ^nOUO{]eʯNiϚ>[Pӆ Ow\gKd>%hF> vEԣކ rqO܉d% ^`;PmVB]x<ǀW%un UQG{ڨg]?]Jlsoמk|u]8.#|{\ma,k+8ҍd\07.:Onv;jdõF z`4,`]%屮?c9\6@̱ju> >VK5/^O訋ұsg8c;=-sa)eJ /#vdZkn\eќ`Q_حh^|AV!ɥWIy_bڲЖK3onGSiIK+4@O3=^9>5;u<"Cutx;y3'ut~"1?hbY.f"sȭ̈y;>yKۚ'~G+$,S\}`ދ/v|̓;ovF3= EwyQ06 mL01~]\Ёck G9(eӷ i$J0t3 [p6M1t0؀5@i oe Tr`۶JǮo콂o c48Zh :dC$WhW-8ɋU6/O!'\"eC=C6=[+>(뢼G턯-z''׵Gt$om؎qkcpﳛʶl("ܕxPꤿO B;Q]$x?]I߻L4" _Hx'᫤ %@4ܑQ[ҙ֝k7Pv_5dr=҅=^ҁt{VqzwHBF,c{q?x:F* wiT/8DmOǘ.<N{ +\zd*_}]?Lkq>N6tГm?/iT+9Q|FWŠM>M-t?^,#hԎF+F\hԣ__wWΎ}Y?N̴sl)9?=>g :ի !sc1-ipT4X<ƚ zܘ׶'4V]׍UCCaU;p3`Fxcz R;9 ^c`thkLz >E ]-rGu`Ȩw ?t(>U1~A07?e待L=EQiM%t1 ?#m& v;M7%܁"_ Fgl{Oiv 0}Mxe>"_)!_]҄9+\_Dth:TJTJ!G=!W0MdBڼr2՟#·"_5w|UД.W m%ܺ)Z ߃M@T^zbSYf~_dM k!AdRg7/ݔ}W߷ ?,Dnt>W_e w2YJx_WM9~{;៚r.݄'\UEd9s]M+ !.Ixd3ϪE"ɼ"iߚXyXs,sL?ḿy M!ie~e<1Ls0M5c:\~Tk/Y;9Bì:{ob<^77K?}|exC[gScdT(H,9pʡfδl<؜nc=nιÍ"X y1s W1\w>p՘c dmҜsxqkx>NnuH/5g)ݜ(A[s#Rv #~F /kganߕp .eȹ4lz5]ׂjBƔԂ љ-6W yvU̾R%Nq']BU-TvS R0h91m]zi={ýN܋g6wЁ{d[z5׭~]1ڒdTR.syTY'|9&zs=HKP縖CL~;%jX/ ZʞKߥ{KВsu- ԖCr.Es]Rl|$:桖wTK;}ToT[,gb|ђ%coU0N&1R?'p^+ފn+cۍ:d֭x@B'eB7^ j`Y!_- V"> l%{E |uu+oo%~|+!k)!k} Y ™LV,~{+*ޚ1h`c[ L``MZ%&]kkuk-t85L5T55O VښuK洖>G,nc< B _F]e2ɭ&!c mhöyЧ u;T01;K+坆iE3GЕӘ(\;Zvloo9K}G{F+3!d2.ЗO'N{~L6ul2W~ǹ1_[4ivgF1tTWH7lEt>N2t]?o#Eg&:yA3~Cx#^u `쁽q3N&F0w==!h, 4vy{AWz<ﲕBK/o} yoy~)%;{ hOtHYX΂oށ߻w"* 1O=]M{DduϖLg ^Ё 렾;uk{=]({KMkaϛBڳɴ甃(N4*tCbo-A_;m1QECxO F;_ >mW% 1ڂq̵k( NNNxb,_yrvgxM<7{ΎsЫfG<sA q٦ t͝Y]s yξIGvʡ?5΋e:_7~ɀͺNɧ;)Ow,WY?vRw%ktϥA=:"`j.{Wl!qbŦ Ƙ"U`H˞1"w"||%h— -;3 hΜoNZ9Ֆy֙PYS5?+UyW0dOc>κ?%]nc*wuaNܽ)b?l҅u˸в 'Ӿ]tYwxb"|Ց'˹.,@O7.߀Vu3+ .s`CEK.｣=Ev=īo.w_֧aԅXCKvY]NxuXV]yM`u"3˃] <54xߓUewI_*zB"/|҇O{"s:w5bc}X~P@`Lȿ;Gݣ;<_s;{}%?U[ O'`,?'n{"r^*w]5^"x'|x7Yȅ)3J0Mv9|X\NxO}fV~Td̓W#ks!2sFF{< y=2<=^4@ qVYRIYJxG7M>ᇺqC}1y 9s@vMwS9n*T.ZD_y*O~ɮvg]r]t`ѝic6]|BݙW931_,h.{cwEnWSd.'{{r~ ?9e@'y{Λ9s~):^GJxU+uԠifhcڴ+Qh%Eۀ_wf> ??oE`X785?TZO~Q¿H{ߕ6(a:=QgC?܋kh<&AA?kl3E^ V.5= KUQ)2>u݇s5xpm>>$^.9n=>|f3>_zk!k]Q6ևu2}Ur_ *}kW}Uܱ/.{=c "@Gu̽# 75Һc*ul_~mu_oy1ȁrdl>3^̫`sk_gE;/v^ޗ/Ϋz8z}yC7V·C.v<,:'yE,:}Y^Sk~h;d=^(Wїi =ُe3k+b~֑ͤ2wx~SЏ::'I?.Z^S?3yA;zܻ#Џ)|w ڿTDga\vTOl} WS)9<n)eeG?~^?C5/cEn?/Se?scP8*ڨ*WUUW_I`>/9pa0W>,9%m&W:s2|//\_Cx͎fICíoT'Ss/,*9!2 xvKSl~%{/ӎ:Q;/O#l-A4}0 /3ȔNSS&#Ma&wӅLj}#M_Ոot1髊1q)u_v|{`4? 3 ,pAYԃK͈]l{8H@R6#Pvvbڹ]|;rNW$'"݄ƞGWg]>MRN½e?Ӊ1'y@9uƒe|P=+£fHxl ==>ho<pyk '6Г7'|dm OLxJl;p|_W?}ǻ3G̰b:YvNCvMc2$|/` ޭ9"߲##>@؜ \ϭLWX_ z@t ׊yExȕu7PfU.k;eCn9&9K0^շfKspiuw?7˸8BT~y Uj0Hs8S2H\ RуئI7eпyyNԯ=]ض s=О e\Z??u mE\Dգl"z:W^/xҖ1ߋ_9w |IY&N A*:AxS STÓ슧sA?&{2yqq`&|~`3Xsd ?4h$gK{f>S:ɳr>/7mX9Xm2=%3+?zAKcKr;]?Gy=s9yw;7!|@xkyF`+_`"qI_XSub :ȭ#!|K~x<̫ vf2:22_\O:I!cp'ѳ6Dt—}yXr/mV7Ƶmh <}e/r:!|91ۈ!|tϸ64xU9rОw~J/Hs^`tW7:P_yPwIC7 #^f~̥[\5ԅf¯Š%ac]?s'wK#sP gFF1 :׽.sy0D0LxJN yttڔG~R5\}>yrvuz ?#}~p4qf5;nkw_osc{o0mVq`?oŧ] 󸿽_q}x}oLWXG?ns*w8B去Fy }~{>BcWT#R?/Gxh ֘P#{ҏ#Ǯ?sJ=F*h7R}zT:1pF!R)koE/w܋q#;7^B7-fdj?sC1wsf+ >7RHֶ;MlN[?x"u}lbG|{̧#7Jɩʓyw _tPGi>Ym>{e?Js4F:<2`̣>xy*CG٫S:F܉5W0| F52Jystq}(=v'Ew[};}{}Gml4 m`nkLt $ V /qA\G>l)%bώӜ﯏Sqr!l\$ע'%~'4t퀣eKF ~ISrᆂn,<aGp]!]8U0\f61|e̿\A8sEP}Y[z\mG#t=Fewva*EY')h}t\p[6_2/VRmtFG mi6`ճ؝ 9QMtesmqDwJnؽ]lu|[wv">5uxGGͦ>,<q B>M.]7^cЋ6qs<'x9'Rt ϏW {{½W,6i_H҆x-o;Oеw`M"|94 fMs&0rӳʳ]ti[XpiÏA6{'jZs߼ XR&Zu2Eg[>[g}E>ɜ_&),{RSdoZ5i̻Mw\ǼLὯ!|w rƞ9zosAw? &Fxq^^`WM+~q;ak)>JǢ-ݎR@Pߌ"XJM]m f0~ێDyˀ9BMfWyf;bQ|/ѣG /`śc,(&{f| cLES4A)RЙ 2/6VuL‡MQ΄OOQrzNr˧x":|6L Nsl m 61箕5q;EnMDYOOyFx7 uO0#kd}!¸ At '2FJS`}c~˄{^+||aSƉ7'|r,&.OxcsnspO*||R|yۥ=ȹݔ Oe,Mo%AԄsY'dt@Z1U}J᧤0^'EhЇSc|G MUG*Dyx3.UGKgRSc>97Sb47Y, ~,]-:c=Sf8z4Y@bu^D 苛go=dCB=1Kg)?`d_~,2~ xӣ&:c#)A \'OW?å~׻ '75+Gk>w ?Xz{k0?EwЎ<^8[W:fcjU'Uk6;l6aY~L޳9n~3f6c:M0ϝ-1^*cR0nq?]0r?[uADwϓX~)ofc/rn6e3e\uf 3[gl"bxrU7U U^6b_xZ~氞+z9۸m S^䈷~=n5)U7ژ樽g w /SmyI}oa9VI@wfY/?3?(Y|qߙrϗ枯s97>Gsԏ9G4Gewhϥ;&/欄ߙv0<(/NPX)c/}'d9ԕi;ޱÔ3_ ߦ?dž<7YR.nD.(?^fum[\ES.+2^Be9YmΓ<{.Y'U湹Lk0O^%Th֗}'_'y ]7u"zVlcx3p,{$w"™I3Nu3d"؃'^zɻ8FsjI7u WOAӬnRr?k|/~M??r|v20H'uOg=Ϯ8. |HRrn3KxiWBjZC7c[~jx|uy<& 7KB03I~cAYm@eN7VZ&m@ TiBz-H'w /tHb^ |/P9FHCy.P~AĽ~1϶r}`Թs Ϙn͡Wzgy;6.e%%gG;d7'#{?d!3\׉^TRhO"ˉ.3Lr;cl.Lsk/'G0G-b}\AGIG.>CN_4t~"8#uzFx[YW,qwuvx;{Ĥ#~Y5)LOs| /D<ls4躋5ɽk5qb%[s:,V%ɾr1gkC'-%}xܵX<9Lx1ؔ5Y<9vbg_-VϋIhY`޻:,9Onk&~M5k.Q<1I#Y>wIX({e$<ʅI>CKH9=n9182eDu $~Y(soKT/cY/{Ief0FytW&Zƨ!B; ÍifL,>dC6TХTyK^[*y >Idŗ/5R>[Yʺx[25$uflXzm&^KǴ2ms2)/^29LuЃll\O;]~ӵ—6I{cYoL0 F,j'3 |na\d\d:F07Öp`z.^4}YG -\.ז+y'>]o+mmΥcItYSy37v֮Ǫ3e8VmGm}eHcfJR;߱Gx=r>sfȘ2[!е9{~&<Aya_=V]!/}&HBeXڳLuI~ۖP"o̼[!2[F&.:}Bc|.^1/W F*KiGUG_Ajۤ,6qյ 4+{e&plV|F~A|R}~[>Lԇ*aJt#܈p$fdG|*#J8b³ZmϮV{|Zy/W+j=@Q"U#5*Fer/vkT"{}5bg7:~^qM(5׃>skL Y>1]\os>s LIb0}Q9 ?"zk5.ZeD?!;~G$kY |Z3瘲Vs^+b)Ur\y`k]7~6#DʽLwe|g4s:ǏL}I[n1{VSׇ!tzȔ~l?Ie -|/3.{>Odf1+=Le,=}]˔6d[ξVk8cKC9v[[ez 9 g|׸2E.͈,s.+}gd@/wW1(c_2cX67ط|9 Es a:~6hd&.V! "Qxu+0:'ujWNϔu 0Wg^< 4ӺuGL3gϕ\A=Wv:ܵs:w:>NE KR۫ i ٴ-^la]NچOgYd?j׆y4>2Ci=ݯtz+MG{^ڴG\ǯw۰^iE 7gqAӽ n#<ٱg ֫#ŸF5;hj?=O'Iz 9N8#>Tho J#*cl겁TA: _3?bms]}7rUIA l[Asm>xYs2JfF/eM\ ׇ jxdg퉕qUal5PͼG}=sc|?TD'9_I1|/ 6O6hF u62/vب}ڌ'ld[9ިآJ#Ь%=ջi18G.Ѯ(>~úQٵQ{Qbl=^;Løo|3ᛍw_62o[f&s jlI++G;Up}v4,]~;Ʋ7{:pÓO8/C뀒X3.9%#JR*A ( *JR,b@Qr9̒s *9H9U;;9۷CuuuuUuEs JU`Yq ̆H5 "nZ@ݪЧ=6q^ϙ^)j|bzPȈ;?yX<*3ֶIKEJ}ϑn۝V3;z"^{(6yLb]EJv|jjRr+u=9Dax,s"Kr缏rxߴ+ʤIFvup?#E4ӑ2'wP;`^9 ;ҳn[Vږ/m"{[Oq ܱa" C_V5ҽ7=z-Da5rn7uPp91e#\ku~.R-#0G)pHc&b^ /EjY¯D >Oz^#z)U+2/tz̡3QzoBw1 v쨲oU:lpCƑL+|Fz-xAG^NQc ֣|T6u`: xq>O#ۍ4krt?rynv2ϧNzt@:}sw00󷢄SNG:J'ᱬIx)*Ix)w>pcM#e |L鄘鄻s>&=βMƲ픜Z?əyz'餱~e$#ܿAeouR>3a{NŸ#9p1_*k7&@/1F"l=6SK($xBP_unH_y 7ꂽ/ |p.צ G3E|&Wv!`WbEm?Ern.:u]T/Uyx U|PÊuUo`\uwU^і/65& {w}cUwn.ˮ/pvvUTn_c*MM骴<ԑ+7v5dGWYl}md{ fA o8<4L¦\72Զ1s;vKvofL){)!d՞!|M}n:&5}׵bLw\׏ Tm7oK8 ${ rp7/泓6ytwuSnzΓݔ:릱wRwn5A|_"ҙB:Hg^;*HҷM)pX3w.tͺGFchwEMxzw|u'ބ.gXlxL7˙u?N:orդ:"H^Lc0s6_I!6y/{%yq,Cy£"]z$ԇWSWCm!W <u~ml󰲩'&dЦ=䌚uv\~>#z#O}ECu63[.S5~>ɾG Ov0OTU{hL=ԗR!x/(`VzR>gXkZ|[gxnD튚Ywr(#oQ% >1y!yA ML?3S'~k')pN!<)RgC OM"p0S=L;^|ga< L;\BL/#e9pڞ#'$"", Z#\琇*A|yxPc<݆D_}Ov=u6snEk-"~_n"$[jS=`E(k%-=5ޞzAˡ'|IE!ڰjJ|BO=?R^v$u+K<^?y*gz}WXz wU,%Bҵ#«Kk &4M^<d-}B^;Ho)[e$}5_̩=܆j'P]=u{vYEEo!G& '[X{˜w =^$c#\P:_+oUVǫv$\h_Vܮuf8e1wEw#癉Ay nʐ˒ǬtU]/X}zucQoi eo9{>z&G[ir`GG<y܋Qlz'!cO~(Ʋ[ck8a>HZgEv 4uI4'] |%R=8 eN4ߤ>U\)vt?9ߩ2/p J"*˿K%tW!G'PO<|Ɲc]L0UڬY>',/{K'y<`t5ʍlԙ)`O5U' H`V"3 W6 4 743x<[GwIyPnFRw`g5¡L.8LxVi 5̪k乶/!|-h d_{l븝'u 3ܷ w /8^}]}o=W/e~9a݋tkxp'q2z2(,KTI)Shģ,y M% 1 ;OJc&J""U =<>@d~n8QL%X*c*'}G%׉4@tndyZ8:ߡ觸SZ{GSR1o1o2ZuȔ·҆񭴞7"g\a3{}Ӫg.=V=΍߳l螯IYF}oy_K +_8"?PےaEf|ΏET@xp1:Pj TFȏGqZ|(vV{`V/+ Tw@yg Tw@yԘ;GtU{(w^V'|f T^A$E'AOZU80H# Gro>EK Jzh(iUA2.lz[F3h<<: սiw_Dtyo:3Y7eXfCU#@E 6|70+'F:ު ]%kaYm< ń{L&ʚ-_`z&s;K.h 5faJWfö3;6Of/^m­Dp/~mkppQ8\ml~_+Å3.efʹ׊_;g3 wt8#.G@6BdwFw7B?{gFH~H᱅GJ|FJ?RF֢гwǭJϓ}%*JoG!(9X4JQ('̗'h0 i<ډDgI_V[{7#O;.j /=oCۇ!Cv`{ -NAޙ~F=QnV=ONWz.ZF#鶌̱7ۑ~mS";c;Y۔/е3 9Uy̩Bw7VԘ2V9ux̩q2 98S9z̩dN-'sq2W`ؽq)uHTf^a2-}D?sl{a:0'$뫂JAk :WB'@lRٖ[t\B̈́SOTΖl[mVK.c2.׉zVn&eQ~͉ڗ'[L6w[c=9rOC5MfDݻ2EfjDku?V?wh;w9Dx?嬩}&<ߍCZZyɡyߝ"=$޹$/Gx'ɷGSY>N{(-3IߐCIbC >S?>%NFBI{Z40 8 rԹby2E;OYezjqxn«'ggNI?F%v\'&sM.:"&˻Gf,m/Ώ*ԎI(25>|,Ę*e|QYsu5Owfpj+TW*L JYzk{fnpzWSNq/DMm"_L9_. ?퓱j;UeޱSm3 G{^؋^5w̾cOGjʔÊC\ŧ gSZ4y/Yc[KXs]YpTLӄvs?zy<|r rJ6/䬣0ҹ"g~'LiB\M?1MFu_=kR~כ2}#4܍H_OӶ4C٘}}m{mɘ-[E;NKWy>oiu j<ע ˴GLS_K+=v6jh5YjJ| }75B߷;:ltVOS?-L'G W]&=0;]O;*:7}r.:>9gkJxj9g;>9g ̍JOٖnž2>|v>9g;OC *Atꓳt -ڛd>@,}_b}?< y"<<)DكZKp_P<3$~/S*(SE4CS_pS3gi)A+ \j?A3)SOhaZi@K_9!ר3dn#><f3ićXOZ[+ol?xnv?f)3tݘ;Cb%Mg mg'Z_ (]3$Ξo5rфH?SI*(B[3OT)k$}N,z`` gSgbM!-a<=|]QO>k>Shyb`8K&(se&O3NO ɹ{5sD30x0]>OD~>q#?εeu,؁'3nsB_iFO|4RY*4KujMfNc?M~2KnRu|n:K 1v3$8ytY,]羽szf؆6bgh ~̙-?}9 ?]`GG wy|6|Й'Ά?=φdŭ}OWa5(W"ة+u-NEg.!0^|̊\ԇp7ED"½v_yGGGi&G^ ܉NeYA~&>/Zbx-uu&o?gws<~taƯf=B9cf:K;G0=f#qys>s/^ۓb#*Syߪάiߏo0ǽ3:_-HhE7ԡw{sV\LG .۔^m/ 7ɉK5Ugk;Ica[M+l#9&{7f].VN/ЉTj靫|$@x{*w,gAY\4Jg+C +p1Ur|VSb*_q zye ؒ}3r>X?Oe 11EЧ[y5H_#v+4~BE0g^$Gb_[ qqZv'">L'& q 5:g,{rڝdzȍ2f RgϭE2?l{4U~^mz?2-vӚtc[fL6pQwK,>nMW6Ộ'/g}¿.VlUCCC(^EEv}g݋©x\Z,6(<n9[kx/ |3 @Y=sֻ K-iJ~Թ60;nm+Mt;JE;s2GYeN^q8;mzX{KDyykΚD%Kd]~>HW ]ԁuwb{̗b]=;tѢ3}~g_pϴ3|zMۛ9ZJ,儲Kվ™П gƝ2(3d 2{ yf=_qg8'rSyQF;F$ iV!ϯGu3wny1Tw lbMc.U5!`{ԱaΡkK2c`O67|nnZ"Z婒ѡ1'ox JƷ҄2ַL[0|ZaURݟW)+y!+¯`L iWՃ5g*N9?(s0 hY:b̦'ꜻBm8!HF?" 9w9^odXB¦ʓ.Jo?-GϘ:큩3(ŧ[ڕԏ{YVJO-g1 'kn_!W|ǽhrL0/q*9QFއ[WXtޘN^w6}KwAk^+]}̋niRuVjN+ZKn舿#:'AcZ}&h }!MB/VCoE[YXO-oAR6PG}%tv m-3*g.ą`8~Wa="\ S*d{8^/ҍ`﬽4>\%cѕl]U"[1IUg %Jst*;8VfU7A;* <&F#}v0ڙfh| ϛrvߥc1we?MpY*Zg?Nv+++[4= 2oek [V+_b~1٦e j~CxHwղ|כklZ~VhjZ/9{.]-r3Ͼղ\q/H!6~ycٓ8>KL3GE>%B{_57a}+\ZkԆ啟QZnv>o| :L$<-DFXjkT>F!?Fx 7y ZgGkq}VHZ } " ϬfKe_7凉hck&Y=ީ3G3T[H}>/1Iﬕ-cGxVО6rx\'\y çnk1PnHx9bs80ȑCDsnE b]4hE[wVGXkZY'3k2(u{OK3W6`։ٳ=[uWΫ~q|Nu(Ӷz.v13|c4.esJ{W_tMmN|_u:ŽkGS>0m3]S:\N׬MWs㈷k(unƠsՖzfe}r9Ul57ǦNI@-V~ u~'>&;_*9?2co<;A{Q.=pq)8lZ/ŞX/<%C g6Yu rVϿmuk+k7om3羵Q֜7Yu"-(gmʽrVc*Ih&-&>$$$M[(f-f-f>uf-f-t{(Hl[$P-bՅr-Wbخ{ⶊ=ۓ[Uh{c=0^-ޕ~4c^ݪcc:Gl_UK~yV o*t\ܱc\تŶf:4wMaEC ?ʱu&)I;6UεMyomT}jeg l۫v2:IK}4:Tldz6=oHoN_`[w~^_OZsu}#ɾLن6t900`۰?c[bGi,넧?V?#|o[ʾez7vGn#olo1ŶSf^)a+vՉV߮RonWhm]φ0W5^cqv8i]Zd'ʔOx)Crԟjyi|4Sg?خ׈(pY;=. ̋BDZcpqla'sh'm'u|;LDs 3`'|s00z`^`^B `O( P͔O S>LwkS>MۛؔgԦ|#LǛx7^l'ʔOx)nS>|}ֶ'&]2d>21wNqȲS})|ՉճS}z yNë$ ̶ wvZh h3yL[٩߉{a5u:VPSԵ|ʲY+ M{:KFfG;>m3^*u1W;U/2xKĝ^? NF20C lb~xgK3o1!uϼKϵ v^gytd[O.+,+a6yJrX#? KdR;RGD&oKdvtNn/Ʋ'}4iܾXO]r?c#w9W1/1p/˅\ȵ&/٥|0_C^z7 ˜(cV$Vr2?[hY݈iNnɄ<8a| :v]wrzKen)M-r)9,l ' f`֮ro=s*"Ꭹ;Uwtoq{6?+m+y>e"{\e{`vOd0R|CS=7=:^Zg?QW Z#f[89ڱ^~<(f~h03g`杁?Q>{Y|r܇Հks6y_L/lʧ |MޔO)/^O[`k<Y ,ng])M 7~`O| yv1`LY|z,6fy` 4hMW o7o'|ޔO)eÿQ><<K3߫|e`3l<{`恝M|ǟ)|+Mw 4a''<3|, ``' /4^g'˔O)yS>{|P>|'/gXZ ZȤQvKC[9h5'_YX9Hnb^ǯMet |'glgw{0x¹7ofRI<ܸOw}ٱ}/m#|EZolҭXƘl>zzW\ ?##mG~H:עwpݎOÃ*[lVUzVJy|+s#jT郃*7}rPM4MܴMtMMCtH|Tn*~@C*+U;ۇTVj~HeVTVjHeTVuHeJtJWI> JuXaY;x.N0փ|jZ7p4><7.E}`ߦ`~Cxbo`g| 5c ?6#~f_Pgz{'Ys3kFYJsD0WA9<"|u"ٖj i~6Į;#8> >{c iGkַ}9um⏫^q'>D*O<.0jM]݁f>;@Uk=sU$_s3%'Z2r1z\dW9N=ʭ:`:3-#1쀹^ہ.]q- ^A:8`l4Kߢ'\u/uBb9ᬨ[ ѐ :3 gOf/ eur;I_˝ W˝On_t~ YK٘cXv&|gf Y3gxn8O=bbOb #U$b< pi6: !\x&kp!\LD µxO Q${| 8tg^\Ɠ2GEzCGO OlI2w=,&|d%S 8%!E==OA @S.[| ័$ᮄoDx`@~#e&\>]'w _nC6pO¾GYg. H _8 =xŸpW /mHi4$<|dS>j^S> e>E Uu |q𝁮-_ {oE8>|{({{[6q3o쌮-ϨlXsΨĔg?%2?y|亣r-H[wFcL +ޟA}^^"ɖeg3"%mgT$Nr .m&rzMg|ڴ{Қh.3>eYWmg|g1W,,ҝUH>VV.Yw ;+H ǖ~Be$gCΪSj4uv'g1U]*}|VDv yt?OΤqOΪyW,VC籟pvq]Gݔ;u|[m⼦lk\kc9v,/;x1.|ZaUAkw:"sFsA7^~}Ϋnȴw!5ym˓umj<$l frQS+ͦP2<ϿƷXsk wg&:)_K5wd͉4V!yT2)eMT9C s~w% c11v_r6X[X/X}nF·͜oc-.xgW+Mx/wYm7V,c0GΘeOz<)MC.)Q>WcmhK;8+ gCk>d;wjηCnz \Bс{=.?#4&甞*w(3oy\n _>+xD }ԫeTja(Ha,ᨀۇgbͤq㺖xqַ2k&׵z=v[.z ^'c z)Wk.w_"} ޠ߾M#^\ɎeY ~/m>l?+4'¯3J۰?s?%';PݘA e?n- ۖ6lp%: plcy<\pހyp>(3U}$eA87/kO<|sEp| ߉s.uEǡ d*̍놺SaWdr~ϧ\AX$M}/5QJX2/dZ6e2Dxx,sD f7E(ۋXX9<Dkx|N]yr&p>?KO8*w?I6u;]~ʂ:~ovb=>35s25W Xs_\(h~{bxl _d}"Ul$=/|UhEO.}UkJիz_-0fo_UGQSw3=c#p`nfWUؿ:_UPSZ?{IbmfM۴Buǽqֵ}t}6_l-۴j6ڲ*kR +Ė|m_úlwvp\68w}]}=3_S̼1`pjDd;/фDҞkM~Mt_&Z{d}59g2A3\`+}!Uضm:P[4f1¯]/kjK0dZA2OM}I d5kp]0XV? Q:>^i%`s]?9ԇm&\; no{~Cddwׅ7Ui@-~_t^:%S;!WJ߬zp=ixuxf~`AǑ5'8Y'~@d|zx vb <.?~/}n߽2|DsHvC?(&GC#?ƻnct,U&M|Wk3z7ԞjO fX/[ܡgY=&u| ö'T֬S^}C7OwtOgTVzuAD PqhK7oӦO$g_><+HZ73 0t.pSi4J!Ob`\4Ềi0 #ַZt>d+7OHgI5nNM/ |M,M=SSVT 7|eM=_YxSwV[on`߃'yKMl҉SZc>FL7dAgY{Ё~7ۓbwx^iΓuh+Ϸ%Mp{h̻ADN`:3oi|9RWK_yj=,=9v-na[ >8tWלڷ+O SB|;7ZcƏ ?f&H~u^0+ݚ[W5*wwe pY/Wc{;2vwW3jP"YHx:yYи}". Opg3!&wXN .9\&Ƅ>ׄsݩm5p{r7y(6&fk'Zj˲s/}htb 8D؀;Fl?(?$qU{='>coڷ ts2WGkL}r_}KGWyշt}-^oi[Z@}K{>Ux}$p?}kyItM&>K1 ?Xr h,ʌ)*Ř2[@1svFLJ̏u#=n΢KO]^7ԭ2aSW upݚYu ֦2xXf?ߎ}2(9.棵 җ@HmiNv'LS7U#O&i˙7:7# o >6wvƽ)`j p<  ܆pIf{Df{C+fOs5ʀwm'W = j$qɔI>\&a_jg3c߂ƫ6?y=E s,XahGOعp ¼"a")p<Le;YFF[(T¼Ix2 zEI$w;\<# yK /nޅVzlpm?/uo y<2|wgT1۳E#_s ?ϒ!=;g(9H3‘v ldNYf)ĞmYonPޑƛ:L3-p _#].%'›Pzڔy*&;DxtHy#tΔg#IZ$,f.}C[a/ y| {>9Pteۻo_F]y1e|{)]͠}+"yȓ5[y|Ho;$Щw_z>Gьoa3R0iYw`"{wM> qߟGJ&:қ*!{&E:0қdp܋7@#I6ϑ۲ܖO# k@~@8"FMgDDN`'JsN#O Nje_ WJyND)LkZz,J վ'>y#}ul2ژ;ImC؜M؜ĻCcΟ<),1ʟƸmD$n0=氾tTu#gCGΥY~߀\ydϛtp^|4ai6O[)Mnv3:>oH] 典0ν8*bտ(p3>m ?b0קOxJ|Йbjzp73ZV|T7IVbjs?L̝>h02ԵP *x/edLrtϛg݆kMrds9'}2O_ &q~Wb}닖LMOS(Z%WAx~ <^${ׅ,~"JbO3>XD||mzzӁ[|mmc[ A:~k]&ߕ=ƛ$ \)ƽLKw!lOWr@ W Z[c> l>~29rψ:P w|O3=!3Xoa:Wb\ks@fix3ѬO?'Y_R1BKܷlM8{+13mGŪ7Sxss_=u++z!g~bEv6cIq s¯85pQnI4yX5b6c4pMXo]'Z6uG>~<[aȫo!ֱ䟷5\ Eo*4W8qB?e,;,w7Set>ax˫q$-[6S>*Nlʉٔ1#w\VƸjp?qV8-TϦ]L0޷78!eHLuV}[kE["_q3O3p#Zc=8L d;v.<6 <1Ÿz\1T!u SobHF@6YiI6MM9~hiCҪ?=#Ki2m:؞֛$+IsBZKN{iUz=H'rHyFsY_xMf i׭))ʒ/鼮UT:9Lɞr|g/Sp 5# Nn=>C؋-w2>K>KLInb%XœkN֔:y6V;t7z%s^1n N)OzoQy=2j?z1fUnڂj^2Yr!B$g*UUؓ_R6R6.iބm0;iE{Feu9DNbW4T4P ԙp/`߀'j}ֶC9^l'ИaC4#>ԮCFbNOKܶ}_^*;_uI/r>ǘBP:2fY+coRƊeP{21Y76L~wp JL~L~''_ڛ!|Y99Ef1s˨G2޿zъV}Q#/p6 l|ߺ biT_hlL{3C3)nk˙a}!N WMZ&S=a?ћ_;QfF]S4jkIIa@&/gȤgDŽo ßMTs-3/&Y05>o-8_&O㟏mp 82y{!Cy8*%(:oI|4Ǡ6gQc?$]@ӭ5zᶙކ^#258 =U]<9f~l*+視d{7n#|؉mvphA0nrYtye Mqi,e5.[9W|Jb F2 |OPN-J蟑u2{8:k2< 2rqGze߬sOe&ݿZ9ګȢ*d ͋Sw9mOsoOvO`@`F,$\,j mqd,j/爕紕犕ݬYyj~Y:{,7ߋ7hUYUuynf5o,FL- mVvV9ݭr Zk7seB}3W‡|L0X }NVo >Yeo>wѠ1>Ț9Vlq`7iy"F.xHX[Rߍ!N;.ө{0֒hX<,pl.>?=oeS16]Kf jA}ƾ+ٔ' 1 Ԟ00yO\voRUfMIoc| <#(مg]xq]xf3.{_;믧{vمdwtمvH.WJ9%ݛtVwȬDZ /\kRgG/K9R1}cfMs>7i\bnƸ}~h GsȸT,<17z?V{ iמnj79~4gG׬5tssjMMܮz>/7)^ ]@:ۨ#'T-6۳>߽9&\-Jas =s<29:kԹ 9uv̙9 }ٹH=Z~&&y4ͪKr*?YS`>¾X9O=P?`>.|ΓU>|7ҏmnq}od^|k z]rdL߯Pwh&y)C.sy:ȥsr.aYK{%WhVr n{om2g $4 >.[u O[Zn魕[x+kH'p3Հ[~gloݸX~ulVe 0kan<{|]nCSpܪ|>}|4Pn#cJ0®$Xrh qL<6d10m-1[?NXYv!?YqĔO =e;!Lع8^0o}#c8s2 εs&4@<G m/G"^n2&yα)/{9ul@q~kcPLL£lgb=c[ UNJ)φxC|iBe7b~/[J'zUgy=l_خu!y@;|p }µ@yf>ʔM|!_ߝYɧ>-u|j7kK_9 s\>o@$J<۞]R@{D[q#];n3+S' |Q1_X(˖ DLa^ Z=(ztWۂ҇[LOໞcί{[G2991_c蟏蟏V4^_+h'770~ ;s҂1 oymiF[>򩑳-lhK2._LW@ ~hoR' hc5VXw\n"-r]qvD}G&A+O|M o|G~( /`q|% ߫WR=|ƱpmQt]m][\{Y/Gex|vxTo RPg9 }Ydֺj=o: Ubuzkл˘Ud_*=GmG]Ўp;3k22ETP벽8{>L AgU^γw)q ڷp^/76軜,Պ=>Y}TO3!θ7qƽ) {9l4,!d r9Q%AtzUzJz %zPC'" D,(*oٛy. }{evvvfv6zBeǔ9ox!x*$6]qӟq^n36,DFvKnʺʀp=hy{Z|^eG;9u,5~ ciq,dsJ!F<pt($F1D/8G9ɀO1 " |Lخ_OԒ?/Z^H֌8W[OEy&v#2GLm12o73RHۜ=v|ND-,RAW*+c܌1~TϖQ;~3mZq1YS3AQBt1ş}NPnjȆ"x~T]?{KWY,*]*RBןj%)v.A4f1osCJKax 0/["9;' %d,&x 8gJ3q2v>E$w\ʯQUE{\n컛:el[6eDoS5?=5zv(_D}tDMQN> { 6nJy{gP1._`EFv p *D)}nI|44CIϣ_ebQK͵FI4ܬ1V3}^Xf{B?3J<#ay'ƽO)򎖤esM-I|Ų3<_2FwQsIj>)rlkGdSG7,TJ/ϥRj>kYJƩ])u*%^{yG&c, J˟W3KJK:`03 cO Wc܂}[JtCK^Q)(-{ьrlBwi귂4g.-g!Ra.Ji9kۤXZ--gmǚhG*-$wsgK9&?L~P4e^l^?2s?Aϖsu*A"VeYFN2*^j[2ʈ?H2w:[;A &)l̸gM82,_'u#ʒf<ga9ZVV&2~mci"cWJ/JoMxw}YGY,'1]2ߐr%y)\N⻔tTKE NGK9|f$ m<徝˸Eo9'c,Gc [o;>-?q[n,r/-Cmct\eD`f ss͎17;ٙq>CԬ<έpK;Բ51{e-2Gu7t뾩u\XyE~yhfy#-.$Nϙ ~@!ca8"V³u=+Hd+1ѯ?8/-}ңB42T6~"7ؗUL673{+H̏cy{q^ r[}~Q[/3CtewOPE8noT$Kdݠŗzy(jEp=gF0fqE^Q,]R1vOw.+ʹM=(YPxnGg{OW|A_eP߾SѢH[IΆ02#*7_%K_q2FB-8vM*=ʌ!oD~8c8RC>C\~/6nc祀sy/m/aC3^A-c_ExKڪNοru!5Ⱦo&.wE*8\aHgҐl/Y6x}+m|vQMNӳ.W}ȪNϽsgTuz'vUe^v־ /ʾ &#U"褯r+ZߏIwQRGjdY9Y,;jpVNۇc_*-((so5?zĴ~1j;NGwNu3MuJʄWt=N5sg:˺38|?Ω>zpc00<ՅN2E ^!|!.b a!j`mr65y ^o9*wy+); oOy~{I܇)_O!oru7Gx3;,;}R] |5,} JA AHg9_ ":+y*3VmK?[<?[\ԯA8ZS嗖G*=ZRZBs֜mcۍ3c=>jaۻg.F<ҩ8gPkSS':/O-sak w tr|I_+9 ^V~coԐ5BokJ)w蔫):5j9UA?ק^IMj_Ծ5})='5QW{;M~/v׹ [^ni'x=PXx->L-9ci+TKTeuZKs֯%F~yzג1 8r|6w*!+k9=2?͵$VZ+u->VKbֽYK[j^z-_nK x.W܃Z]B6Ookde5VC ۛ{_R8_m٧]tIk5v;j܎en/cpqmie.Xjl g{"?Q= LmWy?R^[W0$ Ƞf~ 8u`8Kua=uqƛ+،C:F٠ܟټy:е=|׬:7\O\q:Y㚵1כ͢v2-x_!cԏ\0Qzen:䷁:\x+Nf 4 8 p'ԥ; aI\..-c9;1w]]`lg|t.k>c[]}٘6 = %Nv~5ثLRujuV]k.jև;9=w4d`VXD^zt(AcHzH?g8b]'&z0mĤa {zrTeeZZڈJ#.Wz|{WټU=xO;Q𬇐c2>;'b=ao?O~s3ϟ֣K1|fɚl+'S`]Wz,1.3O/D_a:bGc;]/ih{g\zq)lX2\Ż#goEϵS ˅ ri ^կ/:ր s.(Źf1HlT2.ןOq}{'I߀f e\6X8ѻ&oy-G!j+ugcVl w×h`[6 *S"B6])Z~uƮ\A}kzf]/m d=@s^iK<G\NQ3rx.~W<GE{k`э{~.ufTwEq\t|MtRfz\uyq^a0cm]`Ds55y1ڶm2FgC._0F p`1NR i.Eѐjn,n;!lأZc=ޣ7&?&_'OS } 5} &Dr69}tS/1&tePx  R?ħLsI&bCE.~+3-V|&GQ{m"r.$LFlKޕ럽,ؔ=7p!S1֡^S- mvj*`A mm*i0MaҁisfS(a O_Tx:ʩyZ-xDȗ'!D /-_.Lk_Tʺn8|+NKֺ!!ýp?p%ˣf1r !Tz`_/{@/9_d[>#0ͽ xorhosz3Ԓ'q~5cO40b L|1^,s7F.܇ ŵ߸!r c''[q?\xe<p[ΓD'x2@sOA^D4ɔ)SӀ?zZq?5p?Cdxj0MB&&p,N:9iw ';o[<;s~4<=Ycx yLgnhmnH6aėI?XK?zq<x}D󟵦<|sYu#u/!y/`]B^u;諼.-?_ߗ\_l]/Sz`Ӈ[U$۪`_9I{ |:נ=u;N}]y +ܷ^os+Ij/Lm(HVf$zɊuN)u7Õ)Іd+-VUڈZöFt[>>1w: L?96rc}ƷF(Fn!]eh+Cs=Ϋq.Zw̷q+8U8Moڴ%vV׶߼($nlVev͐/KͩmEXaۏXqIpޖ>8/ۀzglWtǾpV>%(Kܖ}K7񳟶 MϷc?V3yd4ߌ7?sڊ;};9N|sͼ`;a9'MHe!}W'XbDY10~4UZk~}VuE>p'r{?7CdI>RWxkqxJ8l'qaZ#I}NtqG~*/?P޼vd@](/ؙc;>rog=RtyNnOn'eP˙nsv:+?yΟΫ=a;V]N&cw0l.rڞҭD(Aos]g=۷qeeFt>)~t&t&| M4؞hnw{&>l'OI7=;n0g Fu Qݥڪ1`|)/@>Iiņ`!ȗb'ƻ Ǵvؒ{Gq)7*>#MLQhQrtylYC32Y83*T)ݑnGTG߱΁(^ӑ ?EH4tv#8X?~1pwowݎi;9_$vմ{g,6=3dΏ,1x<]q[;}eJ_뫟boü0Eɖ[+Lf`.uC\^:pu]gGghd@Cl1lV$x /OcOq~Ooq98.1/71:GG|<t#az@ٓr1|{OY\m'<'Kt8]b?;t7ȹA]W"I/X)]3w52 C pL ;o;LCb<Q|8EX :*tq.bGoj"<1 Wn n]g22KDӻb-vF8viiwOk Zuu8OcFkbD-^tI4ǟ YE~NE*q &, 騃ދ&93UF{LT»&cg vUd ]e|pn~?Y\v05xd:we׎ipׯ%0%W^*u?S~y]yXqU|.NDHr^N_ԧقώ7@z$%n(/VŮ+mH;wdzyUͽݜZ}X.g~>.v.|W\N4nk.nnw?.6l=r|'+E ı+ G\-? D 7) AJwPOCMT k ք˹d%#Cb~%%7Jq]WBw©bZ0z`;ǽ>?jb{|\v,=R?e1<&#sؘeӿD |jqCږ:ҏsܙpx}Rgca)x2*Vs<[r 8]OܗqXΟc|g| Z%oe\<<1bxhw7(nZq.p p 8Moc::p䝀28/X9=pic7 x<9[p~42f< x8,?D>7cxoȲL+-c<3$s>C79Om5c7 [lz ?Лcx𝇕b*ʣS\)q.-s*Mk~ݿkc341wc(?c(?rp|a΃QvvzѮъ1DSVgAНRX1}za#y1"l%ň\rt/d=*^8Oˋ˳܎[1c _rnsU?Oa|8އu~#q>#qnv$݇<|r:$ȉ^Wx_Rn%W+miB&7<]6{ OmjoDZ٩/g{2FY7qN+8팾b]xl+~}!}jr_8X+񳉀2> .W(&ԝ\O#{"]_a/_XθĴ24O"I~նʐ`f?ًkR|iG??e"ܑ:u֍1r2NgJKV:+9x0kA?\'m'{te?׵n7)[)+z#.ڱ׋ߚչJy'* O}>yY_4֭?X~^$>ͯ1Sr}DiO6蕀K0m<Fx/oxEo|ڟ /g2KƘ\v?P'_(t7ss7dr?wvѾg]>cZ _/9ly57.[Vn@p՘[}M],)x/18~Xwxv$C6~cqR~ge e~NQz:jځN 9LGo~$d ȁ;<\`NOk ԭ:žR;ߜ$qL?hah@( 9joj/_ 6Nce~d c%$:,;c~kw~ xV#ٛמ}ޝkou9s˨3s:8ȳ#8<&1/ٛ*۷̫ Toƭ”=e#`O3(te{qo11l3F!FtpygJ!<"s]O2 #nγqum(ůbwJJC%]-ƉN^~c_}#uqCx6"zE2XQ1TP7݊ib0_G\{sܧuyܧ{1P[9ߋtZn3\+9p~!=d wU(DoXcٶ3鰎w>QG Ӏ0 Jxx0^ς^Rg&3ym@o!}y{v{ϞaD!av]E5yί?Lֵ)ȱXv4U/`ˎ-;p19󏀅!p[Ibip.:F]tOٸcQ|)1ÉG|߳?\|`r~}G7` X x8WB=)˦M&r:/dz-É(Z<3) '7=Mb+^D{!`:eS8|~T)1~c\5G1B'm#-ƣxF\ʀ!x5Be@d?7akDg!gUFF=I#xc4o"U1fjw4ٔ I|1 ϳϳaYx90m8k$%Ʒɶb6㬀[0 3む0.x$'0x61nx-㶀w2qo|H21o0N|1q"ovǼ@{RNC}!d%yB&y2N=NRLQ16n<"{#ݭiou<1 ϓqW v9g ˇxtWY}%2B؟pG9Qć*F#>clCҌv:Jq]̾ϓ>%mG?[d) ƾ[8WW;ڒOzlݖ9 ƥ\~ƱָuSQ!=:.6z=]cS.Axlh`2qro.ƨ9:N*?x|!iiqϿ2NΛD/8:߉?NL'~?Ӵ|'i9h;N+ OɜT<eJ>|f] e|WM3kVuLǓ?/ O31d72xM91<00&0> x|>Ned%ճB'7nf<2}&&PM8n}^<נ Nx)+[ڧ?@7&L10&4}Ė ؒDn)'`tcg(i_2Pĕp*N'~q'{IXe/YaqeȮ4y"N !cԁ~':[q!NtʼnqLSD;e<;h>D~o3~إ $: 1hc܉Ǫ>FX`+q$_c>?}N&R%lgɡ!>¢σγX'~,~H{O& -~1Qe>2Q &m$$4Ic|WiƉ 9IdƓ_$GmSbtp.b&ѾߺdFIۻa VL뇀Wm|F$)r^c$> ,},}d>}=Yғem9Y&i-GZlc@zNb3Y3 Oi7YEE9rݓ),gߞL1ouDɲ_ߟl^dg"xcyAДg1٧70oB۪M$AS^L?`3m gg] jz`7MyS{_)9aoL8о/D_Bqn}M_CO"hW׾};C|;`OA{Chxŕ X0,$6œ}t瓇2Ƌ<Otuޑqq_}իc</~Ix&Lb\pG睦C>ow:~Cw"ّ4Czy|!CgS<Ԛ&y?ssb&Z`9Ke>8i= Ϭ֖xmy(^|4Nŋ[rV,87MHæ|x>iuOBrM}><ԧL)p .=E#=]vS,ޘ*>#hTY >hJ\w^=?9Po}UE=u凹_>qx,:|pN;kL{)y$VGMO{.):a{DS_zmC-66h8l_L|Iis.uc+׷y=SKwA}~J'^LcgOt>٧?|Pf*[]Sdb3|?sR;PbMnw:Clov5bgPQy[ϠaVL Ƙ>lƫg=,DaH.n_8ÿw 7 SB ߙ1u xM++> 4o?L/=32K3In VY m2h@H{ufٝM(̊'JgR|ܿ?恋ؚ%C7L⃸}1}yL⏃Pge3|\KڃyEˏ*<ӹ39cINt?kcc궟Ca鹿2.Y˧3ia3O3w,,W~6Yv[qiyg|v%g_vU+=!Ƿ,;|]eo^e*39| * Y>1E+f/Yr0y?<1K^ż c]W9i~mӱXwg9=`%L4nXP_^U7n+Wy1yͦ`Ζ3""x sbL>Ь<1'ֳT.!5+6Έ#o-Y=-1 5kCcg2'2d]M!ZBk)ڭmyoF[1$ПcӉӹDW_¯Fp#5pK?S&~[U\oxzq8c$&iWc/m7gf []06yf[4ޓ:̞'sK'B[} Vl.:('OOxrnUy4oϣsszĻG^帇%XtTt¤a\L44$AΗDx5A|&\k&A GFG{SW+썹Θ C+ "Mx9qI )[g]OOYm-hݔ[_ݫn]ݾ1._T>PT'5MZTu*ݭ*J BxG*M!ˎ.\f[19e7O~_ؔu؜ ‹$8}bz")gg3>׼|ǜ9cԱ iNǙCf=W[\gs_4}.DzD`\ȇtaAdI/?Wr83A3h_I75dsx"'2 =3Fx!WϾ0N 0wOqkne;)XqϧNyp*Y|><ހ?ϱAGW&3s}yb_7Kd1MgFBpә SH+F%Fuy}.333.U>C) F8yoxGgn;99hFre:S0z- Ot)keSv\T,~O3pΏᚯf(\Xnj|g.}jޝt~ȗx /?1v1@Jr/PƨȻBx@ytkB5v뾐ksgɦ6n Ҳwd_ai&=ЋwtfzuLb?a>PXR$&?Á 80QB:LB42~q^Oh i O ~B zm YDgT ?aϘwJ*_lJ/f!hu%h·E Y3J2]vXD{ 0Q`I>kq|hAN1Fxgqnb¨9mc/[>ߖ:Dw{0.k_[:3H_<`,G.yjH[vcVQZi(&ߵ6i\1>unWI C o" a,<^mx1.?v&^xx8Tlv:!],r Iln;YvDO/y{ͦ_[۹\?lc&.~>$JNG N5m̎iy7ݤϲ>d#''{bY3X.{egb/}ޫW=j\"1Pޝ _Buθ~Լ: Zy5s;gkZg)M}}nOMe&MK9rs]v8t/KHϵ|yX{o1Om^~ׯa,gt-Y*3ڹT<~ - r"TL2tۗN.ڎOzu??Cz~ޙ_B~3<faQeZt1| &ߏ~ךJּ-{,#EC=~Fe"'PeeB'2O qWOWr폐o`:]NOLgSrlx 3H6m_=jxe\.1_^|\>0ܾ"a{gq_Y~<SvCxf,cc]Nj,B ]\N{Ul;ӎ`nR^_.p^g,CPљb'z(Pek!4+`p}WhY;pϗgpg%HC_+V1J [ NUL5lBqм5o:l+HﴒG.T|?=1$yPl_e_!v?Թzپ2CW?NR|ӭ3W>;OJ[))RJ +oX)|J7Np'ׂ8i;`y_!v;T?ck4i+Ju])2O +eܷ4Ծ`ʟRHVߪ⿱yK`,f"M"%'V//JFRlewY~DOY/wW^-U[Ldd6;eJʻfs9u7Ll`Wc{ΉM:p=Ck?fpjVsݜHc?gw6в|A#​X\g+q9G=ˈрkq:G܈14\4&γ>cܧdɌq>ӴղOO\-1WK \OܧVK Lj)p5WoP=~⡤7(V ᣁQv{Pѻ]qǪk(N$w|6pTGSfj;SX#\E没v~S)~jC}#|ܔF5\#&Ώqxp{g׈5,;] kd~}F8!f_31KS%| p caGGȵb)Vc2kkk%FX BIՖQcoMǘ2ǯAm>c<7vr?~0n y ڇ+xy~-cA`(cZW/+HjTFWq gJ$^H3["ɕ^thDQI{E%ҽV"[9:$\=Ѳ;$R݇'R t!>wO ;V$y=|bu%Z{X#q>hb*$x&Zq˨K+ǟfӁGy3s$: |uW`աrYu\r#Z1Ni8fސuru;z ci0F{u'h흻8a3aypME_0Fό)yf=FCP[Ok弡k3o˹^3:J/t:\/.KՇU֋\[\%NDrFzZ^S!at=AaַY{Ynm|3DHoJ #}R5aNg/kޫufcyDzSq61wjYk _lsũ类˷pUc7 6ì]WL}NP٥_wP4 4 aLD*wjd w 4@y_qξAy+iY8Oo߽CR@ 7_ ėߤ#@mO/Uf׍R}}3a9Vw+WW(a 6[n;$:*OwUώP t6;/ MFk[(g8Vo?TǁԿg=Bu@FžQYWKٻޟi7xPs7QPtI_<Ϲ}TC?4{Ls%7Y~9tZ .swrb9yO .g4<ۉUX3X<֚YǠM4fs6,rp"r]wA6yOfOw1<$ԛm>u2,Lw{,.NfWu3<+h੬7<-$cU{g^Yb~0n#n寇o=Į$9},I< 7$\kI"jP/y;Id=IIxE$T[nd\k{C,G2F_a U&jA:1u |m?;fw1ǯyq=z }-E-"ǿHG@HT}yGzp_.22o?"p #P{ڭ4vU*'PgB1= 9J1Vj# +;$n#[`\@={2n_ߏAy ugNQ33ifPԙtf^yc~P g“ݼ9 I滛cp>*V?:Sϓ[&}M'{7|)>~%?:K?/s}*d柀s'[άth?Vkk:\}ma'X) l(">J2hm~nPE'5 Pd#J),zc_o1>P 〺w9.vmcY =S>MF 4۝Bv8'(Iy? xvf?r^ $Finק &)Z?߆CN@>W|hqqMu޻OŹ.~(,."'m~vOmKrGWE_vwap?p}q^s_3wH}z !C3k&N~Tw}_A]YP=;o(LҴ;]iջ* '3+'I"κStd9̿R4PfNmY66{4q@2\濪Nf߃payj{Py;ϻ$z('Oa\iv ?=^6}f;}wQw/KU%:Fsv?t7S9Ōa3uo#w,7 F:NwBNFc ;Tr[_< 8Sw3B/vyG>G2pŚ*OHDrZz}QT1³a}^vQ0ã_/ y@v ʨ5Gx7MyjѻE[Cv/k:{ tL-:9T\[$ YB-qϛzdY0k{;SMHxE;OUgHv:Fcs0 ?t}Hs{_N"w>R,* fI~ƸE D=!clGPNd7B]8 Z%U?R Ok|˩痣BٰdYO lbG=g:~ ~, uHG g ̋fя9d{`sr$ә",d2Cvp.|騧hOxtT #ߘZ|*K4._@r'Ye,wc|=7G_Mfgi1:\\$#žڍ:Zfifs{:a;g}#N6oh\4<xyʺYKKoo?dսr/@ݽcdݿ:/^;=ےe^KAz%Yf^늆f&;^q/"e^GhclŁd9m1ƶ`c=cl矌1KO,>s0}T_S⿯@zV. xG}W8:[6VGtY}Hy93Θ6gppLv3xrBߚhe>oM,aL)Z̪ګ5:/e Qe\UYe;X=Fx!*gu)o=vpx};ujrFvxt.osX5ƨq5> /g ˙¬*~e }/c_3)/Wcj:c粋t/1Knac_rGKzhEț9n̜R̛cr#t~Y3XtE܎۫SJai]lEp}z(}u*xn_Ӭ'F"=Iv4ԏA9H{ &ߖdx丯-7!U=D6ߖ"]Cd+T}Uڵ/ +.vD|cGqamyEOQLG?C|T濎QO,uGdx̋zwL{:Q8*Q3:m1pF91(e8('gA?᨜~}𺣲'X-{GEǝ|Tt܇ftfSK<:^?}Td߂oJMG}?/~nS)tfn".}c,/fwxtu[t'䞍S&?ҿxDc?ms8<:&?ಜHQZFGD}LǙUcqJc\Pkoޣ>酏\CߍLat܋㸗:_~Qy/sL֣?3A:R$cô0F3; UcR\t7>w }W-j,(>w/ۋ\/'s$U{h?IJ _9]"\B1')n \%6꤯)>}LgIYv,M<$Iu'g5lr>{ovنm'OOv *NIg5?{pp9Ofɜ,ʟW'Iw|| 3|طoce a})ikŹd\ mj4)٠?lAj.8ɀ]NQ? WC1-YQ ˆ& ף^;D7xGP9?{a5}O 9*rNω9KNH/n *( <{}ޛTBBȽ7l( ;RE, ,X bC.*`EDAAB$B!RjsvΜ{o?}^͞={vgggfgf+o^{CtTf;7nt:/wޗ[r4S({]5hUUfwWTɷwI/d DoI sѧ胶MT~\Z8yb{ץ}757ϟ.Iw ^jJ'/q獝f`AbѳY ZB ȳ[Գp^~[BoOwlP1-6L'kHzHk]t\^ .՝ gBwL55yʝKn7{y^_hhC[twLH0LyjԉZ(6 =9qE.$|7 K72[cBptsvsv7>/`>ZpG@zDlPбiS; Ϣ#s>NtwҸfѴ \J}X:چϭ|c{-_$<Hպ/2B wEa`iD<q~$xj>{BYkgVJ:E8v{kBPk=l'߻m؝'2BI@ / ` 9Q堙<z$ϟ8ڷLߋYuuϙE:*˜Ug*YFgYF ;3r3B&6Ms[^Udrϰ*OU \c Uk*޼GmJ@d`*[^ჰ#72:34lhMx,:e\l,c7ci/2~H4Ek|Yr9piM>O,d<1#+20%65iaeWH}oO;McmݛSަe[ WfIF¯<" eȕ19Kx=MZl0$@-Njʐw'N:\9X۵GQ:}K -/ Y,2EX}Xd_Ǽ~bs*hᲒ;Z[ƨ9-4{o~3v^0F$_>er?dL_ٲ]-1ڶ͏'C62[[5{>MwC't}lKw:ْ(td/*K_(%jly?sEoFx.fK@ YT[rfƍmsYE\-'ml ڹXKwOӀ}$聨V4dF=IqKL%u7tOc%FBu O)nMм9mGK})cth޷nXbqlf| 7H4c[h3c=q*2e ۼWI_@9~f<`S*Kd]^ʿèrn<0y:㏄v~[ iX"rsnGx#8ch?6yrD}e .)`vzll3Q:e#v4#{@sy64̑9쏌3^O;³3/{!o>;=,/ޜ{7`s{?#sGږc|j͑s$.(zLY*97k- x~Rsu\*>.KٮO%8'T|Gn3?7'/5iK%O\Ӎr ӍA4l \j櫘p'1e$a&\u;a=yv+qbn$<F"%-~ܹm-Lgxa5ukb߲Wl0{ ?dz뼗!{',}ם}6+ c^.v.y[wZ'[ h?3{m$k0څO:l@x UnWV`CΏmC%//hA~MJC?6].[F9P|&דen' |˱$z=kbIO q:gŸ%X 8r̭T&^t2&) 9Z2?olmswRߺ4cru@#r Ex劏|iu&$WzV߇wUiA{'Y_ `ԣ ,:s(~+gu\fe@N k]ؘ\98+XbW pk|ȓz˹yb:/Llg#㷁ٖyr_=Oanmq~>'>}.2=`{*/~h,ʪ%%gЇyl1hKxh`"~ÏI.Pz탖l(v.ȷיh w\{]>%㸦4$-6^7U'xv-۠NM^i˰3I8/-Anlw;=b#e=[5u?Ҧїڷu^f Hy| LWq _wL#Lk?[!$|mX;Mrk ={|77#|@gP~7|?_e[X^Bxi56&Lc篐sVz ׀d?96RBXϑ=l{V?}_sZa2]{Ko22CJ}}L<0rFVœ.ZaI׮0%f=Q+MLy+MLof\ۮ414cJc}gYcVy+MLFV;SS`ɩ۫; LN/ LN)&nVoh, ީ(썤é | ]{ !9/99ܙ _2NkWW< ד_;:qVYerhڮ^6nY*R{Ÿ}wяv,;V'Ė?ƪssc9iSyIU.Z%~ZOk*ھJtL>z+P{jC˦ϯYT=U g)+ M7Y} Wn*?:Vh_r' U? >\Fscfy[MYtp%6+69#ƒN/&|}F%/C|Bjyf3Όaz9cg#/#017ym>Ymtbu fx oVϫ9?!<>qG>Lu ㄇ]q#6;g~'5L5R~s&2Pzk8k]72'|317\c$aeR~n+|@°k̼1k\ ta3.61rdyaჇ (&O&>9scD8ky`\𹌛x-OJ/1rTsyW1k~8Oڄ_k.$<1F1nBxZ^G'1F֙^}G3n>4%_򳀵gs•MNYvm5י6 gjƵ 7'<1|es*Ҿ{x:^_wLr(coɏ|r: eʅUp9*5B00L[2 3e1~e871GnńۭgC^.ƈXMmQn=or篫߽wß}p5Oͼj"Q,#c wfľ3>WS^V@z 6]a?V`7w8̾LS=l0x˙U}@l&%9A3G6H^WLu/IX՟+~/:Ν#f}䘴zB>8(>·8WLJu6(gÞ #_ogx&c||½8R/[@?V@xp_N{wp?3Y0=GG=SBJl8w v^0/jLFwm1xZ^Q|0lƄ}Fɑ}FcO>t9~u#@[_v;շUߺm4s֞c9}UyFF9Ar`g 4W4zv6,smUf}8EşbO/1 7 ,辇 Ah2Qw5_.n sj'rzvwG:{= bӶl,d-:߈ؔqy2JO9EbsĈ C'iRd$gKռ,`V$qu:I-[-:]H ` AaEx0~~~s?!^I +߼=Ixߌ"Ix>pQǣ*[WNz1@O}7R<uƷΙyٮPT$6НEb;P$>]az*+8N@t&Uwq>QNyZY#$tFx[o;P 6!^UU9W_/y&3o2ӕ+"@QD~ªX'5Şt&K6~wH hLzQq!}tAaH߻ xy,ݵImo[M >A:Z &ŇjmK"$~jxM"IV?$[QDةXy&.7mݣ IdMb_7Ā\y{.f3߭[5iCe!V osIt f 6f]~+pf+v.%S%vfGoфfapJ#?t^ll=7snTFMx}-]gq8KN6\; &sEųi\<<@$e~nbz4b-=a5'=~d~d"}2Tmieݒޤϋ%ߋ?PrXv/eG[goX_DGrb m&f^eG7S}>X:RBwS 1.A|\y cE09Ӻ0}+_'-328aqd3;{ãd}=6ft{1evObɛ"y-q,tr^__d6.Ȟ5b|ĻrB ٻ'Ov9ɋuU޷$al [LL*"wxKham3| ql9rrm9MH[Nx-4Y㏂DGџ"b—񾲌𥼗"xn}9QVSߚ4V?S|C 4c~rj9f <[h@߸Uvq |)q۸?pc\r^suNy6̓C競9@o QҷGr7۾-!J:o(}}}k-07`O[F}Y c u?r7A^Jy&☰9* RyVS*ල/#Krʛx1 M3^Iun:`6ۜ峩&t=k?C?eu|g6K+685d V.;SNT~@)|onj-S\Ya]1N;6 h eiRۼ_s< dNK߮ |kܱRyg9od pi=Ek 4^6&u=;?6 ƈjR7]OםL[L#KO?˹nr`|{!cՄeev÷}G ?0|C÷vp(᪌k퐻/f ~ބ1/ne ¿|);$:zd&݄!hd=wm_b[ fsCfmRzѓ,?,!w;DC._+AV6[Sl=~i;s12-Ӈ{*+'\C|4NR97|K߀)̝]}kk+xϺc8s%Qm\ ;-ew) N H;̣JR06y.CM*؏>O+j?zԝo~{R;Dɽwξ QX>M Q ~9Oƅx771\Ou :Սehk5eSKb8/%1MvIv~DKdPL?~O7.!x=Cw~~{ǻ$x.i'sw]&O1qL_Kt]ao?K!08TyxX'f=n'xe3}tIsc5:Iil%_T噪k߱ :tS|$YC#p>M mF2>^E[/w{C!eŸ\jX=3yŢyL.mh VѠpX)%_nݘ'79컀,kd3jnc,B0ŷpcp-5Z5dGa~t4}0d$?;.?OuG>#6i@sS˹D6WSvq51{s3Fm{dxƴ},#K+>+6ߧa X.Bs}3V.K3Z&u^'wy'<ˇ3q`;^njaWj‰QoDߦ^0ȟ\"0}?`\nrvIJ$X~r~GivcNƎleǽ g*9/vtzOZ޵q GPl/ZB8pႰsUe='=6oFxcX/3<NSWV{V L/4@rE3klS4sP E3Qf0젙B3s9d҆gp;Zhu<m2cmwp;uc [=}sl(2}c3bưom.mB<}=a0c= ط3F;C:xg}cq-#?<(q_4c8Ll|\;hbSvc(9(q Cg;V3IBCeօgg%4ihҮ Ф]C.@v]@.9.@v] ʮ Ч] (Zmh?h?h?#K+?q%CE௱?xX7I\?W,#~>1D4VL!bH >fZPwe.;ΥGo$5b\LzZ\ޜC#"q6 k$< ģ.iG=jG̼#<ë z"96JܜpUn*r8^eO8aDxc;oN36(DG 9j! |T$HY>*y8jjc ~إ_>*a,=oR.I-6}MsHvC J|hL!j;KFS-dPECf&s' aHb<[1;JnΥ۸[6]*/CWהRm^6TrS*'JJ_.(~_*7?65w/5;By=F~ 8#OLM8yQ2o(eB~@7چyr9rU$(^*3wBFt5Vu O@^ןN-izL ˌeMK۽?̜w=~ePRZ8n0ޛ=1{1 Oo/V~iA7i%jU8prnڔe\qs[Xw^m=c|ǃǍ qo.Г116Cv0ۄ/>&܀ή y;’M~ߟ _§ ?>dLq; 7fxxUj߻pQ{*b;0` _'Ďp wgpl\7(]z&m'dl'ć~t*Z~hy N*=>ս %w6P87۶mAL* R75՟d.g]gYLy/>p=w sI9$NӶm'Խ4N' I+Kx^ &܎j>?)M<ɾ^9;D oX+NYrVOs'GN:yD3o:e9p+%f?h>\A–J-7k~'܊˱>e|j:1FC_t9eS6wN]35&Z_S_F)sA)Y4BN 9%L[NZC 1UwZW;-k]wZ$0k3<Zo~p`(I}sLݘf}(k!DJ[{G~:k1kw-_xFgdZqp01E7)(3n`fNz}}c?sCodqyeWΰٞA/;cu tþ>7Ly?ɝ!-ڭ?G{3f3l8#۶3b1!XwgD(?#`k5A1"K[}1r,]\r[.qߓ9&Zˡ\].w{((yrW{4(]˅ OuT`OKH0nz]e9bW)s\&"rs"+,T7 >5{?ڿRչC˳"wqVrF9+GQrGK_n?YgL`YMYᶝy9y˛;*UX8 tuz2Yx\xw:Q: iSbQǮ#lYZs9cew6R6 9G>[ gnFFM WfRL#RahDGT Mp̼xqx~~>TXYu}?:G[~N?]9 ccuɏe|Whk8[Qj/~?}l#Ơɦ'tސg'<_n]]m>uևO5]_Ѿ?>Ͷ>2[&>ݶ>1f OGc;n䟵 'SC0Rm[p" I_k'|mp[>r`{_ p 'OxOxO''|'|O,\peg ߻s]`Gi[ym}Zld w wIn /m}m}m'O[[T[,[`/-mǓgv<(O&~[!|V'֯Iig@[k>w}f8/g0(/m^ `~]ɢ3't+};9h2'c-&Z?P}8ωv{-MnPԷ9JmԱ9JPns#GFĎRَba߱V?CƸSL'b@xv}{Wh*u K1ƹF/"ƐgBgL-el#c.=CϠ Yw^1,B.%'qyII 4?AClB,b[ĉI -c8K9Fm[u-/Nv`3|$Wg6b$J2UxL¹Ayy|!ń8\Iƕ6#\IJ̈́a텰=@Nxp!py}C{1(·~QI_PMe j+X[<+nJ%˶T0ݕ\UϪޤnUR4sq1lNLm[;Tu]HLez5Kc!|E_Ź}Np>bNBwn?+60O+S˹c11,iɵ'dcj/ǖ#>2a!lC^Da ?Ř^mü;h`3ʋ %vh>㷹 {\,_>2 \;?4agogů :U 91zSF&z8hg ܼ*뾩~WT}goPfaIJ~u:wB2G8Ϻވ:O2\/218C}'voN45NDo{Tު|v}\K8_(' |,6Ƶ[Įb<_"xo/t?ZiEo㻫ŋ} wmU|5'7&|gE}<T?o(r:~xcg>0zgjtvr_N>|Kx59ibo/ES2< U/7LSH*vgC8x_>8g1.V9a>PT ߫vDK%0]x%G[.n '"a Dw;A4`²ZxՇ" >~;N;Nn웍*>/vw__"lCۜ#^Z7_)Zަk(OpUΛ^7gw|!n_"}:cNjL@Lz[z=/J0g[Mދ.oq(< gd;,z| %-VjޯTi}܈ia]Oi\id4.%^cȻM3ܾ~8eOJșȤ1$fDoNDoMc71'r1>Q"&&3-QىWp;+Nbt}EOO$8 ł` ƌ{v]a`{zU1s Ïzze_R0]IfZ9Ds~/1SL9SiI"eϗR{BzRKzדwPքrvɑߒp3շP(0A~w`7DJ yjy=p?XOR2#"6[?uI?n!q;YIr_PjP}4s[g??WA=Կ kOa V^_YFCCMՊ1rQc}crge·F| y(*_"~[Ytʢ^MͦY_XˁuCGj*VU ʻ]$<#*Ywaxo77!'|]q>`f O1u!|q*Ԅ{fϻ> G} %>G]-%tU2JOA$8,26穠m۴^:=ww!Gzd))i0!Zһߧ:ԍL{,yF$/d~ ˆ Hf/1V1q֧~}%|`W8 }y\sr㼯1Jl}U|\qw9cx}jPJY\ٽ"⥃ϨT>/B6zL2ckc1; ɿ1b<9cr%d12]a ~1hlm_)Af<>UŜ7m'y:9R| 69l=OݧpZS*^]|m.g͌#L1 k]M等3 Gj9AL~ؙS匠ja9ksvc1mREJc=1SņzƤ m\&~3;UTZ*T:*MBUoΩ*VWV_VUתc !Ce?c<ܶxC>?mU߬ U7kml||*)A5F2d mK w^9J~E4]dm>X'M{aDaE8>Nw23iFWco2m:kcys|[ͱ{Ђ0VsOj}WV?T.|u<g׫uE5;WUsBjx~著.+;BQgz'bt3Xwz ^>߿g;mT.Ŕy*O2 $r'yf;OsO?2-$c)^[֗ELx!tOӅtd80x dz:T-Bw!iy/98Gh&r**rE:ۉ W0N\nd4'{} |'w:9?YR\v?J5&i=lV|2TC/=,0~#oOt#=ߌC=ߙq/%T{E? PvruX. ޓ~߿ƍU$wh?;Z 3p.?Y$JޡϢU@-˩S_չRi0طo B|^Ό1O^,cW;Zc=m,c#呩\yd wm)l?'| @amiOC,?2[?Mt4 Ɇ&.ȕ`\ wIPƛ9u'$lg,0v6(ޫA^:wM<򠡫{oN[B3Gb3~?ַw6yķ!3ʓp^1.dKsV۴%\m59Cxּb W2]llj=?\۱|F6K8J}!620Cl 3_e%cSh P-ag2FL_(v&c|%ƚfBw.hO˸K+y˟4c5>L#`N9: e;[>W. C"?ғ2Ev)Lщ3E';StNjVuRDV.:Q=W]tתN4#06ȱmhmB|Ob m? m>fI89? cb\L~`O3F.aJGאm| k^C|~ B} hd Cw3Kf]V jB9NBvCi]Ԩiڼ>^M0O,j0/0|Vmm5W[ͥ%7$w) lҾtSo8p8'r[}>LT%~lPzPna{Mzk7dLzk7dY!Ws ;bR!=-[}|?v95窬RNɒZ>79YI9R={G2IY$b#<@ ܴNyݗYCQMjM45Ci 8f[emDDe3$uWCNqA²= m#ʿrq?m5;1¿,5~v|^AR璮(vġ4r#:KrMwO؎I]UaLFR|?7Q$J>/Z咈]%i7C6y}Cr*ADigS]*hj!π=HDC1&в)x`Ѩ1tyxP9Hi+Ej~(} j27u(\Q̺m`d+[te$mmdRh= d䕨Cxژ-b.S!oDc$Al_Wn _=^}[rmroէ#{W:_9;S뇇#CHI<|rDpq~}$=ޟ-WB9S{|wꍷˑW^=,CnV%$>߯VwR^? \}xtwl=~G?~Bm>%-^QXS P/n~!xW7Pnο)؟fiHٮ4|tvyuxۯA=ӯWY]7 ȴshl'YA}_ЎۢHcKnʈ\2} [&P%,R/`vuﲲ_>J\Ÿo[m^n2o]H\Lm UD0h`/#}.y@\'dʳdAbdDӴEYeS}/ў7oߣoR%ѷOD.p+Ϸt~)%Nz|>?ЦW3.o^q5?},{ BѹW͕F"ZL9BtH2\|b{r>~<|s?O|H_527Wom)2OLdoa\&$a9(Q{SS5#ZU"NF›ukp#I컦lU`yt=WaڦT h;~e MSwGhRH1H{vBA&l8ӽH ~ 30X]ؾsm[e)QZIvL,n[xL;^;\na^Y${ϊf>ˢLAfLJ¤ 3ʘGCҭ+jWQQh6VKV)I\m' )9M[D/1in)#:ߔXfSC7Re ޶dP RRױZyWQn¹b0/fkol B\!LIYH!3|Tb'(G>&E)ͣs/]#'$L1*t:iO6U[63.>UXGSHl1ZDB$N v Q/Ye@ - (KK>ub+lYcfiJC.sLwzi!-[CKV:Iذy 2Sp\  qب)Cr)$\!8 _[ 㵀^RIOh/O}i+%Ӹemat2ǕDSms%l;!c65-LKL?d)mIoF4)ckB[/w5Ra>f QfX:['5H:?v+Jvyjev+X#(@&M=?̖b;Nwc[l 2<@!!CtRj&M6j>dn/ Ţ*B[ ؿE):Ԑuy@7q>|=*mN}Ѝ ɯ33k M` bj3'AI'k '/ג,_ixduЗL2#Tm]OawLHS2Ds29qX‘RX]Ɲ51`Ű<H wKet)̥qma ٜk8.FF,h#Qa $0,dTǵlciYXe6n6.9_d>#&^ @q&KFm%\>E I` ?nahCWfݱL*ٱ[mgh{}H*:`P#z? Hr?)~ s0/idfK)na3H*',C@PHP-rT`GGZouUSLp1`M9:b$?)}UֱҩW~SNV9g!]rZ,үaq)Ynݡ_TQ'P0׈lIٶ2~5ғ #ˠH;"~CT4mq's㸕  6q)̓X,ͶB1XUKGJXwc]6܁<" f!%Kjjb(Z)c̐z@ts4>x#\A,x5fXVS>m-)t_q1l.3Xsח-qHPHl-N#6Cni Ӭ$GF8.4Ju/a\2a@Rke޴ 0N%qr(:ipZefjh Q?5MNchetJiN\l0h)гa[yaJx ˇEAnsy2.gX4sݝ8٢T|"5~=*$B17};u$0c Pfj~H+MrYqݦœ_<6Ô=G7O| UlاFRZaT~mX1ᐼ |ƭlHvH$; $[P\dK_S$iiLW 6Ģko}cx *[;.x-KTۃ]E_.u)τKia*1[r$/2PXO*z|,mY dg`]%t%Qai tF1 ᆉJF'J4+4?,uY:VRF;fȸ+dEۿ*?JY XW'3+P֒_r'*?K KÇ tQ&' ,pfXbmTFb`6)GXqd ܪr<#9]̅F= ݤĀV=E}̂ ^2ԯ2X0WB=6qv.?-*P2ʸQB?[sT~z {d ,N^``^OǪsCSi VZK_ 'V5eFn-%1];;rq#5`+oam#e e*H!aO@hSد@C8";mWE+)]b(>ZqdrL^,}!l/$R`p8DGeR^JvM Y>1W;U`*057 .5}[Ѽ9)U.=optL >4rD.2CH*ֲN׮"k8aRSJ;`?y=U*I\lGM@FAjԴ0u-pgMc..Eפgf~u~>Θ\Y9#u Yhb%,TU2`+Mjʛ?^4iL7ܻbC&dꃧܶ~!rR Oy-2!g JdeM+~921n94~sRS QR挘<4;Er[OdɽGW |ҺL4r#n,2b4dp8)CL/F4@6Fv_e_ Ŏ9 zn L9店y%rtBaniRL| FyT-i2B$\127Ӡ I WY^ӄQ8_G٦7qk6M l¿3b]:!Nbg&!v):d>-ň$K}\| !]q5'ňqPkU$-n@IBjfB~uAq[T~7`]k: 1W>sc/19̜&G{Z`L_mfѩS!k\>;yHYN̓ta: X\ˢC,yaeꌇYoP ι4K5=kMɦZLY2`??~aG"[gZN|aYFe; 2ܦ '~u~IqO7dy+r%Dhyɐqf59.-qm'3="! \!$N0*%cf`[ xj-856=o-X<-e4ņE찮uZL '")Lu2xa8$,<@[TR>>d{ȿ) _WFW\Wl0zi#5 x1f`”3\l)7b7sEp5k[ P2yS83u[4L{:_k$`t9uœ}I܏~瓎4$[ہ̈́*ҁ{1 .c7)}d.?hXCAFlp1'VM΀iȒɡLwOG3;`+a%DZ " u@qi~A8u8, ┩(zr[}j"#CQ"&B&xaTX{q.)-HoSsݩc_J122LN!"NnXoQ&|sf9l=O׫!>qLzpqL#_4]pEO"߬V48zf~oWOגzV kik.lN3+,YƒgvP !{Q)R^XZHkK\ʞP@N,8 X, 3Q׃ <0²K]f- M@qպ: v?F&XϘkGb nFc+amC%cNjۄΥ][9p Ye740T#5&AʱZT厛S> U&h=g=kC1G\ɛ/^}սnk?4lk8BI hj@<`h0 Uo:+uӯǖ3dR8YSw{S7 !i8 ^NN`J f{z56Zy{ !Z;&gu^{7 L,AhvMNqa𶨝X䘒 *"Uad1Z8:4WbG _ImC*nK^PŎw$ 3$u`YY,ڕw9Cvq4~k=SS>0[v2:5pnvn#=Y+\I N }*=c1Pc/xAtHz[@@&ɂۣ6C׃mSL-W|fI/FRPLks͹6wؿ:s>X `a,샅=}?}?}?}s:7]aըlEc2^2X2X+R.zUn?7m<1CMG 2gu?ӹ8j gmw]+A9[s kw,bs =^D% ׸[<0Vk-=#e;Y{hh᣶[_jUscz)f5E,; WV]dFGvz&}݋p 'uY'ݩN܀ȿ 0g 45ד,0FZ>K|HI`k/.vJB?@g 0fY@-:_VP=N4>i{Bӂ2@jتqt*,ݎ&F?>)J+ڝ% -гJȱȓ̌@(@GJ1HW;$YхÂnaEFbsR_ࡗ3ώ$2 ܪU) s-lI@HҒT2Knv<6V35[ X;8H;n 1T9bJ+,4r#kHbvH(Dυ:h][ (PLo `Q-Stօdo%cV3of#{[M/C&Twr7AY qJ4H $`aOe0BMМ7>6X 8N%0zv7==c=T &"5?bLF~H?Bh9VjZ2SEz㺏{j[3yLUV9hhĜ5l, 6\ja 0:r}Pa" d@)B J-iUi3,udHZEjuG,ΰd1ȼ2bAE {.B5\ޥ98mb Z<>`=²@Yh`AWb| aC7GPpi3"6/1=0!_Wn[iڎfB%k%9zh2kY \mI,c~8Qa0!*.r,mnzi*Ī8 rBIH cYV Fr"=ir0PgLRY59] ]P-i`p; ɀ\jr0an5V:Zz}a|SbfQcup;Y )р0~wSU&G眈u CO뾚u=ĸ4я5XM* _>'J9sμbcLt%"L>zW̉I&+VJ=xڏ+sT DFQl6ImP 0LIz'bו֝a:ci5ȑ_Q)>nMtY ,nɨX 62az dxD Dz{L  ;L2ОZ+b/ձaЂ;y*0U}v-_J@-w:YÐюKVXwe`qY'ݪTL'^z-s1hӅHyȮE+QWb΁m[ ض>pX -ˆUY̳x_"M vχ^]Aخ02 ;W@pz\F=|*hRYmӠfxF(%d{X4*7F Pt~(GE&X֛ <*k0M=YW&䶉 s' m2Z[ƅ#KcƨGI7v&@GgbH;5 q ݖHm5[(︆:w_ h!,p 2ۢ 3cSyJ *o7h~Zӽ2C)fԥk+ma<_J '+ z1օ2! 4!v 5LXCJyЫ6~#)ڦ#+5Ɛ?%볍;#)Wڙ Q=vjSyb$TfNĹ]RH΄x&jZc$wU45}6 30]NW!xaԷ|XOdn{,(,+%AI6󟳥݃Pf6}C4\|gX~DAW-{* {+9_97-Xdb%(Zʽfpncd'7;~Ӫi!mq7ZˏY I`yqN-o9~X3ãnYѐǼ 2Y~CY|"3%L|V~:/#-sXËKJ+f~Fj5?_ m*Rc6o8.L Ic7u#=ҦDQ 9ȊZ hӚh(RA]*3s @&ިeڐW j}Bl8P鐵UC2}>@$N2yT͆lݭ ~?.V1Ģ/VGm;^ Z$UصĽ0Hf~%@Iחi{@Uv Kɚ|5DzwGj{~*quGו IcJ׺!Wk)# ;v͚zFeou\u Z[̣CR;0b 1q-N"= wHwX4X7h@ILһ0!XĽ%ajސpr#s$&9b5RlzQҋr>-R eDNmO&o}ik/̠{*P;;ωpB0 mY2t *xJqs0rUn{L7^+Fm `z.te"+y02z7M&43|ieR_xC5/\4\k9&ٍ#nG,]\6ٌ4-760>Mܑ Ω!ǗUn_|;<%_]n?ܭn>> WP]<_ |+d:0Ti_5(B ^ Rpj1DahA̋Q5252ԗʀ-8v}?oD@CG:͡ 4<gHpT$lqnl" vfc7#)ҤW}#I?H ntmV(GlU[Jۭ=Đ7 Ď7Ͷ#,ުBts9E C:n{x2F2~>񕚦 lʡpJ߈&M*mLoӡ#6Ua8b3-$9*|N=)cA3fZȆ;ZM+pm  47|K<&]_AryjΕۜ#6BS1 2`/UNӌ༫soXee3+>WNM.9j k°-MAax-. /2 6[A0 |= E]  +ҺfJ𭺷'%{"CJ/@ :WՒWՌT} {fE<0 )@^*NVwe]=Gk=Z^߭ zWuK4%:OEr҇&}O U_uP蝖}Ϻ+&/+Y(dJTKm\ՇOvR%#,0lMyµ!^ e } VGu`'{\*.~6Xĝ|isaOn `@&Ute.TبјL;(6hwC$Q +659 YKp7vٮ.HduϋE@= hAw`m:&?XGkCeOm?»ɸ R[O%v8g.&.Ub~=7WU^b֯K%azŻ(B>oTjE~r _ [*0UJTxT ֎ټ`A0x v g91)^JŚ"C%9/N_[ؐQmb9LnvL#QBDQӡ3jFZ'c딙-o=Iz`RXVP,52.b 'Xpv+d<_~ H-qoK<[C\+mT]/w2R~X5ٰkߧ_zwT.\߻`^ܞQvLcZ_AIS¯LtXJGg9Ori;VcꞦY*;,T*dv92-Lˠְ;cUL>[ ΫHngni´Ń4РfH/j4vL:6ŀ"$) kP_d#¦b̄Zt{ nz#Y[9FMoŴg;Qx6 3Ge>^LȠ@ lL ;>wR }bXm$V:D:HkK ]XMPf4/($ŧ9B_\Ht85j8F{Ph$kGQ"u6]c랠A-}WL@̢PW7<1H,m.]CPX{jݷ:gsz› -!&n-z4BgM*h7=t_O5Ou+t\g>h m荦ODCok 1ˁ:3б\WC.Gz£vH;O%%ljYn4&P |0h!Z`}Ea!)gLvfWN3c7yk쵸(bեsybwm:&46 3PN ]5Tޙ^ehx#NwdmV9x 4:teeͿK]( 9IxN17fU H [1TaW~rw@D$)ibuz1q(('8ӳ1Dڱ.]gg 0።kR*a#3,&]gT]}_ {UB`ϳ7<_}%.u!+[8ĥ[e~㚶ޗ'\UPϥ'|;kڄUWzr7›baTo:D\9v Lo>.YlMV8T4] &OێloQ?Ñ]? {%-WoWMBHVb5̹$Qo.=zɁswΔvƽx7cktiԍd|AF8ө;ͬXJ=h7NTR2Rd:*iȈ5Eg/ObYN}ͷIya9/ޞ/HO^s|}ayxyfA^[=ğ>(d̄lxԣ.)%/5%~ڔM8s-,_ϼ`L1 _L~0w$ 3^+iRb &H:f{"8uH7/ L[t2̿iRmuE WV[-oi,R U[H~g׶[yf\6!`ΑaTlcpP#|Ǝ&dh v\)9IٴKٶg pD'mc7Qo1PI=KwG 2zd7}r(Gz8z߯ GM5uSz[ׯO7nVszOW߼^ou:>|ruY]ǯWߏO JR?0qy{?? ^;@Mzm#~=9}7nn^]7޷ӏ;\lx⏿'ׇ~ߟdGH|~qYjg9rǷ;}z~ anu~狛wD8}|O|j3g#+rn>_]*5P[dɫWGeQeh92.UNO*uߎ/nm:pr5&sM E6*qUՉe}BZ%Rs^0/3G_e&{4E1xb^f'uLڑ߆w!:EY 3l3ƋYD:X±?`坂}(|u|yƔk#!}8Zܹu,4 ԈOƘ%0!'ܸG"Lz/Х$lЧ:HQ@:T>[,6i>o( X3ɗ7=H_OCH/5Bo[.k_l;Q y>޿${|F .& U&@G}l/*^{}QLU/=Q,L:bpS[ Vs[p?Ð8M9j:E5 7Ө3N 1&TlA$Ͱ{qE3ڧCxuY< .žtYEJTq(e2ʨrhkġI8qӼA6T_2®XB,6c;@<988[ETJ 3&XC<:*AINߝɬ 1}sa1pȄTO-'7tZ iWYWM=CU ؼRT - PoP;GFyHz8w;TݙlS]3t2%=Ŭ`HϹ)@#OZ}YCdEgYSl y%0R沄XMe()/c q`ޔk° [ħl5LoqXOJ+NK-MW7FjcT~<\~qB|z[ݜ_otOwoO_W#;~oz_p__]׷?!cQP2{uEkbOQJ`VՒ tle7gaظR' jIaPAyNl#K.zX@RG^ÝNhe%YVK6*b?h}abF!u sgv(ܮEu@[ ї˫{ q}'Ra^ciLXՑϦ,13tɡ r /F~-ϟ{@LJpR!Yt*#~3i8L^mv.OeQ^mS󔍴zh7+6v" 0 &_Ν2޴ylVع/52hc+r1%j{Yna E”!cxWNrK^F:rcof@]˛wno>~|$x?sz7NW9}!'?vWzs 4bYǒQ?uG"OqAwrLJo?ۋ?Vc*;I\_<=|=>ݼݧ_~9OWߪݼMA=~"z>]?^]?}3vN~߯ފF{!~?TzW2ӭo~HF6*Ayv4»2 Xom=upkꝠ°NIA^ /<+XO>(=CX']8P,rAs1w 'ű|~$7¥xMӍ6 Nl#v6h;|ww|D"Ć8~i²we=j@p3//y̗](TG= /`1VdTo,ˋTY"5B0 Y8WE9^ '%4I*ULԫ'W|?u\W#-w2h4puċ` SBjd$afd9I+).;;i$PWͤq6IJvm[8ճ E aT#~(U% h\M*MbԼ-7Y1mf>LO?O11jMDd:4J7QEi eȗ;5Kj+PD@E=HM72aYWiktwX!İ!&۳ sշbvuCaO}mlԯ){$8u_jX)6[XOUR@6KW`nrKˏ*'18$%h\؛(zK)C^m9c_֬.go`e0<~`lqjJ'!)Ao.f@c_n p Y!>()oػtx'ym7gփ{Ϧn Q|U_Bl)`6 i8f坾F{$zM M!Ҋ5^l eX3^JZk Uۣ/KjX/w:ly|ȹ6*P > 4+C(ih]IgXd2y(E`RJô;k0JPiﾓmd3ΟNjfa7wPiAAl P׸+pce_nAigKchyIY="Īk0$QHխ6Lς@:eN*}OS쬇VȐ5oH47tJ~a~l1i,1BFސT{q(e(xcVJo:-=s&MҘhK3RpJ@*֡Jatfp,yy.6)3Vsz^،q 8{mg4xKYbC~{;TCDjY зx<4c>!'M=w\0 <Es NmQ"3u25h @V4 2MсL"BS =QI%~H ,ȎFơXֆH`drT=z| t!) c_d^inbM ;br43{arkxlcs:5y4=qqq1d٬MfDB{GK0DZ}TcNsvEE`(U`)}1VMP+( 0%STھ@D,2#ᮌ\ amRQ_ Vl%(J dY'){kp~%ᫀ\mb?il(/iRlC^U u (*(}-6 V=6ƇRxRcqpCC)3V ytZ&戀cfI}%o9x/Yo?_~="<>]vl<49_}zx8"\}="}2};Ć^vp{s| .ˡEd9 zvA'7Oב; ᡂ@YHc'Mz>&7mK]SeM+ םjឧ.]HܡKjƻ2vcR- 3f]-]CBх$iNuƃ=TH/< ,0ºV4n6?Sɜ54hIV) ƪEnm|YPuW8|K23.UCݳ47\E6 49SÌ\6F#Q@i=wR@TlL]ts.y0m&?ئ2wmxKUp+J -Wa,g*PT]Ni-(g>!:;Y2sm҈@'4tCį!.)#6x[M3Sr;djQ@|刼Q2S,戰Z1-|p90ӳi Ddy`Tэ/UYB|tkd~b$?YDkzbmZxݡ|F^U\Vi)[ qLd3r3PX7aGy ?[YL v'0k0ߩT=N9bTQۓYN%R{(9RE{_dEA?aЧT#Ϣ!НY4}Q]]ķwkW_du{TUѵ/yvyQICw'WѸQ!7MxrI9Ł#I3GJ[NO3.#9:G3TߤXNOzBK%DODr^|54g#Ύߢh?u%Ի :$.0%60n=TV9}> ʧ#GCL$A; qF9bY!Fڡ̑d^p.2dތ)4i%T! =!藙WI}Z \AuK !*r7wȽ YBغ~P0dzb։^K@#M`M NQȸO)vdʢ8;n d \ q 7OF'-UXҪܢ %IuuY8oX+-*xXh:;.FVL(AȪ;d1 *S->=̥ ^Ǡ.W,Hgůڬs[J"*n>2,T3Y"KV:"G$M0u\|3332A<&B3!|1-1N~sjbeVá!dT//X5Ix6 R +۶Z<(Efe0vIʦl` z)L<jE<ݢ[[}>&h£CƨQAC`xG$$>TLG%' ƛ+. \;f.sڞ"͛v>ѕTJK@.QGMdZ1x V0JrdXlC>ΦI8Y1 PIW[1x zJ+tYK]@&iMpD_0FM'A]VKN6- ,'D ̩.9Y\<Ua&rV ŽR%OE0s_^B/@z~[]`*34(|V@*ƒ:OǬ_-Ad@=gu3@t8sn@f|@* &^e3۴l.qdn"w8>8tx?oTe2pS3PfzZt [b7 77s@]nnS~\Lxfy~nw9&8.XBiɺJ*,S H%V,5T]$MTm_ȳP2[OIb ;&*{5ۦc> ,~@$9!O\G~Bıq;Cl?Fg |UI'x:L8q J=_aO=. ػ,]Ξ8ʌ8oۙ%KA{~Skꦑ}+VW5 4Ї:L&հ2 ^ 2lW0 P$S ! $-th?cQ%Z@Iq?% MBnmBj£Ï6mjH "E.婔 (C&FeTEe[֡\d8C'Ko+Tu8늚jw*س?@u0j"QR&Z.AJ5HRp.!<(%䅑az7g30ؾ@iB1pY;Bie93MI\-FPDHfDHR+8AOvXg?;iU/m!InS2#WC!xNew `x$ԩ+IA=/uCo*Ľv3A#Tla,RaTqCP܈vPj uӻ[;H,8 PPltƩf PKxJxҼgU}Z4T05VC1懛1I|:x8 c^؅ ma GLO-F~ 畹Q*S|Eb'Qa4pcߋMa E%rwiZ \jSvZ$or5>t3&$JDF/,05&SqX߈A|D/Bst4y6=B2ؚ\91;5ybĺU_VrZ5.c +hBPH `}>χ7_;0DX LcNY*|< zOssssyt d?C Y\ bFD];af /dʇ}E:vDؓ{h~ʼnJR@xy8_?n~v]z|,7d귶$s sQ|j(} ״jm$ڇF^aYW,h&F7P:dmJEHj)vx]z Gr5ݕncfkl먱 " շu]g;ZZ:!\uuZ<0UI_^kekD?dna&0~+DEah cU,3 {A!'U$k;~]qMN%H.l4q I>W4|Aqi39J 4-_|4;aDA{/޶yqqV)#1eSIHLEnX{aħB- P@n*)A4&)JmْVmm~0nbT(G_ȍt"KaGHyǬ ܜ˚옢-ؼ"["X~θo= M5徉*aľs1R#5vp\A-`m#@I)4&NR rXDA>yyU=?]׺:2b|*ypO/!Ɂp7Ӛf 3jnnv^7Ɲn}.].nrW$~Dꦤ^,0Dek3qhFX;ȍHVh2ǺW!Ai`kaX5Zs颼9aLkR(J(Ae]Q(WȊ$MS3uP(iP/TeC6PMӚ:>J2]d~;uD~,U*K \|bI[OǏ@ l( qFv7΄&o~폛GUpB':0Ĉ`Scړe͑^[&y~U~~Ibymиgc^Bt'`@՞ydB{?{"ѫU ̦ a[lbhhB}lu,i3 bH32" XV"7dk&B3pg/#Fbo\.XĜNWUr&&0C޾ގ2!5a$d5ׁD'd!Q nLjjP8lVچVYr,,U[O*~Vq3/Ͻ7EpTFNb8 E!( 5PO(|Δ-A?mЧ Oy+5$qW06^&M`C+0-3=H WCى:uTpQ$}du|}3*'6):uLߡ˿"[~IR&fF`X.wpq6|M }ae#"{ !?u${Q2DU-nh;jX$)0CqY Uq3[SU(K*>d%"!Eot(/TY1 vgWJ9.n05f-1Ɥglɘ'yG8ΐzIbI o MD'g+"m#Ryzi;=<==]+$:)4ʣMCh8;m^q1V =w{=߿(Xͮ`X 4E5{-Xc|LS(fzٳ"bRA;p7 [j⑉=p-e6"(c:czZ .xK)Mg9XFb]'&k-AZoa!{Ox&(FSTrUycY&I}M4ز<F[sY_ p%4poy+&ؙxa U+ 4٫U *pW46 c ٲZC\hR庳<7VL/U` N0ATgL<6X +< A(K ƂF֯fBR,1v9%LW,昵⨰Ό],q iƚ/ z}R7$_//i%rw>]l`e411:#mm)Tgw4M_-`%oFI>䖟 ʜQ'|%5:JSG>!5} +L)HNE jXl9/Q"ej|'o(k8l)Hw1Cfz5"w/QY/8mЬ,v.Hh7oL h-TCdy\yvm0 CdӮU.w~xmt?!<09@RcꌚA ](ʪH/pۗ,V")&)2BžS aMY? JV ^A?IE{]?CaK<3 [U=7b_70mG8i~YQw`l{R7.5ܖy#\ 2k[TP`V̕M`d'Bs'TbX3b4Dv\"`:HeȚLR*FI9#w#Cp,u ru>.[(¾.c.$0@ RUZEKh %r\oT%1ԋZd|fJ:0~#Dkf3 wNNR/IehUFܕ̾S6)L91Wkĕ+䘅Tmr6O)bM{LqR%B&y!K.?7jBA{{\DE_b(M_!{Ab{)+lJ\NJ SQ,0'ئ/nB'@ /^̃1=vF; Vbg:BD,EjznǶy|ƚbvgZsZo^%<(yee@_3|̿fN{G]\]ϾN_;?~ ͏ӡW1aFBzzQ:~\\?XOO{G >֤1 65kRŧ+& |#B+j<1.iVnC'¶J,}䩟V]t|(TA6wqWP\llgBFD,@DY}%JwdΖ^Y0ۀAW7C^fOJ-~>0w! zirz1'߶tEy"--0JQ#dbae zS7|U=MJ~-+!I j7|a0A\{ .$kwзZV'"ޠ2BE:& -xyJ} #0w^J7rf({ݯֳR6€me|bUL"{Sz{vO2\؈n]^665#DNFu1b^A4w|غ0y}wBNaEБtu-6O 5ؓkB(eeeohS5G6rgCw>m TvbvZ'"B4ئPCS*C/msqvO'7ߌJ+Àɡ#q><T"BVbXVDvu p;k_ݑН^8S jb~ᾝk/!C XywkpqGWoZ75S> %'i!LvXb.b/oE@ !) "rbg DP"A/lo Z05wz~l'|Y.$ X=^8Ƽ <,{1A1| #vGXC.j BC^X|t~uӚ&c[ڱc3~ d_"}؈՗{p>b'H>9!hte<JE.Ѻ (OMxMCSۏ5j// ):?y=|<Fd<9cL9Ĺ4#?[xlJhux'\ۡIp0iܽQn{2s $S܏ش7Brx?6U%aqIh*P=;T@2f *[mu>0`ns  %YDDvҪB`&`SnDFX3E#wbڍjTz-$2 6z(# 4-ނx9h줨駈 B 7)E~ 9WlLpЊ|U/C($n<<#VyVU¬UTk渼vKor*/.u?/< wbO{Itsg|jg)%چ\"hF ~ $|-<92kmT/X˛f/o*B@c«rB:g=ݏA~<#zqxV|Oǯ߯U?Mџ߶ypZ񟓚7Ij.χˋ3S_63ϧ/ CJxtpFN2`26|Ps6_g.~\?&5?!AtvB&^рM tڄ75Xz[c88jb R΀LxF4 zIyh7{ۂކ?m[ٝ8/x I%RIxpftK0flav؃@9åvobɲ:9t뿳 +yx⋍9J`0#VsC|:LW։ 7 lYɿ7^[{ʃv:Vg *RGmw떧 ^j5? aacljʗoo׊y8։N4@ m7z+]G K74DqS+ATƇ0&x_\'?n Kju#^Ttʕ笆eyojsyr$L=ҥhCNF( 㲢C {DgTឱ;q%bPnn _H Jv1>?Vf3`ĠO=(9q DLlݺA[zADK 8>r>0P-i_~|nW7miU9盜(wYϱcHHBma M8HX Ș਀$EcثP~_qDDpy#jM*|¿ ]UX聁iobpG;x tbti wآmUC `33}.mKA`\;oX֫ f7xd`ewu`۽" ?GcLc]p^"&n"P{NnCȷ$:WX6ۅhf׫-6; `C៬c^g.#lP0FׂX\F;aXNeǟ?C ѶIž˵Jy+!VPY`}^1=@XX۽,U҉j/C^d஫_PG2vvm2j"E%B n+RUhIE۽f2zúp"F!`!L&!I"5Ϻžx/twDzԂ@zPzT$KU#k/Gd_K.P痔0>DBJeBIVIW!KF(@Z?3\a8<~keAaZ[E00`0˺qIlZ`h< ٢jQo1g@ .3E):ocxXIx(F+V^kH%PN&2nkSuno%<Ϩ=BE(*MՇ8C,ࡖs[YIn!NnC:!=)*ȍ]_Mc DJ iޘ윧g'< |#װpDc~/o+wVq2M{EӨijt*no"p{_?c|B Gnv|\tD0PL Hțdn5՞ZHf#F GT7_9 nMzD`f?,|'! ifK~aYsM8EsT*&ON>;EmD`ĢK\.cKB +5$v Gy%T5&5D4Ʊ/ОP1$صt 5tQC 5ArӊQv XxPci$|{`[sI_5O jw/4dcӫ߮/~@ww蕇v1_zt0 ûxWl RkuYl.Qzʋ F v+"0ڗR-9PqF1 b{JD -v;/pMY>+fY3O;8l;<18띵~xȐ2k+pn4bo"4"L -{sgo$쁱$/g8k%q NH@'1p <Gd&aǷn&+Pr den@6g?:۵y1.vCc =>.d6EMpd>H5T5Q\1[R## 9i[fmISt1D2M:` v rK^njK- ^WQi>r..O.{ F^]d R~j$ +xĀVS=~D~,5,]B/-U~GF=,l4/2T;%9r;`YH$A7\";Y#' ͔`>%`f51 Xm[2OK LPcF!ǀY?C `L5dB@4ZK*u1Ӻ!pܛ/o1# P{5(>Lj<MHu%U%1t>LPS"#uߧphΡsŇwɷGryX gY?|u1SxUHyf$JWd~lW<(N^32 QDf>ϾeE)PaZ&,Ԃ7yR#SF ToOdOdKI_bBH[j'lO->'nb(V銎9ԁ@E ?r1`sVuKqykCu 8"C&ئɮIɭ`[GUk ?%Gp6X4BZlm75F LFF Azu'[j`c1V,Uwk{-"ԓBY/eYStue%sQb7O^.Ӂqz1K1nmN9J52oUܙ磠,NGm38|:>H<?1 S!H`H&0U1|emΥcupD1jj>ՒFWWl]f  B}43W%m|ʲ"\9!*C+ Ml}t妦lIR~OVn2E*b|2nۛ&N( FHmb/\YddbNaޫ=㻵ޭIم`_nh<l=ɜl`V2%^<1g,|љ "O1uaޛ ekCv:"(È_\=&r흭t- P;ۀ-hpi& ɰd^d@5gA79WnMs#=x6TX±|VtB%^f+a 鶗 2 ZBk.?w /'ZnׂX-j1*6G'ĂHO?IZu+/hPʭ"V.:n(3pge#7Z>-ʑR@ lP7T9<8aY ]ߖ«X+NXa@Ʋ?}`oAǟ?!~{un$2ao ^Jl>& \0\KAqYҐ2cA;LQZdP!1ΨB9"T`}+IҐYbhK~r2;ضCκ9dU&^!\*O~snS+b=fqU}/ʋ=vVFi87C+!&†]X9\FaqQ?ea|Y_ Ft[d[-vxW@ț< o^5U%%88C(X P4;` zAq|Զ2%mĐ<^e}Z^Vjd%d3-Qw ͸+7 1>d_(8kBуr^.e3Cqf؞];M2 /zcx84Ac& |\e]( -a7>7{ M`?߬bg _~V-*nnoQ^Yŷ sUcjZT?ł:OkH ނ--B/=? ©\[Bo$p6'c^qݰpiG^lF,X;?5 9BCkG~gAp\B>a})Cg"8= "{utVI{~΁?oo?䝃^|݇$Qa&3$xeP!o] (<oMUᒻ`4!/0fO #y'.x5̯a ؕ=zɣ TA1Te2En.A.o,|DŤuvNx ~ZoS֚_nkvŏ_~}uo n/i 9 +ت` \?l% 3ྚe4=Å-ǐcLw!Pƥgp$O*])4^)ucżu(`ȱ M*r7-(P撅ZI} (.08ǀPxE06~n!4%A NNLʬY=!̲Mg-7NQnLYX '߿ 7SX dVwWW׷|7lZ/n!3<|aqÓ6!ؤQbk}qը.O}Kur C_|Q܋1K>13Z?Mv![Z$K3wc-IJΆn c}1J m"pΞ(:ƲTږW5x)yIv[>u_$+#Mmv}E8_$iiUZ}/KEIc?з7I~CR=#Z% VzQ KZ/sCaa7G`Ja%wX.g7_Ұt^bG7P^{Cށ{^̮߽֯^/7G۫wy}{[LFpƒbvwHw[g77?|?D/:1e}C=k_i)uQp֛&|]\شzzd.[$Bo Wj~91 vP[gmazu| `$/-p-@qסb D;|'*Tԙ(va~wRAVˡk-X_@8^+lCuu]NKK~{K(_Q@ԦnRǔt?V6;3ߡoWdn4da/s@4@)R,h]ny͈ǂ׋}S +)~5՝"9=S xNm G\ b("kz\:d$A+5@#B~ иdkO׷7}F ud zţM _#XD sr@X=%c+qU˗bT[tc|a!&57ǨWVh7"0"vJCL.6Jz«t~L`5k70g٩؜Q5-}7QJbPR}LRQEnctzPyu b '@P@C 86ɫR@yw݄(0]U 1W Ҹ _V5ǒρF7oҞ׊СЯՅÁ}G}hq7Kߊ0K.Pg6@W"aޜR]ۡZ,%Gdb Da; ? fU @kֲϸH h!%a`MzZ!8nvg=b25γvl~$-)ڪhTgccv>MI/> A.e`cG`/E/ xWlC4܇OF pLF BP2ya,c׵T/$52WX 86 bdΉDHڑ SS2NI})J8d!\<5& ] sJDFaa䳆DN&? dʓR=uO`.C-\><(Y P|hfʗ!Ȓ] 3$@!Fc̨RR>TC^wAj/<:$hR]~<'P$3f⃿)b^€AƈɷH`.i'ɪ -a 4FsҒWRO3E,J<*"w΋x xvy Òg}x#;O֝Bܸc*[7:Ry %2BpT^`W9*cvHDv|K[T~7߬Z$u–2"աH^$c 4NU4ծ]P5KM+;ߢ/Іcmo51r\8GYBԈO΁ hnipLucLis;d f7׾O #zK&?C[<%CF(V kUvv+Cf1t'f mսRhu5w0oa2A̻wV1bJ8/ia7l3:ïh:Y)a~,Y_x2LP F(ZYb9v0[WRa=_"\z!7`M! \B#"RƏ"lT+dE6' 6Șw;rByڴn+hGV=[!0,hO5AQ67q3|? 5d1UlLfɆx+aу ~+g0eZo8$N fiZcZu\!innTCӪ;pNjg_]}Ŵʿ=^}?=3av(=~q۞=IgW?gw|';igg>2iïo洩x7_{c8ڀ, 1hKLmuY+劔KOM`Ah[Ж@F٦k? _ش\%,v|̾ugVwy{t!NТ}Q%Y*l\r^z!.`PװJgD-vѿHt2^97*h&3)VQ eDbgC<\K؂\Qj 1j5A` /6X#~ҳm%FF| b  U$#Z2e9A(H9hֵbwU#AEv 4sՍU +wZlb,!ѪsF+gcpؕ]Ψ(9/ :8B@Vn2^nMGsylkxcqܜyyFuJS yyx`ό's9Ђv幑8܉8Л׷go;$*2b>B䋽\;œPذ8`הϙ4`PВt-c|w6If,Ƹ6s  Y7_6% 2uGToA!n -bnXu#ćڔk, e1o[0aNSDzIȀJPᐽvb֘ѩXe4 v DP?b#cCز@/Ձ?zvVMd8O۽r襐 /Lu9JܫpFd;׻v gŤ*ǩYSJHfUDZ̰|\%W`᝵b#.ˣJD{TNvSm:(P~ÑjTiW}P[;=>{=T83Ttxg:5#Wx G`PE»0bM~hvt$H]Rf? hx=`5{dz޷Vnx jYGSY`Pm+im %-\82,Pzc(b:Y^"g# ܠg4epTԆiArZNZ9Z=9藎0[u>>: uzNo MRd\?ВuS1$!'}ί[tX l n;1ώg.,w~ A=6|-Aj%CS(j^ׅ(!* (Vh*'btw"awtq()O ֺFtΖn /C$Zk/SZR1\hlq~q sCniB%n%!%jfHydu3(D%Ș哬쨩Eelmh Fه|Ń^U=+Ƒё9[ pL`FXo: #_շGkm*toC~n=q`p}H# Rx< <>XCn) B)yg:8Ͼɍ%w"+:2+e&FZ Y؇9=aؾ-o,[e#D7i5ڐ d/Q 9oOk >LGСu]Eom@ ~!cK%{9'tɮŇ@6ON=ٕ$\q{>wSG2a[tgs}C+D0~isgEzx,cv=s*dr+b~VS %.'q 栻}6iY+8׈?o)C3{Fqy7crԏT!mrF.Zޖ"F{%ai.)o0L)8#LpF-?t݌]Jm5yӳ/5ʥ(xHz:_a2lgm4ˡ 4>Exr|6 ж+4%u[=cE z>%;oYc-knS#TOAuHxLQTu͂W MC?ad|t5YBpBjŤ<S*@1 փ^s^q&Fiq0&T_;G|pcLJ`0l]LF>%D e5E8]Vw$V7Jp6"=XKa[B @t[_U͏p5zA$H 繁Պ덠}}j\{]3"f09/PxJ@F^s%刏OF~]>EVcb5H( &&vtX8KTpk[עw/H4 VVY9hj>6J@zX/id8Ax^+[2 Uxl/a_3:sA|G 9cD!PHI>hl3izKNu\%BvA֒0V.mD.m03]TؕqY|oGj_%XAy"\L Q S~a;fs% ^A ws^٨ *YkYA4Ybh뇢mcC)ʁHf_|XdKt Hƫ&PаD߀дH4 H<]HϟV7>{#S୶i].0zEXVj}6Gn )(`y(j5eE7`Zk5[''d%^aF `j<2&_ys_cj}RoB.wF 'e8/56Ո4H[]VuYȠvUS9Qy:GyKs-]tiM"cz8V"bi.`E*YԿҞDHǴW8I>^nr\I J@j<}XC.A3j+~0*!kR6c>vlLe֮ԵG5r qލ\m|JL}WXTCT|¢UZOAPy Q{(!%Œl $u)'2OvSgO,ê eI.6ŻQH` TtAE2>qN`iio&98]웧L8`aA u~Zhdz-Ƙp?fl^{zn:oc /'<іqN[wHI<okS6RKXg62W0z.c ~#/Ud`Y/&Z[ ?2F_TH-䌌fwʕ _gF3c9AsO  y443Fu:(ilm ͋k hI'LH08iF|*> o/$j)FHOFS^8Q21V_hC:o!uWo@ܼE&&m\prƢѣr72ZiC&PGk㻽66Z) Gٺt;MiW7T=x@|6U. IDv%*$Z98լ@f VF* f9&|g T]c#hGv{s #-l{.0c2n]QHTaU>%j v MHe|c#/U : Xk鹃;U兌϶"zML4m٧ؠ #!twX#?3~]/.~M65$r>{1$]$"$r6A;0^ XgQ  bW Bw F,.#T=OPT'D!Kn[|sjdD.l~7"a aCg$FFyMm8zيvXC9 S9UW=,=9\UqU**m~=E9]N- lN^\L/(AluZBcUHjTigiCV5.׼H'ïw2Uᨅac13oOu@@*@ +:P qoڹ\K:צhw[&f(Ity$9vi`I1wmw'W3Wol1!Kȭ(;2>*qVn}~XHi3Op]ܤ%Z:2NǠѢ@*j^\h J.$RW9>˂I ׏$%&yUqiٌr|}>@i"! JNsN, RJs)sF Ɣxud^zfl1K'e7%wڳL3BиȎd6úI=4ѹ{pt&jAdq|N`&C/)Efw@!/ATqnQ'5J%p󸔭qp?n<"_x P|.)~~X.GFwXL²Z,ny{H]VjsUտO_7_* ,V\h-pg$Ǹ??2 ؀<V*jrzpu.& 41%0TBZлq`_!m>ƛ@K_hzp&,Z8FCxMNTqTs?d;8rOfH`ڦN;P@]uqB_*?@9 ]`G5P@ ǡEC] `VR{g;Wlv[ѝ g(r:=ހa '/㋴n{:17?eB WV@v@HR! }nMY~ UCVVt[\tIw͓qBQ1]Hiū4gm־jmGVTJIUEgYs4@(]ms,1 S_Drt԰ȜU/ S'J8x0;GG-#럆C/& -Pl|]<$)x4 I Ƴm5@ߦ,dA+JhA| ^0;,Hu t(`Wjj/NjEd ±gy5 ŵWBeGr诟asXb9u#QX#Qp# gjl}frlt,zeEQTueOJ8ڪ -;FT&ګАy^?QEMYqfSLI*K!0!0I Vbo(Dnetbsd-INSTALL_C700.debugdEd@h@#`@*] 5M <l@Kt@tnx\|   4@ p@0@p@@@@82@@(@S$@f @x@@@@8@@x@8@d @T  @D - ?t_ LD(@]L(@`s(@p)@ +@p,@,@$,,@d,@t -@-@2 G<.@RT.@]\.@Ti.@sL/@1@ 0@d@1@tT\ ^\l\ y\\x_ 7@$ 8@,L8@:@ ;@;@$(\< Nl( a <@s>@,>@ 8>@P>@h>@>@>@>@>@tC@ C@PD@D@ $F@9E@PHF@4bF@0\u\T_ G@H@H@H@H@LhH@dH@<(L@HL@P@  L@O@("L@/pO@l;<\ Q\\0h\y\ 0\0`\\  \ \  \|  #  0   ?_ GP@ R4P@b8P@n \@T \@k \@} P\ `\  \ \ \  8@d د@ @     @! @> @[ @s @  ء_ @D @ x@p\\ $@' \@/ T%\@A $\@Q $\@b T$\@s $\@ #\@ #\@ T#\@ "\@ #\@ "\@ T"\@ %\@ @| H@  T@`( @8 %\&\'&\ D @@T @@g 0@Lx |@ @@ |@\ @@ @4 L@x @d (@@@@.@lK<@f@(|@4L@H@4|@@xA( A' A5 ABAL\At4&\@t&\ 0   $ ($ b d f f  f $f #(f )0f 6(g >@g I`i bdi xhi i( i@  @ ܡ_x x @  HAAAA$BAD1CA<DAEEAS,GA,]XGA fxIAs\JAD~JADJAdHKALAdxLAMAPAPA\SAxTA$UA$VAVA|WAfAX(fAT3P^Ah=^AlD$_A@Ld_A<S_A[8cAbcAPj(dA|dA&\&\&\&\ &\ '\ ('\ H'\,t'\ ` d 8gA@gA HgA\gA/LhAh@hApX$iAjqA<{tA8'\@tA,ltAtAvAvAdB`Npz etz _t{ L!B<l!B<z!B8!B84"BT"BX"B%B8d$B4$B4$B{ { ,B$-Bp/B 0B0Bd<1Bt,1B62B ?3BTG,4B^ g( r7B$@7B(h7B@7B|:Bt:B0 >BABABd0BBt| $GB(GB$LGB((tGB7|GBHGB$_GB yGB4GBHBHBl IB(LBlHJB$lKBtKB0!|MB8x8 )\QeB8e,fB,yXfBTiBphB\gB<gBdgBtiBjBjB jB`ljB&jB7jBLjB_jBojBkBdLlBtlBtmB,mB nBDdnB8nBDnBnB rBp%@ ;yB$H|B0X4|Bi|B}Bt}BBPBB\B(B@)\)\  | ,| *\Bt*\`$8\h:7\ U6\hk5\ ,5\h 4\ 3\h2\ D2\h 81\ + 0\hC /\ ` \/\hz P.\  -\h ,\  t,\h h+\ !tB&!|8\@ 1!C\0E!4B4c!hB8!B!4B!BL!BX!lB!,Bd!C\l"B<-"BL>"BS"B4c"B|"B"B"XE\"lBl"B"Bh"`Bd"B"XB"BD"XBd#B#3 PD`M3RD,[3`QD|h3PD3PDq3QD,3{]Zh} 3l} 3p} 3t} 3d_3_3SD4 SD0PSDdSDt4(TD@{]44 |]@4(|]}]H4}]P44}]LY&}]\4 k4}  |4liDP4iD4iD4iD4iD,}]4}]}]Y&~]40~]D~]\~]s~]~]4} 4ltD4ttDD5uDP5wDp'5xwD 35wD,t5wD ?5wDJ5wD~]~] U5t_5yD5yD5yD5yD5yD5yDP50zDP5zD85zD05{D5}D 6}D  6}D`6P~D*6D66DA6D`M6DtX6D d6D,6D p6̆D6PDx6ȊD]]60]0] ;] G] 6x_6D6D6ċDh6,D*6̎D\6(D7D  7D@?7HD 7TD6]] 7|_L7\DHU7DP_7Dj7D 68D`u7D7(Ddk$D<7ȕD@7D7D|7D7DT8آET(>,E@5> C> L> [>İ k>E w>4E >TE >tE >E>EH>E0? E@?`E %?lE07?E8I?԰E _?E(v?E?ȲE?|E ?EH?E?E?ED@E)@EhA@EN@EZ@ j@ ~@~ @  @ @ @ @  Ew>E @E@TEhEd Et@ElG @$ A( !AE7A ELAEbAEwAEAEA_AE\AEtAET BE/BEQB F]B]hBВ]8?Bd rBh Bp Bt B B4 B8 B BFTBFCF4CF?ClFICFPCL _C@ sCL k>:F w>8:F ?X:F@C:F|?;F C ;Fl?;F C;FCI%GZI%GwI&GI'G,I'G>GdL?GtI?GI@GLI AGIAG JLBG JhDG1J,EGDJEGdOJ0FGbJ4FGwJ8FGdJFG@JFGJGGJNG<JNG0JOGTKQGXKRGd6KtRGFK@SGYKPSGdoKSGKPTG KpTG(KTGlKVG`LdVGL|XG-LLYG<GLYGDaL( tL, Ld]G L]GL]GHL]G L^GLLT^G$Lx^G|L^GL_G$L_GL`G|M8aGM bG!MdG|3MDeGX@MeGQMQGJQp؁ WQt؁ jQx؁L oQ؁( tQ؁ Q GQG Q G4Q@G\QGtQGR GXaFxGRGT7RGxWR\GrRTG~RdGR,GRGt]]˕] ؕ] R8 R< R@ RD SL ST ,S؁ :Sف NS k>xG w>G >G >G XSGkS G wSG<STGS\G(SGSGxSGhTG8T0G0'T`Gp:TG`0GdQTGGtbTGrTHTHp TH4]Y&]]TP]X]g]] ]'] 0]TX T` w>;H TGHT[HT[HU[HU[H!A\H!U\H7U \HNU$\HdU(\H|U,\HUX]U_U0\HUlHdUtHTUtH VH<] ]ʙ] VDHT1VH,@VĠHl0HdHtLVHTVHdV]jV  rV  ~Vpځ V߁( V ( w>H V(H|VH<8H VDH(VHlVH] w>H VHVH WHDWH%WH9WH`CWHXWI\eWP nW xW@ W IHW IW IW$ IW4 IWD IWX I0W IH X IXpI$XpI6XtIEXDI<] ] (] 4]TX aX nX( ~X( X0'ILQ|(I X(I4X(I X(IX5IX\6IB] O]]]k]Y&y] ]X8 X@ ]XdJIYlJIH+YJI=YJIOYJIdYJITY KI Y@KIY0LIYDLIYXLIY\LIHYLIZLIZLI/ZLIEZLIPZZ,MIlZ@NIHNIdZNIZ]IZ`IZD Z]]] Z]8Zp@ w>gI Z0gIZ8gI[@gI"[HgI7[PgITS[gI h[gI~[gI[gIaFgI[hI8[@hI[,iI[4iIP[iIiIdiIt[djIh\jI0%\jI:\kI<L\kId\LlI(z\tlI$\|IPL] \  \  \ II\I0\LIl\I@\IT\IT]LI4]I"] IP?]\IH[]I$5If]Ixq]`I@]]{]h_]HI8]I(]I]]]l_] I^]^p_(^XI;^Ihc^]L^t_w^I  d$ID^ԠI\^0]^0Ip^I^I$^I@^TI<_@]<_I$_ȶI@3_I@B_HIX_8I|m_I_I8_IL_,I| _It_I_ IX_xI_dI`tI|%`|]-`] 7`]HA`] T`] h` ] {`] `$]``]`]8`ԟ]`](`I$`I`I`I`Ih`]a,] aI$a8I.aI=aIPMa0I^a8]<hat] wa(I$aLIaIaI4aIa]a] aI$aI a IpaI#]Ha] bI$bI<bI*bI8b]$?b] KbIWbI4cbIqbIT|b(] bI$bI0b8I`bI`bIb4]$bX] bd] bI$bI  cIcI$c0I3cp]H;c] Hc(I$ScLI4`cIlcIzcIcġ]0c] c] c@I$cdIcDIcIc ]`cl] cI$dIdIdI,dx]4d] AdILdIXd4Ifd] ,IDGd# | Jd`Jt| | rdPJ0dJdJ d J8dDJ\dJxd JdL JHe JTe J3exJdBeJLTeJ fePJ8xeJeJeJJdJteJPe,JheJe,JD fpJ#f@JT;fp#0 Jf df }f f f f f f g#  g$ "-0 g3J(,g4JFg5Jhg5Jg5J`g(6Jg7Jg8J g8J$h9J<(hL:J@h;JVh;Jjh ?J,h8?J(h@J\ht@JDh@JhDJhEJdL]]hh]0i4 -iEJBiFJ0Xi] ai]0ki]xi]i]Pi`]ip]("-H i]Jh7j0^Ji^J8i4_J_Jd8`Jti`J,]i]j $ j_LjdJ0XjdJhdjdeJ sjeJ jeJjHgJj`gJPjt|JjiJj`nJ(jTpJPjpJ$qJdknJtPn`Jd anĻJsnhJ|n(J@nhJnJ@nJnJ8nJݡ]n]0n* n8+ o* o]&o]3oȿ]Bo]Poؿ]^o]oko]yoo]o0]o]o@]oA]oP]oS]ao`]o]) pp]p]2)p]9p]Hp]Xp]gp)0 up+( ~p+ f4| p w& pJ(p`JpxJ8pJk*J pJDpJpJ`qJP#qPJ 9q\JXLqJX`q J,tq8JqTJqJqJq]pq]q]PqP]@ r]@rJk*J rJ,'rJ9rPJEr]lr]Urx_{r_r0KdrK,rK@rK0rx]sx]sx]sh%K s%K0*s%K;sx]Is]Zs bsp ls ts s1Ks1K0s1K,k*1K s2K ] sDKsXXK@sXKsXKtXKxt YK0)tPYK@LtYKxotZKt ZK<t\ZKt,\K@t](t8`KXXu`KpsaK k*(aK udK, uLy@L,6y|]y_By_VLnyZLzy\iLywLPuxL8y Ly AM(y4BMy(DMy(JMDylJMxyJMzKML'zNMNzOM`hzTUM`wzVMzDWMzXMN&]]&]R;:]Y&M] Z] 4f]t]] ]zMzhMxzMzȯMzpM0zM,zM$zM$zM{M{M{MT] ]] ] ){M2{M={M8=|PMM{M\{Mt{tMh{M{tM{M<{H]\] i] {t]{]] |]{D {_!|_N|TNdc|N|X,Npy|$/N,|D]|= |d |_|_|<> | 7N<] }$VN]] }4ZN@/}](D}fN0t}]O}H> ]}_}8fN0}]}N0}ND}(N|}N(}̈N@}pN`} } ~@ ~ĝN+~  :~8N,B~NJ~NP]Z~"H p~# ~ # ~ ~ ~ ~ȰNX~ N~$N~N#0 9(N$N,PN*4N 3TNHFNP@# Y b\N\rN03 N<\NtNxHNN4Nt N]$%N94N$NP>$ bD# ]rx% &P h&P & ǀ) bdNXۀNNN`3N@] ,  /N,E@N,YNiN~NdN2Op@O8O4ЁlO0O pOPOp(O9xOGxO|W]]h- |_`GO8POTO͂JOH߂$RO _UO'XO7@nOIoO\pOrdqO,rOLxrOdrOtsOD> / ΃/ ׃/ / $/ (/ )( 80/ @4/ N=/ Y,Oq0O|$O|> @/ L/ ΄@ لOhOOP1DOPMOpOdhOtWP/X g s__˅_(OOL$]6]/0 1@ =D HLOS4OaO`qO x4OOd|OLO\OOlO dž,OpOxΆOOdhO@@OO<5OL] U] `]n]|? A? N2 \2 m2 u2  _ˇO<هR<X<  > ,TP0-Td-Tt Ͷ ܶpN  N  > > > |4T90]J](_> j@  y@ @ 8Td@9Tt9TD9ThpTXd>TƷh?T, @TT@T&^6N ?N HN RN( [N bO jO O O HT$LT`LT4LTdMTtMTŸQT Ը$QT8RTTT(A @A *XA >TXTRlXT@gXT@{XTYTlZTp[T|p\TP[T_T8_Td\`Tt`T`aT PdT,eT<'oTp1PrTDErTZ4vTXkwTtxT<T `^t^Y&^ ^ ^^ ^^  ͺЁ ܺO O $O (O Vp W /X VHX >Y MZ UA eA vH_dT`lTT0ȻHTp޻@T\Tt XT"T9^I X cZ oZ Z Z B @B  ܢ_جT<'TL`T4T`ؼT$TT,(T\-4T@6tTT8>T(@T`JLTWPTPXTxeTHuTTlTHT8ĽTDѽ ^T0T4TTl c TDIT(ZTkTt`T~TTPTT@T<ӾT0T^  L P KT 2\ A\ T\ cx] r|] ] ] ] ]( ʿ] ` _*_[\TDjTPTTT0T`TdTpTxTdTtTp B0 B0 C  &@C  4C <TETxQpTX^@TpiTXyUU(xU@UL(^Hp^ y z z { _ L_8UMUfPUl|U UL(UDUUD\UdUl,U|Ut1U0KLU0d|ULvUtUUh\!UD^^^@#U, #U &#UL1@$UhE$U8Y$U(h%U0s8%U@x%U|%U\%U\4&Ut'U<)U-U -U@\.U.U%t/U|?^L ^`C$ jPGUvXGU,GUHU8IU@xIU8JUJUKULU^$^@@TU4tTU!UU-UULUUP;8XU$J\XUYXUtfZU0td^X^@^ { D @D DD _P_hUt'^ 3TuU<EuU\SuUvU0exUdvwUl{ { { T_UH@U\U"UxL^ HD LD X_6{ B`UTMU_{ pHU~`UvhULU4UXW0LW@ZXWflWpW,WDLW\W4W @WWW0 WW81 WhHtWT_Ww$W$  dX<XXX@8XX4X\dXHX 4X74XLLX[Ċ lȊ }Њ Ԋ ܊  䊂 节 I J XX!X!Xb!X$)!X,<!XTQD"Xld"Xq#X}%X &X&Xh8'XL'X*X.X /Xlh9Xpx2X|1Xx42XD)8XP@ ^O ^V ^ ` ^q ^4슂 > M ]0 g, r00 }` d @J J K BX,BXT,DX4DX8lDXXHX HXD4IX|!IX)hKX1NX<=NXPFQX O0RX\W$WXdl^Xtd_X_X8(`X4\aXxaX|rXusX8@sX8Xh^x^X@ X&4X4XpvXLvPXLXXZX<k,XyX<XhTX;Xt\X,X,X$֗PX \XTXp^^hX< XDXuĹX8&XDXp^bX|rDX\XHX ^(^<^P^p^xPX9`Xt ^_\_^ RX dXr Xp Xxx  `XPX\YYtYH^ _.HY<PY0IYXYhYwY YYYt<YhYPYYxYY@YYhT YH YP YL8!Y!Y)"Y0^1 @ ? I h  _T3Yl3Y̚8^ _8Y H^ T^-d^Tf( G_n=YhuL>Y@?Y$@YAY\CYCYdDYDYEY^, GYHY`tHY8HY @K DK %HK 3KY$?LYLLYd\LY<hLY(uLYH,NYD NY<NY(NYOYDOYLPYTPY,PYQY&xRY<6RY@8TYIUYR$VYD`UY8k`Y0xWYl(XYhXY]HZY^Y]Y[YbYx|_Y DbYp$`Yd`Yx/0aY'aYLbY4:,cYDgYLOiY[kYY w>Y >\Y  |Y4/ԌY$@YZYnY 4YtYTY@PY,k$|Y<YY@Y(hY$ <Y(YD'ؑYL,Y4=`Y(VYg4YlxY0YY ĖYY PY#Y ^܆  䆀 솀    0 :K IK ]K k$Y<oTY|PY`YYXY^@^^@ , 0 !Y\4Y<D(YTDYlfYDzYX,Yf^8 , Y Y\`YZ(t^ ġ_/^0M ZddZP'^ m0 w>Z x0ZL|ZZZPZL L L 0Z8ZHZ*dZ 8Z KZTZ<cZXzLZLZ"ZHx Z@ Z@ Zd\!Zt!ZL`)Z '^  L -L @L Xl+ZTs|,Z-ZDH-Z-Z8'^   ď ԏ ؏ ܏ aFh@Z CZ,$8CZ|2CZC@DZLNDZ]DZtgEZuFZ,FZFZd`GZtGZJZ\LZ hMZL'^'^  䏂  ( " * 7( J@L YL <L jL yiZ  (^ 0 w>kZ kZ lZlZlZlZlZlZlZ&lZ<mZPmZe$mZ {DmZ@mZ4nZnZXpZ(pZ(pZPqZsZXtZdhuZ2puZxuZdGuZH[$wZh ZthZvȇZZḦZ4Z((Z\ZtZZ\(^ %(^)(^9(^G(^ T(^L((^,6Ȓ ?_bZ8u̒  Z0ZHZXZhZ4Z$ZTZ$ęZ86Z(=$ZP?tZ FZO(ZaZ(ءZpHZxZDZ $ZxZ(8ZTZ$xZ+^R,^ Z-^ b-^ j-^ r(-^ z4-^ @-^ L-^ X-^ d-^ p-^ |-^ -^ -^ X.^P/^`.^h0^h.^0^ p.^+/^ Hx.^S@0^d.^ox/^.^/^.^/^ .^z[QW^h X^X^ EBx>hz v @ $(H 5[M$iOX]$ch1C,oA{O4MnpX`R DqRp]^lQpItzXpMn%[6F@D0IV,Th` et/Bq/B}$G,0PIT0O\xNMnMn ?X8 MnDDh1[hGdUR Y [eJ,sXNl~, [dwXlVj  ʀ sR4v 'V `YD , W2S?OU 1EpC =Ax![Y(x@Yl4SJ4X\Ā ،ADp[|0(mP B_QO nKa ZLr@  O  ^JW ^dKTZN` Mn-]$ 7ļVA|zT(OxA@]\  gt xITH*ZhF@pNY4^CQ I@@(   0G@Mnc?MTmP{RHv&I{ @ @N[Џ {XPVV8BhZh]L'ܡS4ܪ  =U[`Gp_O  E B<{P@S[A 0[T?[S  Ā ; /Vd K @ Z Mnq WLP[0z  hO  Z(  NhyP W  C< HV< $F d ^!P[!XL+!P 3!@,>!5NH!dFZ!L"Ll!@X!K8!a !T@!|@!@4!G!Rd!@!0C"$P("uX,"K-"ID="Mna"Lm[<m"42TT"gJH"O[$"^@"S"S "Sl" #Mn #@J5#WG#TX0W#0a l#HD#p]#Ed#$)H#LB|#h3X\#\  #Q #O$#H$@0$Mn$pO($Y1$}XP=$_MH$bJPU$ )Qp) T)tY<)<, )xO)ɀ p([(*AZ*Mn-*X@B*R\u R*,0T$e*@`s*L*Q0F.Z*hS *@U[*Mn*< *`:T *XyxYF*tnPx#  +pB$+PM0.+ Z <+$@L+IdY+p]Vd+hR4r+3J$+J +U+ ,S<+H8D+Nl+A+C<+vL\+Z( ,`I ,:E:,2N(C,8#, L,Mnm,ȓRv,`v[h,<  ,0Y,WAԧ@,ܫ  ,T0,Mn,X]-E-HD?eR3-hQC-4]N-@`-L^q-ȏK-8O<-HQ\/ЈWd-XR +R-Y-W-( -? -dN-Mn.P ,.<Q<<.}OL.,mS}ԧ@X.8P[e.EW,}.T.^t,V.LU8.0X. D.XN[`.]R(.@C@. (\</|@(/N[ ,/O>/mUN/W8[/XLg/Mn~/<B/E/Jl/zV/4Zp/[N</B0@ 0X+K(08ZA0]\0Mnv0NT0(7VP0Mn0؈TVCW008K[0O80tQ0{[00Jl18S41J|(14ZT41BI1Th[1  e1,X\w1L^<10zTL1R1[<1\Ox1T.A1A1<7T 1X2!, 2^<&2wKhZhف 32;TK2BR U2Tg]d24]}2A2X2`P 2 @2XF2W2^<2^Cx2Mn].U3` #3lM63N?3[$O3S[3q[}3GH3G(3\%V`3,{T3[3 6`& 6~]06`5X6YD6+[D6\v 6z@6PS 7^ 7(S@"7Mn77@'TC7N`O7^PX7Lf7$Yx7S 7R"~2V<7U(7Mn7N7<$Q8L<$VTa<@R<l<&B<0K4<(KLH <4X<<S[x<tbZh<W <pg@(<@N<xJ <X= I=0 @H =E$/=X&K>=@CVDN=TX=|S8h=Bx=48I= SL=Mn=8/ =0]=7TD=P =xT8=A=@F> [ >S`*>LD7>D IHF>0T T>[`>L/Bk>x2Av>,O0> >/N8>Mn'][,>< >4fJ|>^[>{P> I ?^?dA $?x9R0?@ 8?pE4K?T8UpgQ8V?L D ^?ПVlf?ED}?PGW0?@ɀ ?^?HJ?TV<?|?L? ?lH$?SQ@?ԋN@OG^[@](&xo &@< 5@;QD>@MRL@Wd]@\S(k@JVPs@T@lX@lT@tU@ D @,Ox@ @|S AUSXAܡ@ 7AE8 >AxAlQA`@T@YAHWhaAOqA$QA GAI AtE|AEAMnA*YAܨ  AV4AMnBr B4Y BHHH0B|M:BdU QBU],[BHT0lByM}B0QHB BdNQ,BFWdB84NTB[B[TB CMnnR$%CTh-C0C<5CWCCPJCp~OPWC,S4mC膀 wC0SC|SS4CSCP CP)HLCMnCQ<CZ,DR0Dx^!DU,/D F#FG HYDHH qU\H ^sH@XHR\IDv IMnJ@)H-JPW0@JXRUJ U$gJX8xJdVlJ{[J[HJ]XJ@? JQJoM J$R KX@K3KP@KtAKdUKTSQmKC}ǨSK4 KyV0K8]KMnK@iQ(K,SKlXhKW LDR LV4Z L[-LPI<>LTI$HLWVLBT_LMnzL:LLF LLC8L, LMnL|F@LxI4 MI|MȆX$MO2MOȓRԧ@EM[MMPfPT`MMnyMzSTM4X$ML]CM MDiNDM`;S(MK`MrW4MuK<M N$? NQN  %NJT.NAD;NMnON R[iNlRdxNC NtIN@ NL NVNȀJ4NXXNMnNȓR"O̍I&OX9S 2Ot[N$PO^[4cO8XoO  yOLRO O]LO8PODStO{]<O7 O`yA8OE(P@%PX@8P4XAPMn]PMnwPZPZ4P^PX@L^[P@(P؀@P4dNPNPRP^QX Q)^%Q[T+Q \@]O[,]Mn<]Z<K]Mnp]4YBtXW] "A](@]DT]jZD]3A] ] @(] Bt ^ ^a@QaLv `aH[h$VvaX8 FDLa&\apRHaDOHLS\a\bTatS̄][a W$aGaY b  bMn%b [48bdPJbMnfbUobGB$|bBbMnbK[|bU|b|PbMnbEb{^b0T`cɀ cod $cF3c0dC @fUtKf WVfCl`ft8F(lfYxfGfx f@fUVfY(fZftKdf8YfXXxf[g(oKp'g]WxL? 2g@Eg< Pg,K^g X,kgMngMnKgTg@gTg`&ZgěT0gOLߒ _[Ah ^Ph\R`hA|whMnhPhhl@h  hр h\Q$h` hX i6 ip4A$i0@\(i< >ipIMiMndi,JqiHMSp}iMniELiS$iSiGW$iMniH ifI,jJ jSX4jdI,+jT 8jxuFEjY>TLYTjp cjQhtj @|jP joDjSt= j\ADj j0Y0j]j|> jKWk|W0@RPkPSkI*kjDBk(XDOkC`kJ8lkXAdwkN[ k4WkdDUTkSk v k|WPk}[pkfQ, lPS,l rP[0PrXjrMnrlNr|  r,hUrxS(r^<]r\  r{T,r0 sQHs̨T)s_As@ Ns WsW`rsT[s\  s#Zs%T|s u[s]Cx.H>Z<sMntW t[@.tMnNtWgt`Y<}tPtB\tT[tRtMnt0StMnu Rul@$u .uDQ,AudlXNuX[YuLZcuRoux VlR,Y^[vuX ua u]<u[0uo^u@i u,uUuKuP,u| v^ vM\)vpSPR(@v}Y4OvV]vp[LvS v(%@vH8M^t> vmO8vhDDLv0 RviQvl@vLTQwMnwg@&wu :w ] Cw4^YwtwxVL@Rwz4RDKzlAYzPTbz S4xzSQ zN[zPOz`Tz@zHDzȅX{ف ?#ZTSTRd{\BL}:L5E8'{TT3{L{^@ W{ O8d{[h{Sh{ {,^{tF|{W{TX{*H {GR |XMX |5R|`Nh͌"W,|P"Ix;| @ Q|O$l|N(~|Rt|<5X$|Mn|Mn|hR$|(+QT|QO$|Bd}{T }D K0}TZl?}]M}NV}Wd}hTDw}ˀ }I} }pyX`}U<}P}UT}0K\~ēR"~ ^$&~U|9~pB(N~RRtSY~ EXkWHe~iL DX|p~U[,~(O<~[~;T~C@~9S$~ `F@~$[hr8[T@[L)Z 2uR\CVO$r[lh R,s(&N}TV0SPW|^Е@XqPpF8v @tgC!\&Mn@,V$LS`]$yA<o v}]|[0NWx[ˀYDـ @PXXXT2LhMn.xWD:I,O@N`̀ x^|+Q8MnHP ʁ/TH؁hS1I(YHheT 0U^#{[ 8$DW\E\G@Q@5V loEXNWȓRMnxhHς T@X@#@`*YT  @4,4(Ot:0UKC(_@Tv@S`@0S T҃I^[4|  EC  GV\@(#R1MnV1Ln|XxyF(@ J"UMn˄][܄TTtB$BZ $Q8(ȩ[\C MPTQb@QtsxLD~ItJdDYERZ΅MnF E< 8U M %ĘU>[V@m0  n][ԅB(|(Vl@Y^`͆R4݆P[TO(ON,R@<8D|G4_RNH cTNHv@M  [xS$Їh]XTX,_~O(niC$, ЏWP RB\Kš/Dߚ=XD^<yR0H 4VW$ "OZx,x~X`8PR|I<@ ]HmPHm ~MnMnWhЛ8Kޛ8S$HZ Jdu 0Xp;dPLSl@L`E sLG ]G р W hR4 ˜ qI!LL< P р @|8(5VIyX0T@ʀ 0d@llW {LlE(\ Mn@€ L] u[Tȝ[ܝdP(ZHX| { Mn2N8H8RSOe p<+Sx|Y(ST`L h3AI\̞z@MnhVYT8AM @dȓRU[X99ALPRZ n V@|hgQГR"[UQŠ$IxҠRpS:nUE RL WL&=p 1  LT T8cKt'@xPUQH ȓR!Ap˫Ė ի؆X߫D`ILXXjQp@S!hR41V9X@H0A$]h sMn4V8AHhRDE<*^`YɬDSD߬ XD tU`<   Ӏ &T>DONkPXedNpGh{x *Y_^˭/B ֭X#ZtKT lE S,,TL# ^3` =YPFSHV0YWgJhs0LS8V(Ydف 4VȮHVծ[Xl~@8N0,["Z`:gH4Lv[@gVPpLW4~XWPh, 4X0MnZ4گu  hMH@ Q4@BLV0NlWpY(WhMnLE(r  SXOKDͰH8ZذJTZL](,dR DXd $h@:MHCa O<Xp^MnoХT,|P4? (AOLSD/BQ[ұ, ^Lޱx߁h @> 0Lhh iX\\&K(,4HX$4S@LAS` =pR\][$eRPtU[,^pJMnɲpZ4VHR Ā 3ؓR,U k bP vPIx*B(JX`ɳ@Aٳ J![@Mn   pqX$JP>dKY.F` F0E _AZl(Y upXhCdT,UdWd JʴSԴLSdT[(Mn(Ra h ~b[024LDETYNBW,` 5VwG ]`S(2KhZ@͵1O۵X$4jXSL%K &=ZL5@IMnJY_eN,hEhvJS  ([@tP TZǶ,YTҶNM`_Q qs[`RtW0(XdLGL4,[ȽXٽ[\THW(xX4lK(!N+0 5SP@MnUȈTeX qG[CH@XHHTh @A(ȾgQHB Ӿ̄@?DgDt. SQ0pOP)ET:̽OpKT^]K mAx[ZW/ ԿO&W CDLǿ@ٿ 3XT|jZ49W,FI\!D@4z@WN_DQq JN |<U@Mn[,ORZS WPPLE^-MnE`` V 'Jd@djW4V4Q=@ET4!SSCOHVHY(fK@X8 x@,C(3P^[(6$R[P8xX8^< F\exLLoؐQ {]Bd`BpUD@PMnQdMn5BMn0Zx<f Mԧ@b,O qPA~_BK0]0VR(dUX\C ^̗Kd @H@(!PH"hVL;ؓR,"8j\DF6PJ L$bI\jSs\QX(EE@Mn6TP/H@{SY U\`]C4NP $O0Z 7[`?EMēR"iR||_  HW 4S p_EdI(4EA |^PcX -DT8xHL H;WXpQ4hԧ@r^ SC<YMnI`JMn-(ZXF(7EaY(\XjМ@$P}[p<BDTHO@UjUuI iE$TP1\NEHqPp]Mn{@( dTtMnMn(N,W`J\XWW x4XtVTWB$/U@9\qW(LxY^DXiг[$yVPSK [Mn`WHq[ ^(iH4WC ^ ZT$Mn$R$+N|9ZXH(SOpf|~G|QCPDTtN@^}F,YPT@Mn3Q# cO,0.T@MnYĖ]bl](m][~ȓ@D)^U|\", Sl~J(StGKX{Bh8? YT*GR:rPML~X,ZP1LlrId@}W TSXVQ`J04NGp ]O |XH ^'DB5LWLKMnj؟TzW4rT1I\ P48U(XpS@@<]\A0*o!@Fd0XV=L L{Sh`dAPptkZDzMnMnWLSD2@yXP>  mO 8v xZT KO,)E(EWWK|f]<w^ |GܠW\A9CJ|Mn,C$ )J!p6X)[xM Z_4Wlr @DRP )KZhdOMnc@P`X 88 ^@VPB S;,T,NDOZ܍Ilo< St #9L^[] XLkUTXNX`M`OB`FT$ F('U2EXNNl]aP@ wDHlSC0F$hYL}[0S4SPL|V@lT KS  Z0U#T5JZ>Xd$ b]\l, x_I@IR0tXT3VPLKO,0]G40LMnR_3H]@]SQgViQw'S$O@  ~Q$  LAH[deNPD4@XVԧ@Z@$X(.F$@x;DVPBL^[Rlف ]-H mIpwMnI<QMnL[@S, ZxdA^Mn1XOT? IDP eHX|XXha O(ZȓRQXHlC YT ZlDJP'P3A/HB X8Q]@bMn|]xA4SHUxXVMnThr _CqMn@xWP  X$&}[@G OMnkTTP^[(\[RM 4a @Ȁ ZXiS x uO2CEXTl| SD C  pcX)0X@7X,JXO\WHlhXxQkE4[ľE(hN JXD@ HhQJ UH>   BP(O,7]QSH\KTB؞ n$]$ujXMnu[0t[cZI Mn^^MnxP 8 @Np-$HH<]\IDAlZDDPeJXD~@(4XTB`YL)W(;E$$dQdQWfJP'8QX4 CcMT|XT^OUi  r4 ~[OtQKDMnhPA\ @0VDx' <W$OdPbX8t\T\~B$L F| pP4  SULWWl+P0AT=SD O $6K( RP fP0 O _ 4C|% h[X4 (U$< MnW \ f TLh s ^<~ /B Z 8Rdc8PT hO[(   ȓR PN{Rl Mn U4  $ *J> `pVP n  { ^ `@, Mn W  4X< @ ^MnlkP/([(> L  YUhg DxMnSK \ Mnd]UTX 3AD NMna=ZLmJX,[$H/V0SBQUQWpQP[ iN8 L!W|@E\*zBI oRP6xvx >P? FMnbRZoXPzNW ESL̾O$G I|Mn `@@-[HK4U|S4^j9F@uD? 0Gxl/BMn@8 l T%0SHj\^8YWMܞD xVP  8T%(@h,MnOAdgԧ@cHR\sE4U H/ ;Z][R W|VZ@@($]L @\[.MnJ7RS;I`> l0E|.LxIlȓR^Cx S I<MnuX,}@8]x @X?Zl)EbXtX  dxXwwLLyL @ ߹dY8DFD  #, O](DQD %S7L@ IfI\X0KV^Zl`v SYx R$IA\3TX 3H (3 53Ud<3V@I30TPV3 f3 y3S@38O 3R03ȓR3DdK3@3Zdl 3$3N04KL4NDD-4ZQ,B4| S4Pd4Sdp44U`z4@Q4؏Wh4W 4 4$Kt4G 4dP40J`5oX5$^<"58ITH45yBM5GE$`5T@Zo5xR8y5`N85`[H 5H4X05ƀ $ZP^[(5\rPD5^5W85|V,5Wx 6'\(6A$/6R76oDPO6$v b6 q6Uh6EV6 L6U]<6,VP6$KX6( 6V6`G 6Mn6Mn 7X7ēR"67$a G7Q`7Yn7Mn7u 7C7آ]77R7d X,7TP7Mn8$ G8G@,/ ,8A98$QM84N(Y8T$g8l X,v8Xd8ˀ 8W8oP8Mn8Tp8X8BZ$8X 9[߄CV,90X"9L^[39HCD9,NO95Ud[9 > E1>H :> VE>`fZ_>4fQ0j>C~>TV>P>zCh>C>Mn>B0>]>ЌY?譀 ?X|?Yp.?M9?SpI?Qdd?$ z?G(?UZ<?V ? ?/B?TQ?pC?@ ?\D\ @АZ@R,(Pp#@\W0.@tR8:@4\QG@00A X@;@0jPRi@U|@@@@Z@ @4@`@E@ԊS,@X@(M0AMnAxEH'Ap[V\I4:AH JAxsX`UA6TaA0GTrA@A XDAQA0RXAx@A d@A@XTA^ AP\A BR BXU)BxK8BSEBHg@(MB UWBG@fBēR"BFW,B@B p@B#ZB0OBRPBG B^OB0v BZ\BtlE(C/T  C,X-C^,4CSLACMnUC^jC| xC B<C XPCPCd( CZCdO8C, CMnC4sD8CLEDpDlXDWQL/DMnDDTIQDMWPVeDKMn^K{Y iKWuKU|~KXK,^K@KmPleT[0K1E`K],K](KMnKZLX LXLkQ0%LW8/L^R  ALMneL{PmL]zLYL0\XL`JLWLMnL0T,L{LtLS$MēR"MVdM^[8/MT ;MdXDHMI0ZMAPkM$YxM= M0EhMLuUMT M, MX{D,? MPsO,MdT M NEHNDP4$NdP4N8F(CNȌUhMNﾭ`NA8pNUhN8S$N]NlrNNLoP8NDgPNENhR4NпZObROMn(OS@6OXQHOlZD X XO  H? qOT,~OX@OMnOZOxl@OETOSO(O P9APSV,P`Y4$Pt 3PlSJP[L][L]lO] J]qG]Sh]4VT@]8F]F< ^dR4^A4$^tRd.^Z8^TQpD^NHpYHX^0LXs^jU^@B4^DA^Mn^|E^=U\W^DFT_h _pPl&_ A:_OdR_:T|c_L,B@v_hJLIhxG Zh @qhQxhdXhMnh*Xh|U8hIR,M h_Oh hZh RLh@i\ i S`2iDS ;i('VxNiOHbi|OtiR iXS@i?SiA@i4 iD~P8i̜WiRdi`Q i@"iND jEj$TV(j`Q7jvFBjȓRLj^bj MrjMnjWjW4jIjddVjMnjLC jEkMkItkDRp,k JT8kSOkRYkDWtbkMn{kH=Axk\  U k)YkКLk8VtkYkNkpxX8k (e@X l|  lMn+l|/B  |Ssqr9RhLr4C]r^cr, qrTdOrP[0Vx rhZr|B l D rPr XDrUsjO0"sJ6sS(IsP`RsMnssHR |sĒZsx sVs TsMnsZsZsH s0H tC@tPVS5tV=t Pt$^gt~@$}tR`tTptiO@tܬRtlVtl t(^tء_t t^puMn6u+Q8BuW MuEVuMnpuLNTu|vV(u84TDuQ,u$@u^  uEW,u-Kdu@*B8 vR[&v,X4v^LvtM[vUhvԾWyvSvYv@Vv&@v`[vdOvǀ v UwX,w@wgZ;wMn\wR"ywR$G wl@wZPw:HxwPTww0XLwMnx$Vx,cCD'x,S,6x|W'B$Cx vR`Lx [0RTxHEmx4!TXyxKH't[@xxd@xXOx0L,xt@xU|xX$x[4yz@y[HyDXP*yh'L 6y؁ Gy` RyOPbyŀ yXyVy8$  yēR"yXzQylSy;_y`5V0yhT8 z@OzxQx'z[H5zoQBz Wz^^zX]gz@E SZzz8OzX z zl@zO(UPhKzHKzܽEz V{1A{Y{aCl({Mn:{(v G{R$X{1C`{~[tw{hA{ Q{pVL{[{X {SP{{h~A |H*J<|4iQ +|  ;|8TM|AO b|YJo|[@}|l}Y<|S|$0Jd|@@|-A\|@ |HX|ENH|JP|P}S8}ԧ@+}Z8}R[S}| g}H7T`u}UQ$}Z}Mn}i@ }́I@}  }Mn}tR~؏O,~O %~ĥWx6~xP4E~p@K~X@e~tU[~ZH~Mn~> ~PYQ~T1NP~"@x~`[ W@ ȏ .HVT;h[S$Za`Ci$jO4yH V4lTxAX SC CHЫO<8G@< @%P= 7KH0FPSU`/Re\L[(m,^EHXTDVx0TŀOxӀ xU[(I\/lO ?h-YlTgD m KhSMn_ށ@Ā *BTMnMn9lXp KZkhIP&@(MnW hN\L[˂V4؂`S,hR4 8T[)Mn:[4RMnlW$v~O P[l PMnȃ\XxՃ_D`€ T3N` YMn1xPCjZ4Q ]HIoQ(Mn C,Mn΄7Fׄ([(X`VpU58VS#PB`5R"7|  JXU@U/BT*< eNo T|HRԮVP T4Հ  N]ʅ[,څpQ4*X8EZ8`}@(WWl(Z0GPTSFpiV\|WcF0fQPTT І( J߆ N(+LxR"$!A,4xePGJS> Z,(JXk8Wyh -JhO$,NXL@ȇkCT҇i@O!, Mn.hQ@ēR"Xp[r@SLIXtdNTMn ˆ| ̈ITՈ@AXOL\G4AƎv юLBTߎ 8 4X[0Mn&H6^H[$e@O[(@SXXFIXŏ 0T Տ*H8  l xKPdZ*N6R[P@Z['JnMn8ER8'BALِP8MX$GWq[Mn,9EBL  TXT`@{Y0([(oPX\aUl{X^ кR8T@ϑ  Mn, 4`, K(0T\$hC/`X CXWLW|lDoSKwXT0` R"LYh [4ޒ _[ܟO$OL|, T@8+0v <р, GZXITR^T[vLA`Qp|V"EǓ8U[ 3NMn2W\xQ<McK\Y|jF0{S01U   XД ݔS O.A<0@ 'JTX:7 NO,@X  _HKhò hWeDDFl4EpCHʕޕIG$U([\  4 [`ԁ$ )4z 3 FH VhQHk{@(JDoCP4X\p3A– Ζ̬PۖQ @~ B USh:<@0GVOeXdROu&VA8L^JD#, ԗK ZVdtF`N P W*BDl6.KlHL, SC(gYtdY|HWZ \kZMn ИIDPU TLD@ШY$)HxDRSV,WeMnYX  4 Ι`KۙP|[K, tM!J18{A@NOTJD<cLWTnMnI04UGD][Ț@ۚh%  PV<ܰX0T9U\OW0 Pd@dFPVl_4Sq0KMn WTY<EכAX DDN}@(]p% W WXȥDBlߥhZ<TYMn{ !MnF7EHdMnMn^sX,¦N4ͦ Pݦ@ˀ l@VgP!S@-,zVtAxSQ8WPG anO0~ǀ MnH@ΧD LdpcT| IdH3T@S\&Mn@dGK?N`R TtN0bdGo zMnE8Z,Ǩ רl^uN0SdO*B(0pnF: RGQXaxSqFNdQ8U` Q<]  ͩZ4ݩXhR4 (Td^[@S 'H'C081RXF$ ZK0q}KX(J@ALX@XIZ4ĭMnۭ[P GUl8X,tCH.N>dXdOħ]<\vOllG 3T@\NMn`J8h^UDCT <@'ĠGDAHRQ|q(BpZ/JÀ }F0DAX4DdU<~@0$Wlq[&[X4hR4@R"S^b({Gj< w$7V,!K^;SHu &A$@$ "[H9Wh_p +X,9 LXI$?[Tl0 cnSr\NOxAO(|XxTa@\C\WL}[ ( ^ ^(T3$[MA@Y hMn0}K\O(JlTl[|A\8TS"HwS</]6 @OTU[LIDrH ~MnEX8^lwLL|M|I\[?S`ف HTXSL'FT01@A$AēR"X^[gPv vTN&\,E(  |^ V[L \ WLL !0Y$$cC?V^] nN4{QG8Mnp[WHr[xMnhhNH=El%Z2XTJDNW0Ea@ZlkP|@,rUIH,^STx XXDCCATT0GR%bF8;`:LHHRShOTeOxxLyS4Mn< WXho P@̂ ?   WzJ%:A/JH?x]GdN TXDaMnvXhHDl@Z8Mn0 G BIT$W(A( xS(RR$*(|@(@@XTMnpRwHXEXX ݢ]ZP[0 X|(T${O@TSPQ[)V0܃Y4;T3XG@JhU 4X,i I,P|xOTMn|q[ NMnDI@2|_ JtZ^,U4:8JD]BU@I cMnyMnV05X( X<T4", Mn[H7N8@cLXMn P0TXv ,MnCMnX2T@f^zеU.*x@,OX<qU<TCR0jS\Hv URR 8PL(WT0ODMnipPu(LN@L/ Mn) S|5TS ]x dfQ(,3 6`eMG^^ QP@vT@c$g yN`ZD*IYMnAEWL\O ^D24,B H![DTܓB<d$U<pT4̋O\P^[(8S<]QDYl@yV | SEP*T7OH<FXQTMnn.Z4x[TdD d8DMnOXK HC0 QD6R'(S5PT0CWU`X blEplYtMnԗVJ$^0VCxԪTTT[tpP)EP?pOhNW4U]_ R mG$}FU֙]ؐV?S 4F  FXp,'Z`;TtR`OR<  $]7d@ g@M`OBDcp3VLpl@oVlJ@̀ Lstartup_pagetablemmu_init_tableLstartsvcstk_endsvcstkmatch_bootdiskpxa2x0_splraise.constprop.0.isra.0zaurus_devmapconsinit_called.0pxa27x_zaurus_gpioconfpxa25x_zaurus_gpioconfpxa25x_boarddep_gpioconfread_sectorscan_mbrscan_iso_vrs_sessionvalidate_labellook_netbsd_partwrite_netbsd_labelpxaiic_attachpxaiic_acquire_buspxaiic_release_buspxaiic_send_startpxaiic_send_stoppxaiic_initiate_xferpxaiic_read_bytepxaiic_write_bytepxaiic_matchscoopmatchscoop_gpio_pin_writescoop_gpio_pin_ctl.constprop.0scoopattachbacklight_cont_initbacklight_on_initbacklight_scscoop_pcic_matchscoop_pcic_clear_intrscoop_pcic_attachscoop_pcic_socket_setupscoop_pcic_readscoop_pcic_intr_disestablishscoop_pcic_intr_establishpxa2x0_splxpxa2x0_splraise.constprop.0scoop_pcic_writescoop_pcic_set_powerscoop_pcic_functionszssp_matchzssp_printzssp_searchzssp_initzssp_attachzssp_resume__func__.4__func__.3__func__.2__func__.1__func__.0zssp_scw100lcd_matchw100lcd_show_screenw100lcd_ioctlw100lcd_attachw100lcd_resumew100lcd_suspendw100lcd_screen_listw100lcd_scr_descrw100lcd_std_screenw100_lcd_geometryw100_cursorw100_mapcharw100_putcharw100_copycolsw100_erasecolsw100_copyrowsw100_eraserowsw100_alloc_attrw100_new_screenlcdctl_matchlcdctl_set_brightnesslcdctl_attachlcdctl_brightness_uplcdctl_brightness_downlcdctl_display_onlcdctl_display_offlcdctl_backlight_c3000lcdctl_sczkbd_matchzkbd_onzkbd_enablezkbd_set_ledszkbd_ioctlzkbd_hingezkbd_attachzkbd_pollzkbd_resumezkbd_irq_c3000zkbd_synczkbd_irq_c860zkbd_cnpollczkbd_cngetcgpio_sense_pins_c3000gpio_strobe_pins_c3000stuck_keys_c3000gpio_sense_pins_c860gpio_strobe_pins_c860stuck_keys_c860zkbd_keydesctab_c860zkbd_keydesc_us_c860zkbd_keydesctabzkbd_keydesc_uszkbd_keymapdatazkbd_keymapdata_c860zkbd_consopszkbd_accessopszkbd_sczapm_matchzapm_disconnectzapm_enablezapm_get_capabilitieszapm_set_powstatezapm_set_charging.constprop.0zapm_get_battery_voltzapm_cpu_idlezapm_cpu_busyzapm_poll1zapm_attachzapm_cycliczapm_pollzapm_acintrzapm_bcintrzapm_hookzapm_get_powstatzapm_get_eventzapm_battchkratezaurus_battery_life_c3000zapm_accessopspxamci_matchzmci_get_ocrpxamci_attachzmci_intrzmci_set_powerzmci_card_detectzmci_write_protectvfp_fpscr_handlercn_redirectcn_releasecons_modcmdrefcount.0cn_lock__link_set_modules_sym_cons_modinfofiq_installhandlermainbusmatchmainbusprintmainbusattachmainbussearchcpu_mainbus_matchcpu_mainbus_attachdisassemble_readworddisassemble_printaddrdisasm_register_shiftdisasm_register_print.isra.0op_shiftsarm32_iarm32_insn_conditionsinsn_barrier_limiationinsn_fpaconstantsinsn_block_transfersinsn_stack_block_transfersinsn_fpa_precisioninsn_fpa_roundingdisassemble_dimi_userretcp15_trappergdb_trappercp15_uhgdb_uhgdb_uh_thumbsysctl_machdep_booted_devicesysctl_machdep_booted_kernelsysctl_machdep_cpu_archsysctl_machdep_powersavebootsyncdone.0__link_set_sysctl_funcs_sym_sysctl_machdep_setup_bus_dmamap_sync_segment_bus_dmamap_load_paddr_bus_dma_busaddr_to_paddrprint_cache_infowtnamesgeneric_steppingssa110_steppingssa1100_steppingssa1110_steppingsixp12x0_steppingsxscale_steppingsi80321_steppingsi80219_steppingspxa27x_steppingspxa2x0_steppingspxa255_steppingsixp425_steppingspN_steppingsdab_fataldab_buserrdab_aligncall_trapsignaldata_abortspmap_is_currentpmap_get_l2_bucketkernel_pt_lookuppmap_l2dtable_ctorpmap_pmap_ctorl1pte_setpmap_tlb_flush_SEpmap_tlb_flushIDpmap_cache_wbinv_pagepmap_cache_wbinv_allpmap_free_l2_bucketpmap_use_l1pmap_bootstrap_pv_page_freepmap_bootstrap_pv_page_allocpmap_remove_pv.constprop.0l2pte_set.constprop.0pmap_set_pt_cache_modepmap_l2ptp_ctorpmap_vac_me_user.constprop.0.isra.0pmap_clean_page.isra.0pmap_vac_me_harder.isra.0pmap_find_pv.isra.0pmap_modify_pv.constprop.0pmap_grow_mappmap_init_l1pmap_clearbit.constprop.0pmap_page_remove.isra.0pmap_vac_flagskernel_pmap_storelast_bootstrap_pagefree_bootstrap_pagespmap_bootstrap_pv_allocatorpmap_l2ptp_cachepmap_l2dtable_cachel1_lru_listcdst_ptecdstpcsrc_ptecsrcppmap_pv_pooll1_listpmap_cachepmap_kernel_l2dtable_kvapmap_kernel_l2ptp_kvapmap_kernel_l2ptp_physstatic_l1.2static_l2.1l1_lru_lock__link_set_sysctl_funcs_sym_sysctl_machdep_pmap_setuppd_rootpd_tablepv_unmanagedwd_check_errorwd_flushcachewd_lastclosewd_discardwdperrorwd_dumpblockswdrestartwdstart1wd_diskstartwdbioretrywdbiorequeuewdclosewdopenwdminphyswd_iosizewdioctlstrategywdstrategywddonewd_get_paramswd_getcachewd_setcachewd_set_geometrywd_firstopenwdattachwd_shutdownwd_suspendwddiscardwdsizewdwritewdreadwdioctlwddumpwdprobewd_standby.isra.0wddetachat_errbits.5__func__.6errstr4_5.2errstr0_3.1wd_quirk_tablewddkdriverwddumprecalibratedwddoingadumpwdc_ata_delrefwdc_ata_addrefwdc_ata_biowdc_ata_bio_kill_xferwdc_ata_bio_donewdc_ata_err.constprop.0wdc_ata_bio_startwdc_ata_bio_intrwdc_ata_bio_pollwdc_bio_xfer_opsatabus_matchata_channel_freeze_lockedatabus_childdetachedatabus_rescanatabus_suspendatabus_initatabus_detachatabus_resumeatabus_attachatabus_threadatabusconfigatabusconfig_threadata_init_ctrlatabus_qlockatabus_initq_headata_xfer_poolatabus_qcvatabus_cfg_lwpsdmmc_discover_tasksdmmc_polling_cardsdmmc_printsdmmc_task_threadsdmmc_disablesdmmc_card_detach.constprop.0speed_val.2speed_unit.1cis1_info.0sdmmc_io_send_op_condsdmmc_io_rw_extendedsdmmc_io_rw_direct__byte_swap_u32_variablesdmmc_mem_execute_tuningsdmmc_mem_send_cxd_datasdmmc_be512_to_bitfield512sdmmc_mem_read_block_subrsdmmc_mem_write_block_subr__bitfield.part.0sdmmc_mem_sd_switch.constprop.0sdmmc_mem_read_extr_single.constprop.0sdmmc_mem_write_extr_single.constprop.0sdmmc_mem_mmc_switch.constprop.0sdmmc_mem_signal_voltage.constprop.0sdmmc_mem_mmc_initsdmmc_mem_sd_initsdmmc_mmc_timingsswitch_group0_functionsCSWTCH.136speed_exponent.1speed_mantissa.0ld_sdmmc_task_getld_sdmmc_task_putld_sdmmc_modcmdld_sdmmc_matchld_sdmmc_detachld_sdmmc_attachld_sdmmc_dumpld_sdmmc_startld_sdmmc_discardld_sdmmc_ioctlld_sdmmc_doattachld_sdmmc_docachesyncld_sdmmc_dodiscardld_sdmmc_dobiold_sdmmc_restart__link_set_modules_sym_ld_sdmmc_modinfopxaip_printpxaip_searchpxaip_matchpxaip_attachpxaip_scpxamemctl_regspxaclkman_regspxa2x0_setiplpxaintc_match__set_cpsr_c.constprop.0.isra.0pxa2x0_splraise.part.0pxaintc_attachstray_interruptpxaintc_attachedextirq_levelpxagpio_matchgpio_intr0gpio_intr1pxagpio_reg_readpxagpio_reg_writepxagpio_attachgpio_intrNgpio_dispatchpxagpio_softcpxagpio_regspxauart_attachpxauart_matchsaost_attachsaost_matchclockintrstatintrgetticksaost_tc_get_timecountsaost_scsaost_tc.0dmac_reg_readdmac_reg_writepxadmac_matchdmac_continue_xferdmac_startdmac_intrpxadmac_attachdmac_init_desc.isra.0pxadmac_scpxapcic_mem_freepxapcic_mem_unmappxapcic_io_freepxapcic_io_mappxapcic_io_unmappxapcic_intr_establishpxapcic_intr_disestablishpxapcic_socket_disablepxapcic_printpxapcic_mem_mappxapcic_attach_cardpxapcic_doattachpxapcic_event_threadpxapcic_socket_enablepxapcic_io_allocpxapcic_mem_allocpxapcic_socket_settypepxapcic_pcmcia_functionspxartc_todr_gettimepxartc_todr_settimepxartc_attachpxartc_wristwatch_gettimepxartc_wristwatch_settimepxartc_matchpxamci_host_maxblklenpxamci_bus_rodpxamci_card_intr_ackpxamci_dmac_ointrpxamci_dmac_iintrpxamci_bus_powerpxamci_write_protectpxamci_card_detectpxamci_host_ocrpxamci_stop_clockpxamci_bus_clockpxamci_bus_widthpxamci_host_resetpxamci_disable_intrpxamci_intr_donepxamci_enable_intrpxamci_card_enable_intrpxamci_exec_commandpxamci_intrpxamci_chip_functionsfilt_apmreadfilt_apmrdetachapm_record_eventapm_resume.constprop.0apm_suspend.part.0apm_perrorapm_periodic_checkapm_threadapmdevmatchapmdevattachapmread_filtopsCSWTCH.78apm_splgot.0wildcard.0create_pfpcmcia_cis_quirkspcmcia_3cxem556_func0pcmcia_3cxem556_func0_cfe0pcmcia_3cxem556_func1pcmcia_3cxem556_func1_cfe0pcmcia_3ccfem556bi_func0pcmcia_3ccfem556bi_func0_cfe0pcmcia_3ccfem556bi_func1pcmcia_3ccfem556bi_func1_cfe0pcmcia_sveclancard_func0pcmcia_sveclancard_func0_cfe0pcmcia_ndc_nd5100_func0pcmcia_ndc_nd5100_func0_cfe0pcmcia_emtac_a2424i_func0pcmcia_emtac_a2424i_func0_cfe0pcmcia_fujitsu_j181_func0pcmcia_fujitsu_j181_func0_cfe0pcmcia_necinfrontia_ax420n_func0pcmcia_necinfrontia_ax420n_func0_cfe0ne2000_matchne2000devscom_pcmcia_productswdc_pcmcia_validate_config_iowdc_pcmcia_validate_config_memorywdc_pcmcia_datain_memorywdc_pcmcia_dataout_memorywdc_pcmcia_detachwdc_pcmcia_matchwdc_pcmcia_enablewdc_pcmcia_attachwdc_pcmcia_productswi_pcmcia_validate_configwi_pcmcia_detachwi_pcmcia_write_firmwi_pcmcia_matchwi_pcmcia_set_hcr.isra.0wi_pcmcia_enablewi_pcmcia_attachwi_pcmcia_productsdev_untokenstringld_modcmdlddiscardldsizelddumpldioctlldstrategyldcloseldopenldwriteldminphysldreadld_iosizeld_dumpblocksld_config_interruptsld_flushld_shutdownld_lastcloseld_resumeld_suspendld_discardld_diskstartlddkdriver__link_set_modules_sym_ld_modinfowi_key_deletewi_key_setwi_key_update_beginwi_mend_flagswi_seek_bapwi_write_bapwi_read_bapwi_cmd_waitwi_node_freewi_node_allocwi_rssadapt_updatestats_cbif_statincwi_ioctl_enterwi_ioctl_exitwi_txcmd_waitwi_cmd_start.constprop.0wi_push_packetwi_rssdescs_resetwi_rssadapt_updatestatswi_cmd_intrwi_cmd.constprop.0wi_read_ridwi_read_xridwi_media_statuswi_newstatewi_get_cfg.constprop.0.isra.0wi_write_ridwi_write_valwi_set_timwi_write_txratewi_startwi_resetwi_write_multiwi_set_cfg.constprop.0wi_write_ssid.isra.0wi_write_wep.isra.0wi_key_update_endwi_stopwi_initwi_media_changewi_watchdogwi_ioctlwi_softintr__func__.8__func__.5CSWTCH.185wi_card_identempty_macaddr.7curtxepslasttxerror__link_set_sysctl_funcs_sym_sysctl_widp8390_xmitdp8390_read_hdrdp8390_ring_copydp8390_write_mbufdp8390_test_memdp8390_haltne2000_test_memne2000_readmemne2000_read_hdrne2000_ring_copyne2000_write_mbufne2000_writemem.constprop.0com_read_1com_write_1com_write_multi_1com_read_4com_write_4com_write_multi_4cflag2lcrpxa2x0_splraisecom_intr_pollcom_std_mapcom_readaheadcountcomconscomcons_infocom_cnm_statecom_readaheadcomconsattachedrtl80x9_media.0__wdcwait__wdcwait_resetwdcprobe1mstohzwdc_dataout_piowdc_datain_pio__wdcerror__wdccommand_kill_xfer__wdccommand_donewdcreset.isra.0__wdccommand_intr__wdccommand_poll__wdccommand_startwdc_cmd_xfer_opsdl10019_mii_reset.part.0dl10019_tickax88190_mii_statchgax88190_mii_writeregax88190_mii_bitbang_writeax88190_mii_bitbang_readax88190_mii_readregax88190_tickax88190_mii_bitbang_opscompat_util_modcmd__link_set_modules_sym_compat_util_modinfoaesbear_xts_updateaesbear_probele32decle32encaesbear_cbcmac_update1aesbear_encbe32decbe32encaesbear_ccm_dec1aesbear_ccm_enc1aesbear_decaesbear_xts_enc.part.0aesbear_xts_encaesbear_cbc_enc.part.0aesbear_cbc_encaesbear_xts_dec.part.0aesbear_xts_decaesbear_cbc_dec.part.0aesbear_cbc_decaesbear_setkeyaesbear_setenckeyaesbear_setdeckeycases.0aes_ccm_incaes_ccm_modcmdkeyCptxt_seq__compound_literal.0__compound_literal.1__compound_literal.2__compound_literal.3__compound_literal.4__compound_literal.5keyDptxt_rand__compound_literal.6__link_set_modules_sym_aes_ccm_modinfosub_wordRconadd_round_keyinv_shift_rowsaes_setenckeyaes_setdeckeysysctl_kern_crypto_aes_selectedaes_modcmdC.7rk128enc.0rk128dec.3rk192enc.1rk192dec.4rk256enc.2rk256dec.5key.6aes_implaes_md_impl__link_set_modules_sym_aes_modinfo__link_set_sysctl_funcs_sym_sysctl_kern_crypto_aes_setupaes_selftest_encdecaes_selftest_encdec_cbcaes_selftest_ccmaes_selftest_encdec_xtsexpected.14aes_nroundsaes_keybitsexpected.13key.5ptxt.3key2.12key1.11expected.10key.9m.8authctr16.2authctr48.1ctxt.0auth16.7auth48.6sysctl_kern_crypto_chacha_selectedchacha_modcmdchacha_implchacha_md_impl__link_set_modules_sym_chacha_modinfo__link_set_sysctl_funcs_sym_sysctl_kern_crypto_chacha_setupchacha_probe_refhchacha_refchacha_core_refxchacha_stream_xor_refxchacha_stream_refxchacha_stream_selftestnonce.3k.2expected.0zero.11expected0.10k1.8in1.9expected1.7k.5in.6expected.4hash_df_blockadd8.constprop.0hash_df.constprop.0kat_zerokat_no_additionalkat_additionalkat_personalizationkat_noncekat_entropycprng_fast_seedcprng_fast_init_cpucprng_fast_buf_shortcprng_fast_intrcprng_fast_percpucprng_fast_softintblake2s_compressblake2s_modcmdblake2s_sigmazero_block.0__link_set_modules_sym_blake2s_modinfosm_init_oncesysmon_modcmdsysmon_modsysmon_opvec_tablesysmon_refcntsysmon_minor_mtx__link_set_modules_sym_sysmon_modinfowdog_preinitsysmon_wdog_modcmdsysmon_wdog_opvecsysmon_wdog_listsysmon_armed_wdogsysmon_wdog_list_mtxsysmon_wdog_mtxsysmon_wdog_cvsysmon_wdog_calloutsysmon_wdog_sdhooksysmon_wdog_cphooksysmon_wdog_count__link_set_modules_sym_sysmon_wdog_modinfoswwdog_matchswwdog_suspendswwdog_detachswwdog_attachswwdog_setmodeswwdog_tickleswwdog_panicdorebootswwdog_modcmdwk.1swwdog_devcf.0__link_set_modules_sym_swwdog_modinfo__link_set_sysctl_funcs_sym_swwdog_sysctl_setupieee80211_default_resetieee80211_init_link_stateieee80211_find_instancechanflags.2rates.1mopts.6ieeerates.0ieee80211_listieee80211_vapmapnull_key_allocnull_key_deletenull_key_setnull_key_update_ieee80211_crypto_delkey__func__.7cipher_modnamesciphersccmp_enmicccmp_init_blocksccmp_encapccmp_setkeyccmp_detachccmp_attachccmp_demicccmp_decap__link_set_ieee80211_funcs_sym_ccmp_registernone_attachnone_detachnone_setkeynone_enmicnone_demicnone_decapnone_encap_S_tkip_mixing_phase1tkip_mixing_phase2xswapget_le32ieee80211_hdrspacewep_decryptwep_encrypttkip_encaptkip_setkeytkip_decaptkip_detachtkip_attachmichael_mic.constprop.0tkip_enmictkip_demiccrc32_table__link_set_ieee80211_funcs_sym_tkip_registerwep_setkeywep_enmicwep_decapwep_encapwep_detachwep_attachwep_demic__link_set_ieee80211_funcs_sym_wep_registeriswpaouiiswmeinfowpa_cipherrsn_cipherieee80211_discard_macieee80211_send_errorieee80211_getbssidieee80211_discard_frameieee80211_discard_ieieee80211_parse_wmeparamsieee80211_ssid_mismatch.constprop.0bpf_mtap3.constprop.0alloc_challengeget_sta_spaceget_sta_infowi_read_ap_resultieee80211_ioctl_getscanresultsieee80211_ioctl_getwpaiedomlmeieee80211_setupscanieee80211_ioctl_get80211.constprop.0CSWTCH.61CSWTCH.67zerobssid.0ieee80211_sysctl_treetopieee80211_init0ieee80211_sysctl_nodeieee80211_sysctl_inactieee80211_sysctl_parentieee80211_init_once.4ieee80211_sysctllognode_getrssiieee80211_set_tim_ieee80211_free_nodenode_reclaimieee80211_timeout_scan_candidatesieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scanieee80211_set_chanieee80211_match_bss_ieee80211_find_nodeieee80211_setup_nodenode_cleanupieee80211_timeout_stations__func__.25__func__.26__func__.21__func__.22__func__.20__func__.11__func__.13__func__.17__func__.14__func__.12__func__.10__func__.9zeromac.7__func__.18__func__.15__func__.16__func__.19__func__.24__func__.23ieee80211_compute_duration1ieee80211_add_erpieee80211_add_wme_paramieee80211_send_setupif_start_lockparam.3acmap.19cipher_suite.14cipher_suite.9info.6sta_deauthsta_disassocieee80211_newstateauth_internalauth_modnamesrates.5basic.4phyParam.2logCwMin.0phyParamForAC_BKphyParamForAC_VIbssPhyParamForAC_VIphyParamForAC_VObssPhyParamForAC_VOphyParamForAC_BEbssPhyParamForAC_BEinitialized.6authenticatorssysctl_ieee80211_rssadapt_expavgctlsysctl_ieee80211_rssadapt_debugmaster_expavgctlcurrssadaptpslastrateadaptxauth__link_set_ieee80211_funcs_sym_ieee80211_external_auth_setupsysctl_net_inet_igmp_statsigmp_sendpktigmp_rti_poolrti_headigmp_timers_onigmpstat_percpucurlwp_bindcurlwp_bindx_pslist_reader_first_container_pslist_reader_next_containerin_rt_ifa_matcherin_lltable_find_dstin_lltable_fill_sa_entryin_get_ia_from_ifp_psrefia4_releasein_lltable_lookupin_lltable_deletein_lltable_free_entryin_lltable_destroy_llein_multicast_sysctlin_lltable_createsockaddr_in_init.constprop.0in_lltable_dump_entryin_scrubprefix.isra.0in_lltable_hashin_addrhash_remove_lockedin_addrhash_insert_lockedin_lltable_match_prefixin_scrubaddrin_control0subnetsarelocalhostzeroisbroadcastinmulti_poolin_ifaddr_lockin_multihashin_multihashtblin_multilockin_multientriesinpcb_poolinitin_get_iainpcb_bind_portin4pcb_pool_cachein6pcb_pool_cachetcp_ctloutput_wrappertcp_ctlinput_wrapperudp_ctloutput_wrapperudp_ctlinput_wrapperrip_ctloutput_wrapperrip_ctlinput_wrapper__link_set_domains_sym_inetdomainicmp_redirect_timeouticmp_mtudisc_timeoutsysctl_net_inet_icmp_statssysctl_net_inet_icmp_returndatabytessysctl_net_inet_icmp_redirtimeout_icmp_inputCSWTCH.153mtu_tableicmp_redirect_timeout_qicmperrppslimicmp_rediraccepticmperrpps_counticmp_wqinputicmperrppslim_lasticmp_mtxsysctl_net_inet_ip_statssysctl_net_inet_ip_pmtudtosysctl_net_inet_ip_forwsrcrtip_forwardip_rtaddripintrip_drainwantedipforward_rt_percpuip_checkinterfaceip_newid_rangeip_getoptvalip_multicast_ifip_get_membershipip_pktinfo_prepareip_freefip_reass_ttl_decrdropscanidx.0ip_nfragsip_nfragpacketsipfren_cachefragttl_histoip_fragsip_reass_sysctllogip_maxfragpacketsipfr_lockip_maxfragsip_nmbclustersrip_connect2_wrapperrip_stat_wrapperrip_rcvd_wrapperrip_recvoob_wrapperrip_sendoob_wrapperrip_sbappendaddrrip_ioctl_wrapperrip_abort_wrapperrip_accept_wrapperrip_detach_wrapperrip_attach_wrapperrip_listen_wrapperrip_connect_pcbrip_bind_wrapperrip_connect_wrapperrip_purgeif_wrapperrip_peeraddr_wrapperrip_sockaddr_wrapperrip_disconnect_wrapperrip_shutdown_wrapperrip_send_wrappertcp_fields_to_hosttcp_fields_to_nettcp_setup_acktcp_urp_dropsowwakeupsorwakeupnd_hinttcp_reass_unlocktcp_reass_lock_try.isra.0tcp_reasstcp_ackdrop_ppslim_counttcp_rst_ppslim_counttcpipqent_pooltcp_ackdrop_ppslim_lasttcp_rst_ppslim_lastsack_removeholesack_insertholesackhole_pooltcp6_mtudisctcp_iss_secret_inittcp_reass_lock_trydo_tcpinittcp_mtudisc_callbackdotcpinit.1tcp_iss_secret_control.0tcp_iss_secrettcpcb_pooltcp_drainwantedsyn_cache_rmsyn_cache_putsyn_cache_timer_armsyn_cache_timersyn_cache_respondsyn_cache_lookuptcp_syn_cachesyn_cache_poolsyn_hash2syn_hash1tcp_slowtimotcp_slowtimo_chtcp_connect2_wrappertcp_stat_wrapperchange_keepalivesysctl_tcp_init_winsysctl_net_inet_tcp_statscopyout_uidinet4_ident_coresysctl_net_inet_tcp_identsysctl_tcp_keepsysctl_net_inet_tcp_mssdfltsysctl_update_tcpcb_templatesysctl_tcp_congctltcp_ioctl_wrappersysctl_net_inet_tcp_setup2.constprop.0tcp_attach_wrappertcp_rcvd_wrappertcp_send_wrappertcp_recvoob_wrappertcp_connect_wrappertcp_bind_wrappertcp_listen_wrappertcp_accepttcp_accept_wrappertcp_peeraddr_wrappertcp_sockaddr_wrappertcp_abort_wrappertcp_sendoob_wrappertcp_purgeif_wrappertcp_disconnect_wrappertcp_detach_wrappertcp_shutdown_wrappertcp_reno_congestion_exptcp_reno_slow_retransmittcp_reno_newacktcp_newreno_newacktcp_congctl_fillnamestcp_reno_do_fast_retransmittcp_reno_fast_retransmittcp_newreno_fast_retransmittcp_newreno_fast_retransmit_newacktcp_reno_fast_retransmit_newacktcp_cubic_newacktcp_cubic_congestion_exptcp_cubic_slow_retransmittcp_cubic_fast_retransmittcp_congctl_globaltcp_congctl_mtxfatp_nextfatp_indexv6_tagv4_port_tagfatp_freevtw_alivevtw_indexvtw_from_indexvtw_nextvtw_export_v6tcp_init_ports_v6vtw_export_v4tcp_next_port_v4tcp_init_ports_v4class_to_mslvtw_control_initv4_tagvtw_controltcp_lookup_v4tcp_lookup_v6tcp_next_port_v6vtw_agevtw_allocvtw_tickfatp_vtw_inshash.constprop.0vtw_inshash_v6vtw_inshash_v4fatp_xtratcp_hookstcp_ports_iterator_v6tcp_ports_iterator_v4vtw_csin_cksum_phdrudp_connect2_wrapperudp_stat_wrapperudp_rcvd_wrapperudp_recvoob_wrapperdo_udpinitsysctl_net_inet_udp_statsudp_abort_wrapperudp_accept_wrapperudp_sendoob_wrapperudp_ioctl_wrapperudp_detach_wrapperudp4_sendupudp_notifyudp_attach_wrapperudp_listen_wrapperudp4_input_checksum.isra.0udp_purgeif_wrapperudp_connect_wrapperudp_bind_wrapperudp_shutdown_wrapperudp_peeraddr_wrapperudp_sockaddr_wrapperudp_disconnect_wrapperudp_send_wrapperudp_recvspaceudp_sendspacedoudpinit.0pcb_getportscheck_suitable_portinet4_reserveinet6_reservealgo_randincalgo_random_pickalgo_random_startalgo_bsdiscompletetupleFhashalgo_doublehashalgo_hashsysctl_portalgo_selectedalgosinet4_portalgoinet6_portalgoportalgo_next_ephemeraldhtable.0frag6_dropfragfrag6_freeffrag6_nfragsfrag6_nfragpacketsip6qro.0frag6_drainwantedfrag6_lockm_put_rcvif_psrefm_get_rcvificmp6_redirect_timeouticmp6_mtudisc_timeoutsysctl_net_inet6_icmp6_redirtimeoutsysctl_net_inet6_icmp6_statsni6_nametodns.constprop.0icmp6_redirect_diag.constprop.0icmp6_errcount.constprop.0m_put_rcvificmp6_reflecticmp6_redirect_input_icmp6_inputicmp6_redirect_timeout_qicmp6_reflect_pmtuicmp6_mtudisc_hiwaticmp6_mtudisc_lowaticmp6_mtudisc_timeout_qicmp6errpps_counticmp6_wqinputicmp6errppslim_lasticmp6_mtxin6_rt_ifa_matcheria6_releasein6_lltable_fill_sa_entryin6_lltable_free_entryin6_lltable_destroy_llein6_lltable_match_prefixin6_get_llsol_addrin6_lltable_find_dstin6_lltable_deletein6_lltable_lookupin6_lltable_createin6_lltable_dump_entryin6_lltable_hashin6_ifaddprefixin6_ifremprefix.isra.0in6_update_ifa1in6_lifaddr_ioctlmaskarray.2allzero.5allone.4in6pcb_bind_portin6_dom_initencap6_ctlinput_wrapperrip6_ctloutput_wrappertcp6_inittcp6_ctlinput_wrapperudp6_ctloutput_wrapperudp6_ctlinput_wrappericmp6_ctloutput_wrapperrip6_ctlinput_wrapperin6_any__link_set_domains_sym_inet6domainlookup_addrsel_policyip6_cantforwardsysctl_net_inet6_ip6_statsip6_pullexthdrip6intrsysctl_net_inet6_pim6_statsexpire_upcallssocket_sendip6_mdqdel_m6if.isra.0dst.0nummifsreg_mif_numpim6stat_percpuexpire_upcalls_chpim6ip6_copyexthdrip6_splithdrif_output_lockip6_setpktoptip6_pcboptin6_mkludge_sysctlmld_starttimermld_stoptimermld_sendpktmld_start_listeningmld_timeoin6_multicast_sysctlin6m_destroyip6_optshbh_buf.0in6_multilocknd6_llinfo_holdsrcnd6_nud_enablednd6_llinfo_reachablend6_llinfo_retransnd6_llinfo_outputnd6_timernd6_slowtimond6_gc_neighborsnd6_purge_entrynd6_freend6_llinfo_missednd6_timer_worknd6_setifflagsnd6_timer_wknd6_timer_wqnd6_slowtimo_chnd6_timer_chnd6_dad_findnd6_dad_stoptimernd6_dad_destroytimernd6_dad_inputnd6_dad_ns_outputnd6_dad_timerdadqnd6_dad_lockrip6_accept_wrapperrip6_disconnect_wrapperrip6_stat_wrapperrip6_rcvd_wrapperrip6_recvoob_wrappersysctl_net_inet6_raw6_statsrip6_sendoob_wrapperrip6_sbappendaddrrip6_sockaddr_wrapperrip6_peeraddr_wrapperrip6_ioctl_wrapperrip6_detachrip6_abort_wrapperrip6_detach_wrapperrip6_shutdown_wrapperrip6_connect2_wrapperrip6_purgeif_wrapperrip6_bind_wrapperrip6_listen_wrapperrip6_connect_wrapperrip6_send_wrapperrip6_attach_wrapperrip6stat_percpuCSWTCH.9CSWTCH.17sid_defaultudp6_accept_wrapperudp6_stat_wrapperudp6_rcvd_wrapperudp6_recvoob_wrappersysctl_net_inet6_udp6_statsudp6_sendoob_wrapperudp6_sockaddr_wrapperudp6_peeraddr_wrapperudp6_ioctl_wrapperudp6_notifyudp6_sendupudp6_connect2_wrapperudp6_purgeif_wrapperudp6_listen_wrapperudp6_attach_wrapperudp6_abort_wrapperudp6_connect_wrapperudp6_bind_wrapperudp6_disconnect_wrapperudp6_shutdown_wrapperudp6_detach_wrapperudp6_send_wrapperudp6_recvspaceudp6_sendspaceiic_probe_noneiic_closeiic_openiic_child_detachiic_rescaniic_searchiic_printiic_print_directiic_probe_smbus_receive_byteiic_probe_smbus_quick_writeiic_detachiic_modcmdiic_ioctl__link_set_modules_sym_iic_modinfoiic_op_flagsiic_smbus_crc8i2cexec_modcmd__link_set_modules_sym_i2cexec_modinfoi2c_subr_modcmd__link_set_modules_sym_i2c_subr_modinfoi2c_bitbang_modcmdi2c_wait_for_scl__link_set_modules_sym_i2c_bitbang_modinfobitreversemii_printnibbletab.0mii_bitbang_syncmii_bitbang_sendbitsmii_load_verbosemii_phy_auto_timeout_lockedmii_phy_auto_timeoutmii_media_tablebrgphymatchbrgphy_bcm5411_dspcodebrgphy_ber_bugbrgphy_jumbo_settingsbrgphy_eth_wirespeedbrgphy_5708s_statusbrgphyattachbrgphy_bcm5401_dspcodebrgphy_resetbrgphy_loopbrgphy_copper_statusbrgphy_fiber_statusbrgphy_5709s_statusbrgphy_mii_phy_auto.isra.0brgphy_servicebrgphysdspcode.5dspcode.0brgphy_5708s_funcsbrgphy_copper_funcsbrgphy_fiber_funcsbrgphy_5709s_funcsdspcode.6dspcode.4dspcode.3dspcode.2dspcode.1nsphymatchnsphy_statusnsphyattachnsphy_resetnsphy_servicensphysnsphy_funcsnsphytermatchnsphyterattachnsphyter_resetnsphyter_statusnsphyter_servicensphytersnsphyter_funcsqsphymatchqsphy_statusqsphyattachqsphy_resetqsphy_serviceqsphysqsphy_funcsinphymatchinphyattachinphy_statusinphy_serviceinphy_funcsiophymatchiophy_statusiophyattachiophy_serviceiophysiophy_funcsexphyattachexphy_resetexphy_serviceexphymatchexphy_funcslxtphymatchlxtphy_statuslxtphyattachlxtphy_resetlxtphy_servicelxtphyslxtphy971_funcslxtphy_funcsicsphymatchicsphy_statusicsphyattachicsphy_reseticsphy_serviceicsphysicsphy_funcssqphymatchsqphy_statussqphyattachsqphy_servicesqphy_84220_resetsqphyssqphy_84220_funcssqphy_funcsdmphymatchdmphyattachdmphy_statusdmphy_servicedmphysdmphy_funcspnaphymatchpnaphy_statuspnaphyattachpnaphy_servicepnaphyspnaphy_funcsukphymatchukphyattachukphy_serviceukphy_funcswsdisplay_emul_matchwsdisplay_noemul_matchwsdisplayparamwsdisplay_getcwsdisplay_pollcwsdisplay_closescreenwsdisplay_dosyncwsdisplay_swdone_cbwsdisplay_suspendwsdisplay_addscreen_printwsdisplaystartwsdisplay_switch2wsdisplay_switch3wsdisplay_switch1wsdisplay_switch3_cbwsdisplay_switch2_cbwsdisplay_switch1_cbwsdisplay_delscreenwsdisplay_emul_detachwsdisplay_addscreenwsdisplay_common_attachwsdisplay_emul_attachwsdisplay_noemul_attachwsdisplay_conswsdisplay_console_inittedwsdisplay_console_devicewsdisplay_console_confwsdisplay_cons_kbd_getcwsdisplay_cons_pollmodewsdisplay_cons_kbd_pollcwsdisplay_console_attachedwsdisplay_ocnwsemul_confwsemulswsemul_vt100_initwsemul_vt100_output_scs94wsemul_vt100_output_scs94_percentwsemul_vt100_output_esc_spcwsemul_vt100_output_dcswsemul_vt100_output_esc_hashwsemul_vt100_detachwsemul_vt100_output_string_escwsemul_vt100_output_scs96_percentwsemul_vt100_output_scs96wsemul_vt100_output_csiwsemul_vt100_nextlinewsemul_vt100_outputwsemul_vt100_output_stringwsemul_vt100_output_dcs_dollarwsemul_vt100_resetopwsemul_vt100_resizewsemul_vt100_output_escwsemul_vt100_attachwsemul_vt100_cnattachwsemul_vt100_console_emuldatavt100_decmode.isra.0vt100_ansimode.isra.0nrctablenrcovlposdecspcgr2unidectech2univt100_fkeysvt100_pfkeysvt100_numpadfilt_wseventreadwsevent_intrwsevent_copyout_eventsfilt_wseventrdetachwsevent_filtopswsevent_default_version__link_set_sysctl_funcs_sym_sysctl_wsevent_setupwskbd_matchupdate_ledswskbd_activatewskbd_suspendchange_displayparamwskbd_update_layoutwskbd_attachwskbd_repeatwskbd_displayioctlwskbd_do_ioctlwskbd_enablewskbd_mux_closewskbd_mux_openwskbd_translatewskbd_set_displaywskbd_detachwskbd_default_bell_datanum.1wskbd_console_datawskbd_console_devicewskbd_console_inittedpos.0ksym_upcasefillmapentrylatin1_to_uppercompose_tab_inordercompose_tabwsmux_do_openwsmux_mux_openwsmux_do_closewsmux_mux_closewsmux_do_displayioctlwsmux_do_ioctlwsmux_evsrc_set_displaywsmuxdevsnwsmuxrasops_memset32rasops_allocattr_monorasops_erasecols_rotated_cwrasops_eraserows_rotated_cwrasops_putchar_rotated_ccwrasops_putchar_rotated_cwrasops_allocattr_colorrasops_copychar_ccwrasops_copycharrasops_do_cursorrasops_copycolsrasops_copyrowsrasops_mapcharrasops_cursorrasops_rotate_fontrasops_copyrows_rotated_ccwrasops_copycols_rotated_ccwrasops_copyrows_rotated_cwrasops_copycols_rotated_cwrasops_isgrayrasops_lmask32rasops_rmask32rasops4_do_cursorrasops4_copycolsrasops4_erasecolsrasops4_putcharrasops8_putcharrasops8_putchar_aarasops15_putcharrasops15_putchar_aawsfont_find0wsfont_add0encodingsiso_level1ibm437_level1iso7_level1netbsd_box_drawingnetbsd_boxesiso7_level2_32iso7_chars_32iso7_level2_3iso7_chars_3iso7_level2_0iso7_chars_0ibm437_level2_37ibm437_chars_37ibm437_level2_35ibm437_chars_35ibm437_level2_34ibm437_chars_34ibm437_level2_32ibm437_chars_32ibm437_level2_3ibm437_chars_3ibm437_level2_1ibm437_chars_1ibm437_level2_0ibm437_chars_0builtin_fontsbold8x16bold8x16_dataagain.0cd9660_chars2uicd9660_rrip_reldircd9660_rrip_idflagcd9660_rrip_stopcd9660_rrip_contcd9660_rrip_devicecd9660_rrip_attrcd9660_rrip_pclinkcd9660_rrip_deftstampcd9660_rrip_tstampcd9660_rrip_altnamecd9660_rrip_defattrcd9660_rrip_loopcd9660_rrip_defnamecd9660_rrip_slinkcd9660_rrip_extrefrrip_table_analyzerrip_table_getnamerrip_table_getsymnamerrip_table_extref_utf_count.0cd9660_modcmdiso_makemp.isra.0iso_mountfscd9660_genfsops__link_set_modules_sym_cd9660_modinfo__link_set_sysctl_funcs_sym_cd9660_sysctl_setupucs2foldutf8ucs2str.constprop.0char8ucs2str.constprop.0ucs2pad.constprop.0dos2unixu2lunix2dosle16decfh_compare_node_fhfh_compare_nodesfh_rbtree_opsmsdosfs_genfsopsfh_poolfh_rbtreefh_lockfh_generationfatblockusemap_allocusemap_freele16encmsdosfs_vnode_modemsdosfs_gro_rename_check_possiblemsdosfs_gro_remove_check_possiblemsdosfs_gro_lookupmsdosfs_gro_removemsdosfs_gro_remove_check_permittedmsdosfs_gro_rename_check_permittedmsdosfs_gro_directory_empty_pmsdosfs_gro_lock_directorymsdosfs_gro_genealogymsdosfs_gro_renamemsdosfs_genfs_rename_opsmsdosfs_sync_selectormsdos_modcmdupdate_mp__link_set_modules_sym_msdos_modinfo__link_set_sysctl_funcs_sym_msdosfs_sysctl_setupdosdirtemplatekrpccheckxid.0nfs_boot_delroute_matchernfs_sndlocknfs_sndunlocknfssvc_iodVN_KNOTEnfs_kqpollfilt_nfsvnodefilt_nfsreadfilt_nfsdetachkevlistnfskq_locknfskq_threadnfskq_cvnfskq_thread_exitnfs_gop_sizenfs_gop_allocnfs_sillyworkernfs_genfsopsnfs_sillyworkqsolocksounlocknfs_backoffnfs_timer_chnfs_timer_start_evnfs_timer_locknfs_timer_evnfs_timer_stop_evnfs_timer_srvvecnfs_srvdesc_poolnfs_clearcommit_selectornfs_unlinkdircachedzeronfsrv_v3errmapnfsv3err_nullnfsv3err_getattrnfsv3err_setattrnfsv3err_lookupnfsv3err_accessnfsv3err_readlinknfsv3err_readnfsv3err_writenfsv3err_createnfsv3err_mkdirnfsv3err_symlinknfsv3err_mknodnfsv3err_removenfsv3err_rmdirnfsv3err_renamenfsv3err_linknfsv3err_readdirnfsv3err_readdirplusnfsv3err_fsstatnfsv3err_fsinfonfsv3err_pathconfnfsv3err_commitnfsrv_v2errmapnfs_mutexnfs_refcountnfs_xidnfs_sync_selectorsysctl_vfs_nfs_iothreadsnfs_modcmd__link_set_modules_sym_nfs_modinfo__link_set_sysctl_funcs_sym_nfs_sysctl_initnfs_linkrpcnfs_cache_enternfs_writerpc_extfreefls64ffs_hashallocffs_mapsearchffs_nodealloccgffs_fserr.part.0ffs_fserrffs_check_bad_allocationffs_alloccgblk.constprop.0.isra.0ffs_freefile_common.constprop.0.isra.0ffs_blkfree_common.isra.0ffs_blkfree_cgffs_blkfree_tdffs_discardcbffs_alloccgffs_findextattrffs_close_eaffs_open_ea.constprop.0ffs_indirtruncidb_getidb_assignwrsnapblkrwfsblk.isra.0syncsnapffs_copyonwriteffs_aclsffs_modcmdffs_snapshot_cbffs_init_vnodeffs_superblock_validateffs_sync_selectorffs_vfs_fsyncffs_oldfscompat_readffs_is_appleufs.constprop.0ffs_genfsopsffs_ufsopssblock_tryffs_snapshot_listener__link_set_modules_sym_ffs_modinfo__link_set_sysctl_funcs_sym_ffs_sysctl_setupufs_post_read_updateufs_post_write_updatemfs_modcmdmfs_minormfs_initcnt__link_set_modules_sym_mfs_modinfo__link_set_sysctl_funcs_sym_mfs_sysctl_setupinited.0ufs_issequentialufs_dircompact.constprop.0ufs_sane_renameufs_genfs_rename_opsufs_modcmdufs_initcount__link_set_modules_sym_ufs_modinfoufs_makeinodemastertemplatepp_getreflenamap_dtoramap_ctorpp_setreflenamap_alloc1amap_adjref_anons.constprop.0amap_listuvm_amap_cacheamap_list_lockuvm_anon_ctoruvm_anon_cacheuao_getuao_putuao_pagein_pagekernel_object_store.3bootstrap_kernel_object_lock.1uao_initialized.0uao_swhash_elt_pooluao_list_lockuao_listubc_releaseubchash_statsubc_alloc.constprop.0ubc_faultubc_objectudv_referenceudv_detachudv_inituvmfault_unlockalludv_faultudv_listudv_lockuvmfault_relockuvmfault_unlockmapsuvm_fault_upper_upgradeuvmfault_promoteuvm_fault_lower_enteruvm_fault_upper_enter.constprop.0uvm_fault_lower_upgrade.constprop.0uvmfault_lookupuvmadviceuarea_poolpage_freeuarea_poolpage_allocuvm_uarea_allocatoruvm_uarea_cachekernel_map_storekernel_image_mapent_storekernel_kmem_mapent_storekmem_arena_storekmem_va_arena_storeuvm_unloanpageuvm_loanpageulz_putulz_pageruvm_loanzero_objectuvm_loanzero_lockuvm_map_compare_nodesuvm_map_compare_keyuvm_mapent_freeuvm_map_entry_unwireuvm_mapent_splitadjsysctl_vmprocsysctl_user_va0_disableuvm_map_align_va.part.0uvm_mapent_alloc.constprop.0uvm_map_space_avail.constprop.0uvm_rb_fixupuvm_rb_insertuvm_mapent_cloneuvm_rb_removeuvm_map_replaceuvm_map_tree_opsuvm_map_entry_cache__link_set_sysctl_funcs_sym_sysctl_uvmmap_setupsysctl_vm_metersysctl_vm_uvmexpsysctl_vm_uvmexp2uvm_sysctlpctparam__link_set_sysctl_funcs_sym_sysctl_vm_setupuvm_mmapround_and_checkuvm_pagealloc_pgbuvm_pagealloc_pgfluvm_pageinsert_objectuvm_pageremove_objectuvm_pageinsert_treeuvm_page_rediminitialized.1uvm_page_numa_regionwarned.0recolored_pages_memsizerecolored_pages_memvirtual_space_endvirtual_space_startuvm_boot_cpu.2emergvaemerg_ncolorsemerginuseuvmpd_pool_drain_threaduvmpd_tuneswapcluster_flushuvmpd_pool_drain_runuvmpd_pool_drain_cvuvm_pagedaemon_waitersuvmpd_lockuvmpdpol_pagedeactivate_lockeduvmpdpol_pagedequeue_lockeduvmpdpol_pageactivate_lockeduvmpdpol_pagerealize_lockedmin_checkpdpol_scanstatepdpol_state__link_set_evcnts_sym_pdpol_evcnt_reactanon__link_set_evcnts_sym_pdpol_evcnt_reactfile__link_set_evcnts_sym_pdpol_evcnt_reactexecuvm_pglist_adduvm_post_preload_checkbtslab_ex_storage.2vm_nphyssegvm_physmemra_startioswaplist_findswapdrum_getsdpswopenswaplist_insertswaplist_trimiobuf_redirectsw_reg_biodoneswwriteswstrategyswreadsysctl_kern_uvm_swap_encrytpsw_reg_startsw_reg_iodonesw_physio_decrypt_iodoneuvm_swap_stats.part.0uvm_swap_iosw_reg_countswap_prioritysw_reg_workqueueswapmapswap_syscall_lockuvm_swap_data_lock__link_set_sysctl_funcs_sym_sysctl_uvmswap_setupuvn_markdirtyuvn_putuvn_getuvn_detachuvn_referenceuvn_findpagesecmodel_lookupsecmodel_copy_cred_on_forksecmodels_lockbufq_disksort_getbufq_disksort_cancelbufq_disksort_initbufq_disksort_putbufq_disksort_finibuf_inorderbufq_disksort_modcmdbufq_strat_disksort__link_set_modules_sym_bufq_disksort_modinfobufq_fcfs_putbufq_fcfs_getbufq_fcfs_cancelbufq_fcfs_initbufq_fcfs_finibufq_fcfs_modcmdbufq_strat_fcfs__link_set_modules_sym_bufq_fcfs_modinfosave_note_bytescoredump_getseghdrs_elf32coredump_note_elf32coredump_writesegs_netbsdcn_magicelf32_free_emul_argelf32_load_psectionexec_elf32_modcmdexec_elf32_execsw__link_set_modules_sym_exec_elf32_modinfoexec_script_modcmdexec_script_execsw__link_set_modules_sym_exec_script_modinfo__link_set_evcnts_sym_vmcmd_ev_kills__link_set_evcnts_sym_vmcmd_ev_extends__link_set_evcnts_sym_vmcmd_ev_callsrootconf_handle_wedgesinitpathsnotice.0sysctl_kern_maxvnodessysctl_kern_maxprocsysctl_kern_hostidsysctl_kern_boottimesysctl_kern_rtc_offsetsysctl_kern_defcorenamesysctl_kern_cptimesysctl_kern_maxptyssysctl_kern_lwpsysctl_kern_forkfsleepsysctl_kern_root_partitionsysctl_kern_driverssysctl_kern_cpidsysctl_security_setidcorenamesysctl_security_setidcoresysctl_kern_messagessysctl_hw_usermemsysctl_hw_cnmagicfill_lwpdcopyout.constprop.0sysctl_lwpprflagmap__link_set_sysctl_funcs_sym_sysctl_hw_misc_setup__link_set_sysctl_funcs_sym_sysctl_kern_setupsysctl_setlensysctl_hw_machine_arch__link_set_sysctl_funcs_sym_sysctl_hwbase_setup__link_set_sysctl_funcs_sym_sysctl_kernbase_setupencode_comp_tacct_chkfreeacct_stopacctwatchacct_vpacct_stateacct_credacct_dkwatcherkauth_authorize_action_internalkauth_ifindscopekauth_cred_hook.isra.0scope_listkauth_domainkauth_cred_cachekauth_builtin_scope_credkauth_builtin_scope_generickauth_builtin_scope_systemkauth_builtin_scope_processkauth_builtin_scope_networkkauth_builtin_scope_machdepkauth_builtin_scope_devicekauth_builtin_scope_vnodekernconfig_mutexkernconfig_lwpkernconfig_recurseclockrnd_getsysctl_kern_clockrateclockrnd_sampleget_intr_timecountintr_timecounterhardclock_tickspsdivhardscheddivclog.0hardclockrndstatclockrndbintime2timocv_unsleepcv_entercv_wakeup_allcv_wakeup_onedeadcvcoredump_offsetcoredump_modcmdcoredump_write__link_set_modules_sym_coredump_modinfocpu_xc_offlinecpu_xc_onlinefiledescopensysctl_file_marker_resetfiledesc_dtorfdfile_ctorfiledesc_ctorfile_dtorfd_usedfd_map_allocfd_dtab_freefd_unusedfd_map_free.constprop.0fd_next_zero.constprop.0sysctl_kern_file2sysctl_kern_filesysctl_file_markernfilesfile_cachefiledesc_cacheentropy_pending_cpurndsource_entropybits_cpurndsource_to_user_est_cpufilt_entropy_read_eventrnd_lock_sourcesrnd_unlock_sourcesfilt_entropy_read_detachentropy_timerentropy_notifyrndsource_to_userrndsource_to_user_estentropy_fini_cpuentropy_init_cpuentropy_threadentropy_consolidate_xcentropy_requestentropy_cpu_getentropy_enter_earlyentropy_cpu_putentropy_reset_xcentropy_account_cpuentropy_enterentropy_softintrrnd_add_data_1rnd_add_data_internalsysctl_entropy_consolidatesysctl_entropy_gatherattach_seed_rndsourceinterval.3interval.0interval.7entropy_read_filtopsfops.2entropy_depletionready.6besteffort.5entropy_collectionlasttime.4lasttime.1lasttime.8entropy_sysctlrootentropy_sysctllogentropy_percpuentropy_sihentropy_lwp__link_set_evcnts_sym_entropy_notify_evcnt__link_set_evcnts_sym_entropy_deplete_evcnt__link_set_evcnts_sym_entropy_request_evcnt__link_set_evcnts_sym_entropy_extract_fail_evcnt__link_set_evcnts_sym_entropy_consolidate_evcnt__link_set_evcnts_sym_entropy_partial_evcnt__link_set_evcnts_sym_entropy_immediate_evcnt__link_set_evcnts_sym_entropy_discretionary_evcntfilt_nopeventfilt_fileattachfilt_userdetachkqueue_fpathconfkqueue_fcntlkqueue_listener_cbkfilter_byname_syskfilter_byname_userfilt_usertouchfilt_userfilt_userattachfilt_timerfilt_procfilt_kqueuefilt_timercomputefilt_timertouchfilt_timerexpirekqueue_restartknote_activate_lockedknote_activatefilt_timerdetachfilt_procattachknote_allocknote_freeknote_proc_fork_trackkqueue_kqfilterfilt_kqdetachkn_wait_fluxknote_detach_quiescekqueue_statkqueue_pollkfilter_byfilterkqueue_ioctlkqueue_doclose.constprop.0kqueue_closefilter_event.constprop.0filt_seltruedetachfilt_nopdetachfilt_timerattachfilt_procdetachkqueueopskqread_filtopstimer_filtopsuser_filtopskevent_native_opsnop_fd_filtopsnop_filtopsfile_filtopsproc_filtopssys_kfilterskq_ncalloutsuser_kfiltercuser_kfilterskqueue_filter_lockuser_kfiltermaxcuser_kfilterszexecve_fetch_elementexec_path_freeexecve_free_dataexec_pool_freeexec_pool_alloccopyinargstrs.constprop.0spawn_exec_data_releaseexecve_loadvmexecve_runprocexec_pallocex_headexec_poolexec_mapnexecs_proclist_skipmarkerexit_psignalmatch_processfork_tfmratelasttfm.0hook_proc_runhook_disestablish.constprop.0pwr_names.0hook_controlshutdownhook_listmountroothook_listexechook_listexithook_listforkhook_listcritpollhook_listpowerhook_listexithook_lockforkhook_lockkthread_lockkthread_cv_kernel_lock_dumplwp_ctorsysctl_kern_maxlwpmodule_listener_cbmodule_enqueuemodule_lookupalloc_requiredmodule_newmodulemodule_freesysctl_module_autotimemodule_unload_evcnt.part.0module_do_builtinmodule_builtin_add.part.0module_fetch_infomodule_do_unloadmodule_threadmodule_do_loadmodule_netbsd_modinfomodule_bootlistpend_stack.0module_specificdata_domainmodule_netbsdmodule_activemodcblistmodule_thread_ticksmodule_thread_lockmodule_thread_cvmodule_sysctllog__link_set_modules_sym_module_dummymodule_hookmutex_dumpmutex_ownerKPREEMPT_ENABLEmutex_abort.constprop.0time_adjphysio_biodonephysio_initphysio_donepmf_check_system_driversany_suspensorpmf_class_input_deregisterinput_activity_handlerpmf_event_workeradd_suspensorpmf_class_network_resumepmf_class_network_suspendpmf_class_display_deregisterremove_suspensordevice_pmf_remove_suspensor.isra.0complete_suspensionpmf_suspend_workerinput_idle_device_suspensor_self_pmf_qual_self_pmf_qual_system_pmf_qual_drvctl_device_suspensor_drvctl_device_suspensor_systempmf_all_eventspmf_platformpew_plall_displaysglobal_idle_counterpmf_event_workqueuepmf_suspend_workqueue__link_set_sysctl_funcs_sym_sysctl_pmf_setuppg_removeproc_active_lwpproc_find_raw_pid_table_lockedproc_find_internalproc_ctorproc_alloc_pid_slotcopy_procargs_sysctl_cbsysctl_security_expose_addressproc_free_pid_internal.constprop.0orphanpg.isra.0proc_listener_cbsysctl_doeprocsysctl_kern_proc_argspg_deleteostat.0sysctl_flagmapsysctl_sflagmapsysctl_slflagmapsysctl_lflagmapsysctl_stflagmapkern_expose_addressproc_pszproc_specificdata_domainproc_cacheclog.1last_free_ptpid_alloc_cntnext_free_ptpid_tablepid_tbl_maskpid_alloc_limpid_maxras_syncrebooter.0resource_listener_cbsysctl_proc_findprocdonicesysctl_proc_stopsysctl_proc_paxflagssysctl_proc_corenamesysctl_proc_plimitCSWTCH.80proc_sysctllogcacheht_timeskim_intervalmin_catch__link_set_sysctl_funcs_sym_sysctl_sched_setuprw_dumprw_ownerrw_abort.constprop.0crashme_null_derefcrashme_null_jumpcrashme_sysctl_forwardercrashme_paniccrashme_mutex_recursioncrashme_kpreempt_spinoutcrashme_spl_spinoutcrashme_enablecrashme_rootfirst_nodecrashme_lock__link_set_sysctl_funcs_sym_selfdebug_crashmesigchecktracefilt_signalsignal_listener_cbproc_stop_lwpssigacts_ctorsigswitch_unlock_and_switch_awayktrpsigfilt_sigdetachfilt_sigattachsigput.constprop.0ktrpoint.constprop.0firstsigproc_stop_calloutsiggetinfosigpostproc_stop_donesigswitchlognocoredumplogcoredumpproc_stop_chvforksigmasksigacts_cacheksiginfo_cachesleepq_insert.isra.0sleepq_reinsertsoftint_threadsoftint_init_isrsoftint_locksoftint_maxfirst.0getwedgenamefinddeviceparsediskgetdisksetroot_dumpspc_locksched_lendprisched_unsleepsched_changeprisleepq_dontsleep.constprop.0cexpbackwards.3lavg_count.2backwardslwp.1backwardsproc.0kpreempt_ev_critkpreempt_ev_klockkpreempt_ev_immedsysctl_allocrandom_address_initsysctl_lock.part.0sysctl_cvt_insysctl_cvt_outsysctl_mmaprandom_inithookaddress_keybintime_addbintime2timespecbintime2timevaldummy_get_timecounttc_deltatc_pickdogetnanotimesysctl_kern_timecounter_choicesysctl_kern_timecounter_hardwaretc_winduptimecountersdummy_timecountertimehandsth0timecounter_removalsth1th2th3th4th5th6th7th8th9now.1timestepwarningstimecounter_modstimecounter_badtc_ticktimebasetime__second32time__uptime32__link_set_sysctl_funcs_sym_sysctl_timecounter_setupthreadpool_percpu_oksysctl_kern_threadpool_idle_msthreadpool_relethreadpool_destroythreadpool_percpu_finithreadpool_threadthreadpool_job_deadthreadnamesuffix.constprop.0threadpool_dispatcher_threadthreadpool_createthreadpool_percpu_initthreadpool_idle_time_msunbound_threadpoolspercpu_threadpoolsthreadpools_lockthreadpool_thread_pc__link_set_sysctl_funcs_sym_sysctl_threadpool_setupitimer_arm_realptimer_fireptimer_intrsettime1.constprop.0itimer_calloutptimers_allocptimer_freeitimer_decrptimer_itimer_opsptimer_queueitimer_realtime_changed_notifyptimer_sihcallout_lockcallout_softclockcallout_schedule_lockedcallout_waitcallout_cpu0callout_sihturnstile_removeturnstile_locksturnstile_chainstodr_wenabletimesettodr_mutextodr_handleuid_statssysctl_kern_uidinfo_cntnv.0uihashuihashtblkern_uidinfo_sysctllogbe16encbe16decresetprioritysysctl_sched_rttsdecay_cpu_batch__link_set_sysctl_funcs_sym_sysctl_sched_4bsd_setup_acl_append.isra.0acl_nfs4_compute_inherited_acl_psarc.isra.0strarray_match_internalstrarray_matchmatch_strcmpstrarray_pmatchmatch_pmatchdevice_compatible_match_strarray_internaldevice_compatible_match_strlist_internaldeviter_visitsdeviter_next1frob_cfdrivervecfrob_cfattachvecconfig_devlinkconfig_devfreeconfig_mountroot_threadconfig_devunlinkconfig_alldevs_enterconfig_alldevs_exitcfargs_canonicalizedevmon_report_devicedeviter_reinitcfdriver_get_iattr.isra.0cfparent_match.part.0config_cfattach_lookup_cd.isra.0config_interrupts_threadconfig_devallocmapplyconfig_search_internalconfig_process_deferredconfig_attach_internalmsgsalldevs_genalldevsmountroot_config_queuealldevs_garbagealldevs_nwritealldevs_nreadconfig_initializeddetachallconfig_pendingdeferred_config_queueinterrupt_config_queueconfig_finalize_listconfig_misc_lockconfig_do_twiddleconfig_twiddle_chconfig_misc_cvinitcftablernd_autoconf_sourcemountroot_config_lwpids_sizemountroot_config_lwpidsconfig_finalize_donealldevs_lockblst_leaf_allocblst_leaf_fillblst_radix_initblst_meta_allocblst_meta_fillblst_leaf_freeblst_meta_freeblst_copydocopysysctl_kern_bufq_strategiesbufq_strat_listbufq_mutexcprng_init_cpucprng_fini_cpucprng_strong_reseedsysctl_kern_urandomsysctl_kern_arandomcprng_sysctllogcpu_topology_fake1.constprop.0cpu_modellasttick.0cpu_topology_presentcpu_topology_haveslowcpufreq_set_all_rawcpufreq_get_rawcpufreq_set_rawcpufreq_lockcf_backenddevsw_detach_lockeddevsw_cvbdevswrefcdevswreffmt.0sysctl_doevcntevcnt_generationevcnt_lock__link_set_evcnts_sym_dummy_static_evcnt__link_set_sysctl_funcs_sym_sysctl_evcnt_setupextent_alloc_region_descriptorextent_free_region_descriptorextent_insert_and_optimize.constprop.0expoolhash_list_sizehashstat_sysctlhashstat_lock__link_set_sysctl_funcs_sym_sysctl_hash_setupinterrupt_intrio_list_sysctlinterrupt_set_affinity_sysctlinterrupt_intr_sysctlinterrupt_nointr_sysctlinterrupt_intrio_listinterrupt_shield_xcallinterrupt_shieldkintrio_set__link_set_sysctl_funcs_sym_sysctl_interrupt_setuptimermacsysctl_hw_iostatsiostati_getnames.part.0sysctl_hw_disknamessysctl_hw_iostatnamesipi_msg_cpu_handleripi_mark_pending.isra.0ipi_trigger_multi_internalipi_mngmt_lockipi_intrsipi_mboxfull_evipi_mboxeskcpuset_create_rawkc_last_idxkc_initialisedkc_bits_earlykc_noted_earlykc_memsizekc_bitsizekc_nfieldskmem_create_caches.constprop.0kmem_cache_sizeskmem_cache_big_sizeskmem_cachekmem_cache_bigkmem_cache_maxidxkmem_cache_big_maxidxlocalcount_adjustlocalcount_xcfilt_logreadlogcloselogopenlogsoftintrfilt_logrdetachlogpolllogioctllogkqfiltersysctl_msgbuflogread_filtopslog_locklog_pgidlog_asynclog_selplog_cvlog_sihlwp_specificdata_domainoncemtxoncecvoptstr_get_pointerpcu_do_oppcu_cpu_ipipcu_lwp_oppercpu_zero_cbpercpu_cpu_swappercpu_backend_allocpercpu_xcfuncpercpu_swap_lockpercpu_allocationpercpu_offset_arenapool_page_free_metapool_page_alloc_metapool_allocator_freepool_chk_pagepool_pcg_putpool_pcg_getpool_sysctlpr_phinpage_checkpool_print_pagelist.constprop.0.isra.0pool_pcg_truncpool_cache_transferpr_rmpagephtree_SPLAY_FINDpool_growpool_catchup.isra.0pool_cache_cpu_init1pr_pagelist_freepool_cache_invalidate_groupspool_cache_get_slowpool_cache_put_slowpcg_dummypool_allocator_bigpoolid_counterpool_head_lockpool_busypool_allocator_lockphpoolphpool_names.7pcg_normal_poolpcg_large_poolcache_cpu_pooldrainpppcg_large_cachepcg_normal_cache__link_set_sysctl_funcs_sym_sysctl_pool_setupputonekprintf_internal.constprop.0aprint_debug_internalaprint_verbose_internalaprint_naive_internalaprint_error_internalaprint_normal_internaltwiddle_chars.1kprintf_initedneedtstampkprintf_mtxaprint_error_countpos.2scratchstr.0psz_lock__link_set_evcnts_sym_psz_ev_excl_psref_held.constprop.0psreffed_p_xcspecificdata_noop_dtorspecificdata_destroy_datum.part.0timespec2nsokgc_allocgc_freeunlock_nodefree_wrapperalloc_wrapperhashval_getslotfind_edge_nodefind_edge_node_lockedstage_mem_gc.constprop.0key_cmp_p.isra.0hashval_initthmap_default_opsbt_freebt_remsegvmem_fitbt_freetrimstatic_btsvmem_destroy1vmem_rehash_all_kickfls32bt_insfreebt_refill.isra.0bt_refill_lockedbt_allocvmem_add1vmem_xfree_btbt_insbusyvmem_rehash_allpool_page_alloc_vmem_metaqc_poolpage_allocpool_page_free_vmem_metaqc_poolpage_freevmem_btag_freelist_countvmem_listvmem_bootstrappedvmem_btag_lockvmem_btag_freelistvmem_btag_poolvmem_rehash_wkvmem_rehash_wqvmem_btag_refill_lockvmem_list_lockvmem_rehash_intervalvmem_rehash_chkmem_va_meta_arena_storekmem_meta_arena_store__link_set_evcnts_sym_vmem_evcnt_static_bt_inuse__link_set_evcnts_sym_vmem_evcnt_static_bt_countworkqueue_sizeworkqueue_queue_lookupworkqueue_initqueueworkqueue_workerworkqueue_exitworkqueue_q_wait.constprop.0.isra.0xc_nopxc_threadxc_lowprixc_highprixc_low_prixc_high_prixc_broadcast_evxc_unicast_evxc_sihsaio_exitaio_sendsigaio_procinitaio_workeraio_enqueue_jobsysctl_aio_maxsysctl_aio_listio_maxaio_modcmdaio_syscallsaio_job_poolaio_jobs_countaio_lio_poolaio_ehook__link_set_modules_sym_aio_modinfo__link_set_sysctl_funcs_sym_sysctl_aio_initepoll_kev_put_eventsepoll_recover_watch_treeepoll_register_keventepoll_kev_fetch_changesepoll_delete_all_eventsepoll_kev_fetch_timeoutepoll_dfs.isra.0eventfd_fop_restarteventfd_filt_writeeventfd_filt_readeventfd_ioctleventfd_fop_kqfiltereventfd_filt_write_detacheventfd_filt_read_detacheventfd_fop_closeeventfd_fop_stateventfd_fop_polleventfd_fop_writeeventfd_fop_readeventfd_read_filteropseventfd_write_filteropseventfd_fileopsfutex_wait_dequeuecompare_futex_shared_keyfutex_holdfutex_lookup_by_keyfutex_rele_not_lastfutex_key_finifutex_testcompare_futex_keycompare_futexfutex_queue_lock2futex_queue_unlock2futex_relefutex_lookup_createfutex_func_waitcompare_futex_sharedfutex_wakefutex_lookupfutex_func_wakerelease_futex.constprop.0futex_rb_opsfutex_shared_rb_opsfutex_tabmemfd_ioctlmemfd_closememfd_seekmemfd_truncate_lockedmemfd_truncatememfd_mmapmemfd_statmemfd_fcntlmemfd_writememfd_readmemfd_prefixmemfd_fileopsmq_listener_cbmq_stat_fopmq_poll_fopmqueue_lookupmqueue_freemsgmqueue_destroymq_close_fopmqueue_modcmdmqueue_syscallsmqopsmq_prio_maxmq_listenermqueue_headmqlist_lockmqmsg_cache__link_set_modules_sym_mqueue_modinfo__link_set_sysctl_funcs_sym_mqueue_sysctl_initmi_startlwplwp_ss_initpsets_listener_cbpsid_validatekern_pset_destroysysctl_psets_maxsysctl_psets_listpsetspsets_count__link_set_sysctl_funcs_sym_sysctl_pset_setupanysetselclearsel_do_scansel_flagdirect_selectselcluster__link_set_sysctl_funcs_sym_sysctl_select_setupv0v1valid.0genkcpusetsched_listener_cbsched_sysctl_logsoo_fpathconfsoo_posix_fadvisetimerfd_fop_restarttimerfd_filt_readtimerfd_fop_ioctltimerfd_fop_kqfiltertimerfd_filt_read_detachtimerfd_fop_closetimerfd_fop_stattimerfd_waketimerfd_firetimerfd_realtime_changedtimerfd_fop_readtimerfd_fop_polltimerfd_read_filteropstimerfd_itimer_realtime_opstimerfd_itimer_monotonic_opstimerfd_fileopstty_listener_cbfilt_ttywritetty_get_qsizefilt_ttywdetachfilt_ttyrdetachsysctl_kern_tty_qsizettyprintf_nolock.constprop.0ttyechottyrubotty_set_qsizettysigintrttywait_timottnreadfilt_ttyreadttyread_filtopsttywrite_filtopstty_sigqueuettyref_cvconstty_psztty_sigsihttyldisc_lookup_lockedttyldisc_listtermios_discntty_discfilt_ptcwritefilt_ptcwdetachfilt_ptcrdetachfilt_ptcreadptcread_filtopsptcwrite_filtopspt_softctty_global_cccttykqfiltercttypollcttyioctlcttywritecttyreadcttyopenaccept_filter_init0accept_filtlsthdaccept_filter_init_once.0accept_filter_locksysctl_unpcblistdomain_init_timersCSWTCH.39domain_arraydomain_sysctllog__link_set_domains_sym_domain_dummynmbclusters_limitmbstat_convert_to_user_cbmb_ctorsysctl_kern_mbufsysctl_kern_mbuf_statsm_ext_freemb_drainm_split_internalm_copyback_internalm_copy_internalmclpool_warnmsgmcl_cachembstat_percpumbuf_sysctlloglink_initlink_acceptlink_bindlink_disconnectlink_statlink_rcvdlink_recvooblink_sendlink_sendooblink_detachlink_attachsubmemcmpsockaddr_dl_cmplink_connectlink_listenlink_connect2link_peeraddrlink_sockaddrlink_purgeiflink_shutdownlink_abortlink_ioctllink_usrreqs__link_set_domains_sym_linkdomain__link_set_domains_sym_unixdomainksem_listener_cbksem_sysfiniksem_lookup_pshared_lockedksem_stat_fopksem_read_fopksem_createname_destroyksem_freeksem_releaseksem_close_fopksem_lookupksem_permksem_getksem_modcmdname_copyinksem_syscallssemopsksem_listenernsems_totalksem_pshared_hashtabksem_pshared_lockksem_locknsemsksem_headksem_pshared_hashmask__link_set_modules_sym_ksem_modinfosbspacesbfreesbsyncsodopollsokvaunreservesocket_listener_cbsysctl_kern_sooptionssysctl_kern_sbmaxsysctl_kern_somaxkvafilt_soemptyfilt_solistensockopt_allocfilt_sowdetachfilt_sordetachfilt_sowritefilt_soreadsopendfree_threadsolisten_filtopssoread_filtopssowrite_filtopssoempty_filtopsso_pendfreeso_pendfree_locksocurkvasocurkva_cvpendfree_thread_cvsocket_sysctllogsopendfree_lwpsballocCSWTCH.51socket_cachesb_max_adjktrkusersockargs_sbgetsockopt.constprop.0unp_recvoobunp_ioctlunp_statunp_scanunp_setaddrunp_sockaddrunp_peeraddrunp_resetlockunp_listenunp_freeunp_sendoobunp_disconnect1unp_disconnectunp_rcvdunp_dropunp_shutdownunp_detachunp_abortunp_attachunp_discard_laterunp_markunp_discard_now.part.0unp_setpeerlocks.part.0unp_connect1.constprop.0unp_threadunp_acceptunp_bindunp_senduipc_lockunp_thread_discardunp_thread_cvunp_deferusrreq_sysctllogunp_thread_lwpacl_type_unoldacl_copyin.part.0acl_copyinacl_copyoutbuf_mempoolidxbufpool_page_freebufpool_page_allocsysctl_dobufwapbl_vptompbufhash_statswapbl_vphaswapblbuf_setwmsysctl_bufvm_updatebiointrgetnewbufbiodone2buf_trimbio_doreadbufmempool_allocatorbuf_mapbuf_cacheneedbuffer_cvbufio_cachebmempoolsvfsbio_sysctllogbiodone_sihbufqueuesKPREEMPT_DISABLEcache_vdir_filtercache_compare_nodescache_activatecache_lookup_entrycache_removecache_update_statscache_purge_childrencache_deactivatecache_stat_sysctlcache_keycache_mp_namecache_rbtree_opscache_stat_calloutcache_sysctllogcache_lru_lockcache_lrucache_stat_lockhash32_strn.constprop.0maxdirhashsizedirhash_queuedirhash_pooldirhash_entry_pooldirhashmutexmount_listener_cbvfs_sysctlloglf_alloclf_findoverlaplf_getblocklf_splitlf_wakelocklf_freelf_clearlocklockstrlockf_lockpathbuf_create_rawlookup_parsepathnamei_cleanuplookup_crossmount.isra.0lookup_oncenamei_tryemulrootns_nnns_ntns_fnns_ftvfs_vnode_iterator_next1start_extattr_mountlist_iterator_nextvfs_unmount_nextmountlistmount_specificdata_domainmntid_lockmountgenxxxfs_mntid.0mountlist_lockmountgen_lockvn_syncer_add1vprint_common.constprop.0CSWTCH.112vttodt_tabsyncer_delaynosyncer_workitem_pendingsyncer_lastsyncer_data_lockincr.1next.2start.0sync_vnode_filterfilt_fsfilt_fsdetachfilt_fsattachvfs__fhfreedo_sys_quotactl_cursorgetopen_setfpchange_flagschange_modekern_pathconfchange_ownerfd_nameiat_simple_user.constprop.0fd_nameiat.constprop.0do_sys_readlinkatdo_sys_mkfifoatdo_sys_mkdirat.isra.0do_sys_renameat.isra.0do_sys_unlinkat.isra.0do_sys_symlinkat.isra.0do_sys_openatfs_klist_lockfs_klistfstrans_lwp_pcdfstrans_lwp_pccgrant_lockcow_change_entercow_change_donefstrans_mount_dtorfstrans_mount_hashfstrans_mount_getfstrans_alloc_lwp_infofstrans_get_lwp_info_fstrans_startfstrans_fli_headfstrans_state_cvfstrans_pszfstrans_count_cvfstrans_gone_countfstrans_mount_hashmaskfstrans_mount_hashtabfstrans_lwp_cachefstrans_lockvfs_suspend_lockvtryrelevnpanicvstate_changevstate_wait_stablevrevoke_suspend_nextvcache_hash_lookupvcache_statslru_requeuevcache_freevcache_alloclru_iter_next.isra.0vcache_hashvcache_reclaimvrelelvrele_deferredvcache_deallocvdrain_taskvrele_tasklru_iter_firstlru_iter_release.isra.0vdrain_onevcache_cvvcache_hashtabvcache_hashmaskvrele_jobthreadpoolvdrain_jobvcache_poolvcache_hashsizevcache_lockvdrain_lockvn_knote_to_interestvn_posix_fadvisevn_pollvn_fcntlenforce_rlimit_fsizevn_truncatevn_fpathconfvn_advlockvn_seekvn_mmapvn_statfilevn_ioctlvn_writevn_readvn_closefileextattr_list_vpxattr_nativektr_xattr_nameextattr_set_vpextattr_delete_vpextattr_get_vpvop_preVN_KEVENT_INTERESTdead_panicdead_vnodeopv_descsdead_vnodeop_entriessoreadablefifo_lookupfifo_inactivefifo_bmapfifo_pathconffifo_kqfilterfilt_fifowdetachfilt_fiforeadfilt_fifordetachfifo_pollfifo_ioctlfifo_openfifo_socantrcvmorefifo_printfilt_fifowritefiforead_filtopsfifowrite_filtopsgenfs_rel_pagesgenfs_dio_iodonegenfs_do_iogenfs_rename_lock.constprop.0genfs_rename_exit.constprop.0filt_genfsvnodefilt_genfswritefilt_genfsreadfilt_genfsdetachgenfsread_filtopsgenfswrite_filtopsgenfsvnode_filtopsaccmode2masklayerfs_modcmd__link_set_modules_sym_layerfs_modinfo__link_set_sysctl_funcs_sym_sysctl_vfs_layerfs_setuprawio_listener_cbspec_io_enterspec_io_drainspec_io_exit.constprop.0.isra.0specfs_iocvspecfs_hashdays_in_monthis_leap_yeardk_subr_modcmddk_translatedk_strategy1dk_dumping__link_set_modules_sym_dk_subr_modinfodkwedge_matchdkwedge_sizedkwedge_detachdk_set_geometrydkwedge_attachdkwedge_lookupdkdiscarddkcanceldksizedkdumpdkioctldkstartdkiodonedkstrategydkrestartdk_open_parentdkopendkwritedkminphysdkreaddkwedge_compute_pdevdkwedge_delall1dkclosedkwedges_lockndkwedgesdkwedge_discovery_methods_lockdkwedge_discovery_methods__link_set_dkwedge_methods_sym_dummy_discovery_methoddkwedge_discover_apple__link_set_dkwedge_methods_sym_APPLE_ddmdkwedge_discover_gptgpt_hdr_sig.1ent_type_unused.0gpt_ptype_guid_to_str_tab__link_set_dkwedge_methods_sym_GPT_ddmmdsizemd_set_disklabelmdstrategymdclosemdopenmd_detachmd_attachmdwritemdreadmdioctlmddkdrivermd_device_lockmm_ioctlmm_mmapmm_openmm_readwritedev_mem_lockdev_mem_addrdev_zero_pagerandom_openrandom_closerandom_kqfilterrandom_pollrandom_ioctlrandom_writerandom_readuser_rndsourcepslist_writer_removefilt_bpfreadreset_d_bpf_register_track_eventbpf_kqfilterfilt_bpfrdetach_bpf_deregister_track_eventbpf_detachdbpf_free_filterbpf_closebpf_statbpf_pollbpf_timed_outbpf_wakeupbpf_softintr_bpf_mtap_softintbpf_xfilterbpf_readsysctl_net_bpf_maxbufsizebpf_sysctl_gstats_handlersysctl_net_bpf_peersbpf_stats_bpf_mtap_softint_initbpf_mtap_sibpf_mcpy_bpf_change_typebpf_modcmdbpf_write_bpfdetachbpf_deliver_bpf_mtap2_bpf_mtap_sl_out_bpf_mtap_sl_in_bpf_mtap_af_bpfattachbpf_attachdbpf_ioctlbpfread_filtopsbpf_fileopsbpf_mtxbpf_iflistbpf_pszbpf_dlistbpf_gstats_percpudst.1bpf_psref_class__link_set_modules_sym_bpf_modinfo__link_set_sysctl_funcs_sym_sysctl_net_bpf_setupbpf_filter_modcmd__link_set_modules_sym_bpf_filter_modinfobpf_stub_nullbpf_stub_detachbpf_stub_attachbpf_stub_warnlagdrvshandovermtxhandovercvhandoverlla_snprintf1if_listener_cbif_percpuq_dropsif_deferred_start_softintif_delroute_matcherif_percpuq_init_ifqif_clone_lookupif_up_lockedif_percpuq_purge_ifqif_tunnel_ro_init_pcsysctl_if_watchdogsysctl_percpuq_drops_handlerif_tunnel_ro_fini_pcif_tunnel_rtcache_free_pcbpf_mtap.constprop.0if_deferred_start_commonif_slowtimo_intrif_attachdomain1if_slowtimo_workif_link_state_change_workif_transmitif_percpuq_softintdoifioctlif_sdl_sysctlif_clonersif_indexlimifindex2ifnetif_indexif_clone_mtxifnet_pszif_cloners_countindex_genif_slowtimo_wqifnet_link_state_wqifnet_psref_classether_outputether_ioctl_reinitether_multicast_sysctlether_lookup_multi.isra.0ether_bpf_mtapcrctab.2zero.1vlan_zero_pad_buff.0etherbuf.3earlypkts.4ether_pktq_rps_hash_phtable_foreach_llelltable_free_cbhtable_free_tblhtable_link_entryhtable_unlink_entryhtable_prefix_free_cbhtable_prefix_freellentry_poollltablesloop_rtrequestloop_clone_destroyloop_clone_createif_loop_modcmdloop_cloner__link_set_modules_sym_if_loop_modinfoifmedia_baudrate_descriptionsif_stats_to_if_data_cbnd_timernd_domainspfil_hook_getpfil_listset_initpfil_list_addpfil_run_argpfil_list_remove.isra.0pfil_mtxpfil_psref_classpfil_head_listpktq_rps_hash_zeropktq_rps_hash_curcpupktq_fini_cpupktq_init_cpupktqueue_list_initpktq_pcqpktq_inc_countpktq_rps_hash_toeplitzpktq_rps_hash_toeplitz_othercpussysctl_pktq_countpktq_collect_countssysctl_pktq_dropssysctl_pktq_nitemspktq_set_maxlen_cpusysctl_pktq_maxlenpktq_rps_hash_tabpktqueue_listpktqueue_list_lockpktqueue_list_init_oncenetstat_convert_to_user_cbrn_satisfies_leafrn_lexobetterrn_new_radix_maskrn_walknext.constprop.0normal_charslast_zeroed.0delayinitsrn_onesaddmask_keyradix_initializedrn_zerosroute_listener_cbrt_maskedcopyrt_ifa_connectedrt_destroyrt_timer_timerrt_getifprt_timer_workrtcache_percpu_init_cpurt_free_workrtalloc1_locked.constprop.0ifa_ifwithroute_psrefrt_getifa_rtcache_initrt_init_donert_timer_wkrt_timer_wqrttimer_poolrt_timer_chrttrashrtentry_poolrtcache_generationrt_free_globalrt_update_globalrt_psref_classrt_walktree_visitorrt_tablesrt_pr_initrt_getlenroute_bind_wrapperroute_connect2_wrapperroute_ioctl_wrapperroute_stat_wrapperroute_rcvd_wrapperroute_recvoob_wrapperroute_purgeif_wrapperroute_abort_wrapperroute_accept_wrapperroute_sendoob_wrapperroute_get_sdl_indexroute_intr_rt_setmetricsrt_msg2route_sockaddr_wrapperroute_peeraddr_wrapperroute_ctloutputsysctl_dumpentryrt_adjustcountroute_filterroute_connect_wrapperroute_listen_wrapperroute_output_reportroute_outputsysctl_rtableroute_attach_wrapperroute_detach_wrapperroute_disconnect_wrapperroute_shutdown_wrapperroute_send_wrapperrt_makeifannouncemsgrt_addrmsg0route_initCSWTCH.186route_usrreqsroute_protoswrt_rawcb__link_set_domains_sym_routedomainstoeplitz_hash_n32stoeplitz_syskey_cachestoeplitz_keyseedarp_drainstubarp_nud_enabledarp_llinfo_reachablearp_llinfo_retransarp_llinfo_holdsrcar_thasysctl_net_inet_arp_statsarp_setgatearp_dad_stoptimerar_tpaarp_initarp_freearp_llinfo_missedif_output_lock.constprop.0.isra.0arprequestin_get_ia_on_ifacein_get_ia_on_iface_psrefarp_llinfo_outputarp_dad_stoparp_fasttimoarpannounce1arp_dad_startarp_dad_timerin_arpinputarpswarp_perform_nudarp_reachablearp_retransarp_nd_domainlog_movementslog_permanent_modifylog_wrong_ifacerevarp_in_progressmyip_ifpmyip_initializedarp_drainwantedarpstat_percpuarp_dad_locksrv_ipmyip__link_set_domains_sym_arpdomainencap_key_initencap6_lookupencap_initializedencap_mapencaptabencap_wholewqinput_dropswqinput_percpu_init_cpuwqinput_sysctl_drops_handlerwqinput_worksuser_isrootsuser_evalsuser_modcmdl_processl_networkl_machdepl_devicel_vnodesuser_sm__link_set_modules_sym_suser_modinfo__link_set_sysctl_funcs_sym_sysctl_security_suser_setupsecurelevel_evalsecurelevel_modcmdsecurelevelsecurelevel_sm__link_set_modules_sym_securelevel_modinfo__link_set_sysctl_funcs_sym_sysctl_security_securelevel_setupsecmodel_extensions_network_cbsecmodel_extensions_process_cbsysctl_extensions_curtain_handlerextensions_modcmdis_securelevel_above.constprop.0curtainuser_set_cpu_affinityextensions_sm__link_set_modules_sym_extensions_modinfo__link_set_sysctl_funcs_sym_sysctl_security_extensions_setupsecmodel_extensions_vnode_cbsecmodel_extensions_system_cbhardlink_check_uidhardlink_check_giddovfsusermountsecmodel_bsd44_modcmdbsd44_sm__link_set_modules_sym_secmodel_bsd44_modinfo__link_set_sysctl_funcs_sym_sysctl_security_bsd44_setupld_cfattachinitbrgphy_cfattachinitnsphy_cfattachinitnsphyter_cfattachinitqsphy_cfattachinitinphy_cfattachinitiophy_cfattachinitexphy_cfattachinitlxtphy_cfattachiniticsphy_cfattachinitsqphy_cfattachinitdmphy_cfattachinitpnaphy_cfattachinitukphy_cfattachinitwi_cfattachinitne_cfattachinitcom_cfattachinitwdc_cfattachinitatabus_cfattachinitwsdisplay_cfattachinitwskbd_cfattachinitmainbus_cfattachinitcpu_cfattachinitwd_cfattachinitsdmmc_cfattachinitpxaip_cfattachinitpxaintc_cfattachinitpxagpio_cfattachinitsaost_cfattachinitpxadmac_cfattachinitpxapcic_cfattachinitpxartc_cfattachinitpxamci_cfattachinitziic_cfattachinitscoop_cfattachinitzssp_cfattachinitw100lcd_cfattachinitlcdctl_cfattachinitzkbd_cfattachinitapmdev_cfattachinitzapm_cfattachinitpcmcia_cfattachinitpspec32pspec31pspec30pspec18pspec17pspec16pspec15pspec11pspec10pspec7pspec3pspec2pspec1pspec0pcmcia_attrspcmciacf_iattrdatazapm_attrsapmdevifcf_iattrdatazkbd_attrswskbddevcf_iattrdataw100lcd_attrswsemuldisplaydevcf_iattrdatazssp_attrszsspcf_iattrdataziic_attrsi2cbuscf_iattrdatapxamci_attrssdmmcbuscf_iattrdatapxapcic_attrspcmciabuscf_iattrdatapxagpio_attrsgpiobuscf_iattrdatapxaip_attrspxaipcf_iattrdatasdmmc_attrssdmmccf_iattrdatacpu_attrscpucf_iattrdatamainbus_attrsmainbuscf_iattrdataatabus_attrsata_hlcf_iattrdataatapicf_iattrdatawdc_attrsatacf_iattrdatacom_attrscomcf_iattrdatane_attrsmiicf_iattrdataiiccf_iattrdataknown_answersentry_match_pradix_tree_sum_noderadix_tree_alloc_noderadix_tree_growradix_tree_lookup_ptrradix_tree_undo_insert_nodeptn_types.0strlist_match_internalcrc_tablebe64encSHA224_256_FinalSHA512_Lastsha256_initial_hash_valueK256sha224_initial_hash_valuesha512_initial_hash_valueK512sha384_initial_hash_valueEncodeMD5TransformPADDING_prop_object_copyin_sizeprop_dictionary_set_signed_numberprop_dictionary_set_unsigned_numberCSWTCH.2store_eolstore_nummaybe_wrap_linestore_delimiterRC.0_prop_string_alloc_prop_string_rb_compare_key_prop_string_rb_compare_nodes_prop_string_free_prop_string_instantiate_prop_string_init_prop_string_equals_prop_string_externalize_prop_object_type_string_prop_string_rb_tree_ops_prop_string_type_tags_prop_string_init_once_prop_string_tree_mutex_prop_string_tree__link_set_prop_linkpools_sym__link__prop_string_pool_prop_number_equals_prop_number_lock_prop_number_init_prop_number_unlock_prop_number_externalize_prop_number_free_prop_number_compare_values_prop_number_rb_compare_nodes_prop_number_rb_compare_key_prop_number_alloc_prop_number_type_tags_prop_number_rb_tree_ops_prop_object_type_number_prop_number_init_once_prop_number_tree_mutex_prop_number_tree__link_set_prop_linkpools_sym__link__prop_number_pool_prop_xml_intern_skip_comment_prop_json_intern_decode_uesc_getu16_prop_object_internalize_json.constprop.0_prop_xml_intern_by_tag_prop_object_internalizer_table_prop_dict_keysym_equals_prop_dictionary_iterator_next_object_locked_prop_dictionary_alloc_prop_dictionary_unlock_prop_dictionary_lock_prop_dict_init_prop_dict_keysym_rb_compare_key_prop_dict_keysym_rb_compare_nodes_prop_dict_lookup_prop_dictionary_equals_finish_prop_dictionary_iterator_next_object_prop_dictionary_iterator_locked_prop_dictionary_iterator_reset_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dictionary_free_prop_dictionary_expand_prop_dictionary_internalize_body_prop_dictionary_internalize_continue_prop_dictionary_get_prop_dictionary_externalize_prop_dict_keysym_put_prop_dict_keysym_free_prop_dictionary_equals_prop_object_type_dictionary_prop_dict_keysym_rb_tree_ops_prop_dict_key_type_tags_prop_dictionary_type_tags_prop_object_type_dict_keysym_prop_dict_init_once_prop_dict_keysym_tree_mutex_prop_dict_keysym_tree__link_set_prop_linkpools_sym__link__prop_dictionary_pool__link_set_prop_linkpools_sym__link__prop_dictionary_keysym128_pool__link_set_prop_linkpools_sym__link__prop_dictionary_keysym32_pool__link_set_prop_linkpools_sym__link__prop_dictionary_keysym16_pool_prop_data_alloc_prop_data_equals_prop_data_externalize_prop_data_free_prop_data_internalize_decode.isra.0_prop_object_type_data_prop_data_type_tags_prop_data_base64__link_set_prop_linkpools_sym__link__prop_data_pool_prop_bool_free_prop_bool_equals_prop_bool_alloc_prop_bool_init_prop_bool_externalize_prop_object_type_bool_prop_bool_true_type_tagstruestr_prop_bool_false_type_tagsfalsestr_prop_bool_init_once_prop_bool_true_prop_bool_false_prop_array_emergency_free_prop_array_iterator_next_object_locked_prop_array_alloc_prop_array_equals_finish_prop_array_equals_prop_array_iterator_next_object_prop_array_iterator_locked_prop_array_iterator_reset_prop_array_externalize_prop_array_free_prop_array_expand_prop_array_internalize_body_prop_array_internalize_continue_prop_array_add_prop_object_type_array_prop_array_type_tags__link_set_prop_linkpools_sym__link__prop_array_poolrb_tree_reparent_nodes.constprop.0rb_tree_removal_rebalance_plist_xml_header.0_plist_type_tagstimespecsubokrwlock_lockopsdk_sizedo_sys_statatuvm_pagereplacecpu_simdex_presentin6_purgeaddrether_enable_vlan_mtucd9660_loadvnodepgid_in_sessionexechook_establishsdmmc_io_write_4threadpool_cancel_job_asyncm_devgetsyn_cache_getigmp_purgeifin_controlsa6_recoverscopepfctlinput_KERNEL_OPT_KGDB_DEVMODE_KERNEL_OPT_UVMMAP_COUNTERSktr_execargne2000_suspendsys_fsync_rangetc_gonebaddevice_pmf_is_registeredsock_loan_threshsdmmc_io_write_2prop_number_uint32_valuemsdosfs_gop_allocdo_timerfd_gettimeieee80211_create_ibssvt100_initchartablesuvm_pageratopaprint_get_error_countfputdummyprop_dictionary_copyout_ioctludpstat_percpufd_ktrexecfdzssp_ic_sendmax_cdevswssys___gettimeofday50wsmux_set_displayubc_winsizeip6_mloopbackvop_islocked_descras_purgeallsys_extattr_get_fileuao_inituvmspace_inituvm_voaddr_acquirevn_markexec_KERNEL_OPT_NINETsys_getsockopt_KERNEL_OPT_NFS_BOOTSTATIC_SERVERvop_seek_descsppp_params_50_hookvop_parsepath_vp_offsetsprop_dictionary_set_int8sys_setsockopt_KERNEL_OPT_WI_PCMCIA_SPECTRUM24T_FWmdattachwsemul_vt100_translatenamei_simple_kernelfc_wherefromproc_alloc_lwpid_atomic_dec_32dkcksum_sizedsecmodel_suser_startuvm_page_lookup_freelistrpc_mismatchnfs_lookitupkcpuset_uselwpinituvm_pagelockktr_execfdallocbufsoqinsquenchinitcpu_startup_default_KERNEL_OPT_MSGSSZentropy_resetlwp_findw100_mmapuvm_map_cleandumpcdevkauth_cred_uidmatchip6_log_intervaluvmpdpol_pageactivate_pnfs_flushstalebufm_split_KERNEL_OPT_makeoptions_MEMORY_DISK_IMAGEpte_l1_s_prot_wpte_l2_s_cache_masksysctl_basenode_initexec_addin_ifaddrhashffs_initffs_deleteextattrvprintf_flagswskbdclosenfs_bioreadfd_affix_KERNEL_OPT_WSEMUL_VT100if_attach__aeabi_uldivmod_KERNEL_OPT_DCCP_TFRCffs_loadvnodezmci_ca_KERNEL_OPT_WSCONS_SUPPORT_ISO7FONTSprop_dictionary_get_int32ptmcallback_head_destroy_KERNEL_OPT_NETATALKkcpuset_createplatid_ntohvop_mmap_descacl_nfs4_compute_inherited_aclunp_connect_KERNEL_OPT_BPFJITtcp_new_issmountroothook_disestabliship_setpktoptspfslowtimoiic_compatible_matchset_cpufuncsptsopenkobj_statpxa2x0_gpio_set_function__stop_link_set_sysctl_funcsustore_ptrvfs_set_lowermountubchist_initieee80211_sta_joinpcmcia_config_unmappte_l1_s_prot_uremove_coproc_handlerin6_if_link_downradix_tree_empty_tree_psys_mremapnfsv2_typewi_activatesdmmc_pauseuvm_pagewire_KERNEL_OPT_UVM_RESERVED_PAGES_PER_CPUspec_fdiscardgetuptime32kpsendsigsccslwp_ctl_allocdmover_backend_registerVOP_SEEK_KERNEL_OPT_FONT_GALLANT12x22prop_bool_createtcp_sack_initm_remove_pkthdrcpu_do_powersavea4x_bs_rm_2a4x_bs_rm_4in6_initrip6_inithashinituvm_readaheadufs_rmdir_KERNEL_OPT_NFS_BOOT_TCP_KERNEL_OPT_COMPAT_SUNOSip_mtudisc_timeout_qvcache_make_anon_KERNEL_OPT_BUFCACHEieee80211_note_macrb_tree_find_node_geqsched_initdk_getdefaultlabelwsdisplaystopamap_unrefatabus_ca__aeabi_memmoveVOP_WRITEsys_pacceptcompat_bio_30_hookeventswitchpte_l2_s_prot_maskaccept_filt_cleardumpdevif_percpuq_destroypxaintc_camount_specific_key_deletedevice_xnameuvmpdpol_pageactivateieee80211_node_unauthorizebr_aes_ct_bitslice_encryptpmap_devmap_find_vaSHA224_Updatedk_strategybs_notimpl_bs_rm_2lltable_freecd9660_reclaimspec_kqfilterrtsock_newaddr_70_hookatabusclose_prop_data_internalizekauth_proc_chroot_kernel_lockmsdosfs_mountrootrt_ifannouncemsgbs_notimpl_bs_r_1uvm_map_willneedwsdisplay_cdvop_write_vp_offsetsdirhash_getvfs_special_vnodeopv_descsmsdosfs_rootufs_gro_rename_check_possible_KERNEL_OPT_NKMEMPAGES_MINip6_maxfragpacketssoreservepool_sethiwatw100_cnattachapmdev_cdufs_direct_cacheoptstr_get_number_binarypktq_sysctl_setuptcp_statincrndattachvop_listextattr_descwdc_drvprobeexec_vm_minaddriic_smbus_write_bytecpu_rootconfrpc_msgacceptedtcp_autosndbuf_maxicmp6_ctloutput_KERNEL_OPT_WSKBD_EVENT_AUTOREPEATnfs_flushkillprocnd6_sysctltk_ninkern_has_sysvshmbs_notimpl_bs_rm_8prop_object_copyinmask_rnheadVOP_LINK_KERNEL_OPT_WSDISPLAY_DEFAULTSCREENSpcmcia_printstoeplitz_cache_initrip_usrreqsblist_createwskbd_cdprop_dictionary_set_cstring_nocopytcp_timer_rexmt__stop_link_set_dkwedge_methodsuvm_pgflcache_filldata_abort_handler_addressin_domifdetachpcmcia_ccr_writecv_waitustore_charSHA1Finaldevice_compatible_match_strlistrtsock_rt_ieee80211msg_50_hookdomaininit_postcom_rbuf_lowat_KERNEL_OPT_CPU_CORTEXnfs_openudp6stat_percpuuvm_pagedequeuegpiobus_printffs_sbupdatevfs_quotactl_cursoratendaes_ccm_decm_tag_delete_chaintcp_rmx_rttvop_close_descprop_object_copyoutVOP_GETEXTATTRfd_hold_ufetch_32mfs_closeip_reass_slowtimonfs_enterdircachepmap_zero_page_xscalenfs_getattrcacheabtstackextent_initcpu_gtmr_exists_pcpu_reboottcp_timer_keepsys___getloginbs_notimpl_bs_rm_4wi_detach_rnd_add_uint32VOP_ACCESSnfs_loadattrcachein6_multi_group_KERNEL_OPT_WSDISPLAY_SCROLLSUPPORTkern_assertkcpuset_ffs_intersectingwskbdkqfilterprop_object_copyin_ioctl_sizesocketopsemul_find_interpbufq_getstrategynamecpufreq_get_backendtcp_vtw_was_enabled_KERNEL_OPT_COM_DEBUGdmover_backend_alloccopy_statvfs_infoVOP_OPENEXTATTRcpu_unaligned_sigbusin6ifa_ifpforlinklocal_psreftcp_reno_ctlin_addmultiin6_if_downpxa2x0_bs_unmapvrele_flushpxartc_cdklist_initsecmodel_initscoop_battery_temp_adc_KERNEL_OPT_UBC_STATSuvmpdpol_idledk_closeVOP_SYMLINKffs_vallocwsevent_pollsa11x0_intr_establishpcmcia_function_disablecpuidsicmp_mtudisc_lockmfs_rootsizeprop_number_equals_integerip6_mrtprotokernconfig_unlockrasops_pmaskrtcache_percpu_allocicmp6_mtudisc_callback_registerdo_filewritev__aeabi_uidivsys_setgidnextckmem_tmpbuf_freedl10022_mii_bitbang_opslf_advlocksdmmc_add_taskbdev_typeifa_ifwithdstaddr_KERNEL_OPT_COMPAT_50uvmpdpol_scaninitif_initnameigmp_inputentropy_epoch_KERNEL_OPT_COM_TOLERANCEsys___getitimer50sys__lwp_waitmodule_kerneldmover_funcname_iscsi_crc32c_kernel_locked_psys___clonemutex_obj_freeether_delmultiirq_entrysecmodel_securelevel_initffs_initcountcfdriver_list_initialsched_vforkexecsolockretrybr_aes_ct_inv_mix_columnsrb_tree_initbdev_ioctlpowerhook_debugfd_clonepxa2x0_i2c_send_stopkernel_textpreempt_pointpathbuf_createkcpuset_runningvmcmd_map_readvnkauth_cred_toucredrw_tryupgradecpu_count_synclwp_ctl_exitrw_read_held_atomic_swap_ptrmsdosfs_clusterfreeif_initfscow_runsched_rrticks_prop_extern_append_start_tag_KERNEL_OPT_NVLANdev_minor_unit_KERNEL_OPT_COMPAT_13soconnectwsevent_fini_KERNEL_OPT_IPSEC_KERNEL_OPT_UFS_EXTATTRrtl80x9_init_cardradix_tree_empty_tagged_tree_pmsdosfs_win2unixfnpcmcia_socket_disablelltable_purge_entrieslink_rtrequestpool_initswapdevmsdosfs_vnodeop_entriesdisk_renamedisklabel_dev_unituvm_shmforkknote_fdcloseextent_freeifa_ifwithdstaddr_psrefmd_cauvmpdpol_balancequeueif43_cvtcmd_20_hookraw_setsockaddr_KERNEL_OPT_COMPAT_11_bus_dmamap_load_uiosoftint_triggerkcpuset_export_u32xscale_setttbnfs_mknodrpcpmf_system_suspenditimer_lockprop_dictionary_set_uint32_KERNEL_OPT_SCSIPI_DEBUGkern_cprnglocalcount_initdo_sys_mkdirkauth_cred_clonepcmcia_ccr_readffs_snapshot_finiif_stats_finicpufunc_controlmii_pollstatm_pulldownsys_sa_enablewsemul_dumb_detachnumvnodessoo_restartsys___timer_gettime50cprng_fast32ffs_unmountata_waitdrain_xfer_checkaes_ccm_encnfs_readlinkencap_lock_heldroute6_inputieee80211_refine_node_for_beaconmfs_openukphy_ca_KERNEL_OPT_PPPOE_DEQUEUE_MAXLENktr_psigprop_string_comparesdmmc_cdether_sprintfvfs_syncer_add_to_worklistpnaphy_cdaprint_debug_dev_KERNEL_OPT_SDMMC_DEBUGmfs_vnodeop_opv_descieee80211_print_essidin6ifa_ifpwithaddr_psrefmutex_spin_exitaobj_pagerbs_notimpl_bs_w_1vop_default_descmsdosfs_mkdiruvm_map_extractpmf_device_recursive_resumesysctl_queryif_nullioctlmakefstypetcbtablekern_sig_43_pgid_maskufs_fhtovp_KERNEL_OPT_SYSCALL_STATSicmp6_mtudisc_callbackssys___kevent100uvm_pagereallocconfig_initfilt_seltruenamecache_count_2passesthmap_putvop_read_vp_offsetsttrstrtfstrans_lwp_dtorieee80211_cfggetprop_kern_initksiginfo_freedp8390_watchdogatabus_cdevswgeneric_bs_wm_1prop_dictionary_copyin_sizeuvm_page_physloadsys__lwp_detachvfs_shutdownlayer_rmdir_KERNEL_OPT_CPU_SA1110pxa2x0_memctl_bootstrapieee80211_rssadapt_sysctl_setuprasops15_initsys__ksem_trywaitrn_lookupufs_gro_removepxa2x0_clkman_bootstrapkern_has_sysvmsgmsdosfs_detruncsecmodel_suser_device_cbin6addr_nodelocal_allnodes_KERNEL_OPT_DCCP_DEBUG_ONffs_mountsockaddr_format_KERNEL_OPT_TCP_DEBUGpool_cache_get_paddrMD5Updateuvm_pagelock2pmf_device_register1prop_number_copywsfont_initdevhandle_subclasswsmux_detach_scrn_addroutepxa2x0_clkman_confighashstat_registernd6_prunegenfs_can_chtimesmem_cdevswpool_setlowattc_setclock_prop_extern_start_lineuvm_unmap_detachpmap_map_chunkata_queue_allockmem_roundup_sizegenfs_can_access_acl_posix1eqsphy_camd_cdevswmsdosfs_readlocalcount_debug_refcntrunq_initchacha_const32msdosfs_vnodeop_opv_descpmap_icache_sync_rangegenfs_einvalacct_process_bus_dmatag_destroyip_getmoptionsvfs_vnode_iterator_nextdk_cdevswcomwrite_KERNEL_OPT_SEMMSLicmpreturndatabytesffs_discard_finishuvm_idle__aeabi_ldivmoddisk_isbusyprop_string_create_cstring_nocopysyn_cache_cleanupportalgo_algo_index_selectaccept_filt_delpool_nputradix_tree_remove_nodeudp_input_checksum_KERNEL_OPT_FONT_BOLD16x32ata_print_modesbufpagesbdev_close_KERNEL_OPT_NWSMUXunp_inofutex_sys_initinpcb_rtchangecpuctlattachlog_opennfs_fsinfobrgphy_cdxscale_cache_clean_sizecache_enter_mountuvm_ra_freectxspec_vnodeop_opv_descieee80211_watchdogvfs_copyinfh_alloc_KERNEL_OPT_FDTpreempt_neededlltable_prefix_freedevice_compatible_plookupsys_sa_preemptffs_snapgonevmspace0thmap_delinetctlerrmapswapdev_vpifinit1prop_dictionary_set_ulonglongcache_vnode_initieee80211_add_xratesdead_vfsopsvop_pathconf_descne_cduvm_unmap_remove_KERNEL_OPT_EXEC_AOUTtcp_minmss_KERNEL_OPT_CPU_SHEEVAuipc_syscalls_40_hookkern_proc32_base_hookkernel_mapkmembaseieee80211_cipher_ccmpvrecycleifaof_ifpforaddr_psrefSHA384_Initpmap_zero_page_funcgeneric_bs_r_1config_detachkernel_pt_tabletime_wraps_KERNEL_OPT_PPS_SYNCiostat_seekuvm_km_freesys_acctnfs_removerpcether_del_vlantagioctl_copyoutbus_space_reservation_mapttspeedtab_KERNEL_OPT_UVMamap_swap_offin6pcb_fetch_sockaddriophy_cadp8390_initin6_ifremlocalfrag6_inputsockaddr_dupufs_strategyvop_getattr_desc__bss_start__cd9660_setattr_KERNEL_OPT_WSEMUL_VT100_HILIT_BGdevice_pmf_driver_resumeuvm_update_uvmexpnfs_iodfiniffsext_strategyuvm_physseg_unplugdisk_destroystrtoulllayerfs_vgetif_linkstate_change_establishnfs_boot_setrecvtimoencap4_inputvop_read_desclwp_find2apm_majverip6_if_outputwsevent_initieee80211_tmp_nodewsemul_dropnd6_llinfo_release_pktsmii_bitbang_writereglwp_delrefttycharsdmover_doneuvm_coredump_count_segscallout_init_cpukauth_cred_to_uucredetherbroadcastaddrsys_lgetxattr_KERNEL_OPT_ARM_INTR_IMPLvop_advlock_vp_offsetssys_writeva4x_bs_r_2kernel_l1ptklist_finikcpuset_matchmld_inputbooted_methoddevsw_chr2blkprop_string_create_cstringldenddetachdl10019_mii_bitbang_opsvop_remove_descmbstatttypausesched_syncsigactsunshareieee80211_ctl_subtype_nameswapsys_lockip_reass_packetbiodone_vfsspecificdata_setspecificpt_softc_mutexpool_sethardlimitsysctl_nullvector_pagettyldisc_releasenfsfifo_writeuvm_map_clip_endm_gethdr_nktr_mibbr_aes_ct_bitslice_decryptknote_set_eofpercpu_getptr_remotepstatscopypxa2x0_gpio_bootstrapnfs_boot_ifupdownnfs_iodbusyvholdlprop_dictionary_get_cstringrtinitVFS_QUOTACTLcnhaltufs_printcd9660_donelayerfs_initin6_multi_locklookup_bootinfoieee80211_initmsdosfs_reinitmbstat_type_addvmem_initconfig_deferredpcmcia_scan_cisnd6_na_outputevcnt_init_KERNEL_OPT_SYSCTL_INCLUDE_DESCRpager_mapin6mask32kmem_strndupcv_is_validttyprintfsdmmc_app_commandtcp_notifystrchrdevhandle_lookup_device_callnfsdreq_initin6_leavegroupkcpuset_issetmurmurhash2a4x_bs_r_4pmap_uareauvm_map_preparesleeptabmfs_statvfs_KERNEL_OPT_WSDISPLAY_MULTICONSnfs_niothreadswskbdread_atomic_and_ulongcv_destroyin6_multi_unlockvop_fsync_descata_queue_openingsdosetrlimitbufhashin_addrhash_removedofilereadhchachasoabortieee80211_proto_detachcwdunshareif_ifioctl_43_hookhexdigitswsemul_vt100_edm_copyback_cownfs_fhtovpiostatlistin6_purgeifdoshutdownhooksamap_wipeoutuvm_pgflcache_resumesched_syncobjcom_rbuf_hiwatsys_exitrw_obj_refcntsys___statvfs190blist_destroym_getclpsref_target_destroygenfs_can_accesspool_cache_reclaimptrace_hooksxchacha_stream_xorreal_coredump_netbsdip_mtudisc_timeoutioctl_copyinacl_posix1e_perms_to_modexscale_cache_clean_minidatapstat0ata_channel_attachcnclosefd_openuvm_page_unbusyproc_find_lwp_unlockedsyn_cache_unreachtime_adjustedin_purgeifmcastin_if_link_down_KERNEL_OPT_NTPdkwedge_delallzssp_cdsockopt_destroy_KERNEL_OPT_MSGMAXproc0if_freeip6_mrouter_getffs_vfreesys__sched_setaffinityld_bdevswaprint_error_devffs_blkfree_snappmf_class_input_registernetbsd32_machine32_hooksys_forkcwdfreemfs_doioprop_object_iterator_nextrb_tree_find_nodeieee80211_phymode_name_KERNEL_OPT_DUMP_ON_PANICuprintfcominitvfs_insmntqueclosefuvm_pagewaitsys___clock_gettime50ifqmaxlendiskerrsched_niceconfig_cfdata_detachrndsource_setcbin6_tunnel_validate_KERNEL_OPT_TCP_SENDSPACEmodule_thread_kickpfil_remove_ihooksleepq_unsleepvop_rename_descsys_aio_fsyncgenfs_maxdio_KERNEL_OPT_WS_DEFAULT_COLATTRgetdiskinfoin6_controlcdevsw0vop_aclcheck_vp_offsetspool_cache_disablespecificdata_domain_createuvm_vsunlockbs_notimpl_bs_wm_8uao_dropswappxamci_cdscoop_charge_batterypxa2x0_imaskffs_isfreeblockprintf_tologieee80211_sysctl_detachllentry_allocdp8390_getmcafifa_ifwithaddr_psrefexec_readkauth_cred_setsvgidwsdisplay_cfg_ioctlnew_vmcmdsched_pstats_tickssys_listxattrtcp_dooptionsconvertdisklabelubc_zerorangeuvn_text_pip_if_outputdtrace_vtime_switch_funcuvm_pglistfreeuser_thread_stack_guard_sizesys_undelete_KERNEL_OPT_SUBNETSARELOCALne2000_attachieee80211_load_moduledevclsdl10019_mediachange_prop_intern_match_KERNEL_OPT_IPSELSRCoptstr_get_number_hexbs_notimpl_bs_sr_8rn_inithead0pmap_devmap_rootcpufreq_getfbadop_readcom_configcpu_setmodelnetstat_sysctlthmap_getrootlltable_get_aflayer_putpagesvfs_opv_freeexec_sigcode_freeVOP_FCNTLpostsig_mutex_initaccept_filter_initkobj_setnamethmap_createttyoutttypullallproctcp6_inputstrncmpdk_attachsys__lwp_unpark_allNSM_FOLLOW_TRYEMULROOTundefinedinstructionpmap_devmap_registersys_extattr_get_linksys_fsyncdoing_shutdownktr_execenvuvmspace_execzssp_read_max1111tcp_sack_adjustprop_dictionary_get_boolconfig_finalizesys_mlockassert_sleepablewdcprobe_with_resetffs_mountrootsdmmc_intr_disablescoop_led_setfd_freedevsw_initdevsw_name2blkstrlist_stringvpanicprop_data_sizelim_setcorenamepte_l2_l_prot_mask_KERNEL_OPT_CPU_ARM11MPCOREin6_if_link_state_changesys___getvfsstat90sys_getpid_with_ppidepoll_wait_commonlayerfs_quotactldo_sys_getpeernameprop_number_create_integerprop_number_longlong_valuevn_knote_detachmaxfilesproc_find_lockedffs_realloccgsyscall_establisharm32_vector_init_KERNEL_OPT_NATAPIBUSfnullop_pollmsdosfs_fillinusemapmountroothook_establishcom_attach_subrdevice_pmf_driver_registerstathzsys__ksem_opensysctl_lwpflagmap_KERNEL_OPT_SB_MAXlwp_epriodogetitimerVOP_GETACLsys_symlinkatsys_getpidsoconnect2radix_tree_fini_treein6_lookup_multind6_purgevfs_composefhldattach_KERNEL_OPT_WSEMUL_DEFAULTnfs_starticmp_mtudisc_unlock_KERNEL_OPT_NINET6dl10019_init_cardzkbd_ca_KERNEL_OPT_DKWEDGE_METHOD_MBRlcdctl_brightnessiic_smbus_read_bytemii_findproductdead_linkcn_init_magicuvm_physseg_get_pgstrrchrkauth_register_key_KERNEL_OPT_BIOHIST_SIZEconfig_pending_incrvholdcomcnpollcrootspecufs_closeturnstile_ctornfs_cookieheuristicpathbuf_maybe_copyinmsdosfs_bmapvfs_hooks_headmcllowatproc_sessholddmphy_cdisofncmpata_wait_cmd_KERNEL_OPT_FDTBASEprop_dictionary_get_int64getbinboottimeaes_ccm_enc1udp6_input_checksumkern_has_sysvsemtcp_do_timestampssorflushwskbd_set_console_displaysys_lchown_KERNEL_OPT_KCSANinterrupt_get_countiic_compatible_lookupcallout_ackufs_gro_remove_check_possible_atomic_add_ptr_nvvfs_suspendswwdog_cdrw_lock_optcp_sack_tp_maxholesrip6_usrreqscpu_setintrcdevsw_getnamesysmon_cdevswmodule_builtinlistatabus_free_drivesieee80211_aclator_unregisterbs_notimpl_bs_wm_4bs_notimpl_bs_sr_2VOP_LOCK_KERNEL_OPT_FONT_SPLEEN6x12_KERNEL_OPT_SYSCALL_TIMESsecmodel_suser_process_cbtoeplitz_vhashHEXDIGITSwritedisklabelgreen_onbs_notimpl_bs_wm_2ufs_startuvm_km_suballocinittimecountervop_revoke_vp_offsetsnchstatsmem_nocrc32uuid_enc_betc_ticktockdevice_lookupproc_unstopuvm_voaddr_comparernd_add_data_intrsched_proc_forkitimespecfixdp8390_enableffs_reinitifa_insertnprocscpufreq_registerbs_notimpl_bs_sr_4cpu_hwdiv_presentmq_send1physio_concurrencykauth_cred_setgroups_KERNEL_OPT_FDSCRIPTSconfig_stdsubmatchmii_phy_delete_mediasched_lwp_forkieee80211_add_wme_infoloioctlsorestartne_pcmcia_detach_KERNEL_OPT_FAULTvmcmd_map_zeroinetswcom_shutdownnd6_nd_domainproc_enterpgrpcn_devvpuvmpdpol_estimatepageable_KERNEL_OPT_NRASOPS4tcp_keepcntdevsw_name2chraes_encvfs_openat_10_hookrelookupdead_printkern___acl_aclcheck_path_KERNEL_OPT_COMPAT_FREEBSDcpu_reset_addressstrnlenif_tunnel_alloc_ro_percpukcopy_atomic_inc_ptrufs_dirrewritedevice_attached_to_iattrprop_string_mutableprop_dictionary_set_stringieee80211_mhz2ieeesecmodel_securelevel_machdep_cbdevhandle_compareata_channel_initnfs_finitcp_input_checksumtcp_msl_remote_thresholdnfs_msgwsmux_cdevswtshztom_copypacketm_copymsys_ioctluvm_default_mapaddrNSM_FOLLOW_NOEMULROOTkernconfig_lock_initm_tag_findselnotifybus_space_reservation_unmapin6ifa_first_lladdriostat_initdevwaitmq_handle_openip6_get_prevhdrprocess_domemuvm_fault_unwire_lockedin6_setzoneidwsdisplay_reset_prop_object_internalizepsref_copy_KERNEL_OPT_MAGICLINKSiostat_freekrpc_portmapffs_vnodeop_opv_desca4x_bs_wm_4rpc_replytcp_establishedrtsock_rt_missmsg_50_hooktty_allocsecmodel_nsecmodels_KERNEL_OPT_PMAPCOUNTERSrt_replace_ifaffs_truncateshutdownhook_establishuvn_findpages_KERNEL_OPT_SEMAEMvop_fdiscard_descata_get_paramskernel_identfd_getvnodenfs_mountrootinet6sw_KERNEL_OPT_NCARP_KERNEL_OPT_MEMORY_DISK_ROOT_SIZEselop_selectnfs_readrpcpcmcia_verboseieee80211_cipher_weppmf_event_injectapm_evindexwsdisplay_screenstate_KERNEL_OPT_PMAP_STEAL_MEMORYtcp_mslata_channel_lock_ownedcd9660_blkatoffcpu_kpreempt_exitbufmem_valimitm_ensure_contigrt_unref_KERNEL_OPT_NWSFONT_membar_exitsigclearcpuctl_cdevswuvm_anon_initw100_power_membar_releasesockaddr_dl_measuresys___acl_set_file_KERNEL_OPT_NRASOPS8ieee80211_dump_nodessoo_pollcpufreq_deregisterwsmuxioctlcpu_instruction_set_attributesip_do_loopback_cksum_KERNEL_OPT_TCP_OUTPUT_COUNTERS__aeabi_memset4_KERNEL_OPT_MEMORY_RBFLAGSarmv4_tlb_flushD_membar_syncmutex_obj_alloccd9660_inactivea4x_bs_wm_2module_loaduvm_page_owner_locked_pcnreaduvm_obj_unwirepagesata_free_xfer_KERNEL_OPT_NBRIDGE_KERNEL_OPT_COMPAT_40ifioctl_commonphysio_workqueuemainbus_bs_unmapfd_dupopenvn_closetablefullldbegindetachmfs_strategynommapproclist_foreach_callttybg_KERNEL_OPT_INCLUDE_CONFIG_FILEifaddrpref_ioctlvfs_attachlltable_sysctl_dumppxa2x0_bs_subregioncpu_media_and_vfp_featuresradix_tree_gang_lookup_node_reversetty_try_xonxoffvm_map_unlock_readip6_clearpktoptssockaddr_copyconfig_twiddle_initieee80211_cipher_none_KERNEL_OPT_FONT_VT220ISO8x16aprint_naive_devtcpstat_percpuconfig_cfdriver_attachcpufreq_initdirchkcpufunc_faultaddressprop_object_copyin_ioctl_KERNEL_OPT_SCTP_LTRACE_CHUNKSwqinput_create_KERNEL_OPT_WSCONS_SUPPORT_PCVTFONTSpxa2x0_i2c_write_2pmap_pageidlezerobs_notimpl_bs_sm_8pool_cache_initrt_deladdrget_stackptrpxa25x_com_stuart_gpioconfirda_onpxa2x0_intr_disestablishfc_largedistanceexithook_disestablishexec_initgetucontextuvm_page_initprop_number_ulonglong_value_KERNEL_OPT_CHILD_MAXtcp_outflagslimit0vstate_namefifo_nfsv2nodeop_pcallout_initm_applysecmodel_securelevel_stop_KERNEL_OPT_ARMV81_PANether_ifdetachhook_disestablishin_addrhash_insertdp8390_resetdmover_funcname_xor5pktq_createsyncer_maxdelayin6pcb_notifycpufreq_set_allwskbd_ca_edatadmover_completed_qsimplehook_establishttycancelprop_array_mutabledodumpsys_KERNEL_OPT_NRASOPS2m_tag_get_vstate_assert_KERNEL_OPT_DDBamap_lookupsstrlcatsockopt_setdmover_funcname_xor3uvm_swap_encryptvop_fallocate_vp_offsetsvfs_listieee80211_ifattachsys_mq_getattrsys_swapctlplatid_mask_MACH_COMPAQ_KERNEL_OPT_WSEMUL_SUNpmf_device_resumecd9660_reinitsysctl_copyinstr__aeabi_memset8ptcclosebs_notimpl_bs_sm_2pte_l1_s_protorb_tree_find_node_leqfstrans_is_ownerkernel_pmap_ptrkpgsignaluvm_physseg_get_firstphtree_SPLAYdevice_cfdatasys___acl_aclcheck_linktcp_timer_2msl_if_byindexwi_cd_KERNEL_OPT_SPEC_PLATFORMradix_tree_get_tagkauth_cred_setuid_KERNEL_OPT_FONT_GLASS10x25sys_dup2pxapcic_intrpcmcia_devinfo_KERNEL_OPT_BIOHISTMD5Finalttysleepcv_signal_KERNEL_OPT_FDT_MEMORY_RANGESinpcb_createttopenkcpuset_isothersetieee80211_ioctl_20_hookemul_netbsdtcp_setpersistcomspeedgenfs_can_chflagsvfs_getopsbynamesys_getsidlltable_linkbuf_memcalcdevice_pmf_bus_suspendkmem_strdupsizedead_rmdirchainallocvfs_rootmountallocaprint_verbosesys_timer_createspecificdata_key_deletesdmmc_function_allocif_putxscale_setuptodr_attachvector_page_setprotspec_node_revokesys___fhopen40cache_lru_maxdeactieee80211_getrssisysctl_treelockin6_is_addr_deprecated_bus_dmamem_unmapdevice_enumerate_childrenlcd_panel_geometry_c700module_count_KERNEL_OPT_CPU_ARMV5TEsysctl_portalgo_reserve6device_pmf_driver_suspendapmdevopentcp_freequvm_mmap_devradix_tree_initcom_pcmcia_disabledkdebugvop_reclaim_desccprng_strong_createscope6_initifa_removein6pcb_lookup_boundvop_poll_descuvm_aio_aiodonegenfs_sane_renamevm_page_reserve_kernelseldestroyVFS_FHTOVPwdcattachip_fasttimoifa_acquiresysctl_portalgo_reserve4icmpbmcastechouartputcm_copyupdk_getdisklabelsecmodel_bsd44_startnfs_set_niothreadsifunitspec_poll_prop_extern_append_empty_tagmsdosfs_mountvfs_reinitbs_notimpl_bs_sm_4nfs_defectmsdosfs_fsyncVOP_ISLOCKED_KERNEL_OPT_DISKLABEL_EI_KERNEL_OPT_KERNHIST_DELAYvmem_rehash_start_bus_dmamap_load_rawxc_init_cpupktq_barriervprintfffs_snapshot_mountudv_attachtcp_congctl_selectata_queue_hwslot_to_xferuvm_map_protectvop_write_descsysctl_finalizesdmmc_mem_send_if_cond_KERNEL_OPT_SCTP_PACKET_LOGGINGcv_has_waitersmainbus_bs_freecpu_ttbmodule_autoload_onmodule_compatibletcp_msl_loopgenfs_node_destroyprofprocscpu_dumpsizemm_md_physaccieee80211_wme_acnamesudp6_ctloutput_KERNEL_OPT_EXEC_ELF64wsmux_createuuid_enc_le_KERNEL_OPT_OPEN_MAXinpcb_set_statethreadpool_getcprng_strongcwdexec_KERNEL_OPT_KERNHISTcache_stat_intervalin6_getscopenamewsmuxopenvn_opensockaddr_in6_externalizekprintf_lockrip_ctlinputif_down_lockeddead_vnodeop_pexec_makepathbufinitarmdumploieee80211_crypto_detachbdevsw_getnamepmap_clear_referencepool_cache_headifa_ifwithladdrPMF_Q_NONEkmem_arenadirhash_entersys_preadvdisk_ioctlmii_phy_activateieee80211_crypto_attachVOP_PUTPAGESaes_ccm_dec_mbufwsfont_walkatabusopenprop_array_copyin_sizerawdev_mounteddogetrandomdevice_pmf_lockpte_l2_l_wc_modesysctl_vfs_generic_fstypesprop_number_short_valuelwp_unlock_todevice_is_aturnstile_exit_KERNEL_OPT_MAXUPRCufs_gro_lookupxscale_cache_flushIDsdmmc_io_read_1dk_strategy_defernfsm_loadattrcachemsdosfs_renameuvmpdpol_anfreedevice_call_genericdo_sys_linkatuvm_vnp_setwritesizeuvm_reclaimablewsmux_srcopsmodule_load_vfs_veccopyin_pidin6_if_link_upigmp_leavegroupuiomove_frombufproc_initspecifictty_unitip_protoxsys_duppserialize_performconfig_detach_childrensleepq_enterpcmcia_function_configurecnopenpmap_get_pde_pteffs_gop_sizebuf_drain_KERNEL_OPT_NRASOPS15sys_nomodulesdmmc_mem_read_block_KERNEL_OPT_NGPIOpmap_growkernelspec_node_setmountedfsspectrum24t_primsymata_queue_alloc_slotif_attachdomainaprint_debugif_percpuq_create__start_link_set_prop_linkpoolspcu_save_allieee80211_sta_leavebbusypte_l1_s_cache_modevfs_vnode_iterator_initmfs_rootbasewsemuldisplaydevprint_KERNEL_OPT_NMBCLUSTERS_MAXcom_pcmcia_matchif_getfgetowncd9660_initcallout_schedulevop_readlink_descustore_shortextent_create__start_link_set_ieee80211_funcsgeneric_bs_w_4__divdi3contsigmaskin6_ifdetachsys___posix_chownnd6_nbr_init_KERNEL_OPT_FONT_DROID_SANS_MONO10x20sys_getuid_with_euidpmf_debug_suspensormodule_namestrtollbs_notimpl_bs_mmapprop_dictionary_set_int64thmap_getifnet_pslistffs_openextattrdevice_activationnfs_linkextent_allocexec_elf32_makecmdsprop_number_int8_valueldadjqparamdmover_session_poolcopyout_socknamespec_vnodeop_p_prop_array_internalizesa6_embedscopeacl_nfs4_sync_acl_from_modesockaddr_in_const_addrencap_lock_enterxscale_cache_purgeD_rngpmap_initdevice_cfattach_atomic_dec_32_nvspec_node_lookup_by_mount_KERNEL_OPT_FONT_VT220ISO8x8ufs_setattrip6_prefer_tempaddrsys_mq_senddevice_compatible_plookup_strlistpts_cdevswld_cdpool_totalpagesicmpstat_percpupmf_self_suspensor_initsys_profil__start_link_set_evcntskinfo_vdebugrpc_versvfs_vnode_iterator_destroyprop_dictionary_set_scharwd_cdsysctl_pktq_rps_hash_handleriostat_unbusyprop_string_append_cstringcomstop_KERNEL_OPT_XSCALE_CACHE_WRITE_THROUGHvfs_quotactl_idtypestat__aeabi_memcmp_KERNEL_OPT_INCLUDE_JUST_CONFIGacl_copy_oldacl_into_aclifa_ifwithladdr_psrefcn_get_magicne_pcmcia_enableprop_dictionary_set_intptrkpreempt_disable_KERNEL_OPT_PCMCIAVERBOSEdisk_read_sectors_KERNEL_OPT_SOMAXKVAdo_setresuidmainbus_bs_r_2syncdelayexec_free_emul_argsys_getxattrsnprintb_min4_cksumsys_geteuidfirstctcp_mss_ifmtucpu_memory_model_featuresiic_cdevsw_atomic_inc_ptr_nvttyinsystempageprocess_validregsnfs_boot_deladdresskqueue_initapm_standbysfree_pagesffs_snapshot_initconfig_cfdriver_lookupbpf_filter_extdo_sys_accept_prop_string_externalize_internalcfdata_ifattrscoop_set_sdmmc_powerpim6_inituvm_obj_page_writeback_psysmonreadsys_getegidlwp_changeprimainbus_bs_r_4doexithooks_KERNEL_OPT_APPLE_UFSfiq_claimpte_l2_l_cache_modevmmapbsyvop_lookup_vp_offsets_KERNEL_OPT_NRASTERCONSOLEpty_maxptyspmap_devmap_bootstrapped_pbpf_set_extmembufq_drainpserialize_createprofsrcata_channel_destroypffindprotodo_lwp_create_prop_bool_internalizefrag6_initiic_smbus_read_wordprop_dictionary_get_stringpmap_kernel_L1_addrklist_insertinet6_pfil_hooksleepq_enqueueprop_dictionary_copyin_ioctlcallback_unregisterwsdisplay_stat_injectprop_number_uint64_valueprop_array_create_atomic_swap_ulong_KERNEL_OPT_UFS_DIRHASHkauth_lockcd9660_pathconffstrans_setstateuvm_unmap1pmf_debug_idleVOP_WHITEOUTwskbd_cnbellfd_putvnodelltable_unlink_entrybooted_startblkmax_keylenvec_ntp_adjtime1mfs_donecompat_cpuctl_ioctlcopyin_prockobj_unload__bss_end__updatertimedevsw_attachsysctl_rootswwdogattachpmap_activatepcu_savethreadpool_cancel_jobshutdownhook_disestablishprop_array_copyinuvm_page_array_finipserialize_read_enter_bus_dmamap_loadsysmon_wdog_registerdead_removein6_ifaddr_listpcmcia_parse_cis_tuplevmem_create_KERNEL_OPT_NRASOPS_GLUEvfp_detectuvm_pagecopyprop_array_ensure_capacitybdevsw_lookup_majormsdosfs_vnodeop_pvop_inactive_vp_offsetsrip_pcbnotifynamei_simple_userlayerfs_statvfsin6_in_2_v4mapin6sched_takecpulayer_openruaddufsfifo_closend6_need_cachexscale_cache_purgeD_Euvm_physseg_set_start_hintuvm_anon_dropswapras_lookupholdrele_KERNEL_OPT_COMPAT_70_KERNEL_OPT_HOSTZEROBROADCASThash_value_ensure_initializedexecve1uvm_pctparam_setpcmcia_product_lookuppool_printitcd9660_readlinkrtcache_setdsttcp_cubic_ctluvm_initvfs_timestampieee80211_ifdetachwscons_copyout_events_50_hookmii_phy_flowstatusdumponpanicVOP_KQFILTERsys_timerfd_gettimeknote_proc_forksigtimedwait1msdosfs_fh_lookupinterrupt_get_devnamevttoif_tabsigsuspendteardownne_pcmcia_get_enaddrsys_getuidvn_writechknfs_lookupprop_dictionary_set_data_nocopyuvm_pageunlock_prop_stack_poplocalcount_acquirebr_aes_ct_keysched_stddeccallout_pendingip_freemoptionsprop_data_create_dataprop_number_uint_valuepaniccpueventswitchchildunp_disposeprop_string_copy_mutablesys_setsidffs_bufwrpserialize_initsbcreatecontrol1blist_fillvfs_mountedonvop_closeextattr_descoutswkauth_extattr_actiontcp6_ctlinputmaxsmap_bus_dmamem_freecom_detachcpu_classes_KERNEL_OPT_FONT_SONY8x16solockresetdisk_begindetachata_is_thread_runnfsrttieee80211_std_rateset_11aprop_number_signed_valuedirhash_lookupprop_object_retainifa_ifwithnetiic_refcntinswspec_bmapnfs_add_tobecommitted_range_KERNEL_OPT_ARM_LOCK_CAS_DEBUGvfs_trybusynd6_is_addr_neighborufs_balloc_rangeraidframe_ioctl_80_hookvop_symlink_descsys_execve_KERNEL_OPT_WSCOMPAT_USL_SYNCTIMEOUTseltrue_kqfilterkcpuset_unusebufq_allocnd6_ns_outputdk_initphtree_SPLAY_MINMAXselrecord_knotedevioprop_number_unsignedcache_purge1udp_statincsockaddr_getsize_by_familyieee80211_send_probereqdirhash_removektr_syscall_KERNEL_OPT_MEMORY_DISK_DYNAMICin6pcb_set_portworkqueue_enqueuespec_advlockscoop_set_speakerdkwedge_listsofixedbuf_ufetch_16_no_ldrhtuvm_map_entersys_epoll_pwait2dl10019_mediastatusarm_netbsd_elf32_probedisk_init_ustore_16_no_strhtbounds_check_with_mediasizetcp_recvspacepool_cache_setlowatmii_get_descr_atomic_add_long_nvpxapcic_cddp8390_rintm_move_pkthdr_ustore_8deveopnotsupp_KERNEL_OPT_USER_VA0_DISABLE_DEFAULTnfs_del_committed_rangeVOP_RMDIRrip_ctloutputsecurity_setidcore_pathcd9660_unmountdo_eventfd_KERNEL_OPT_MSGMNB_membar_producervmem_addpcmcia_socket_settyperaw_setpeeraddrmodule_builtin_require_forceprop_dictionary_set_keysymffs_closeextattrmutex_ownablecopyin_psstringsnfs_getreqmii_findvendorwsdisplay_cnputcieee80211_node_lateattachrt_timer_queue_change_KERNEL_OPT_KGDB_DEVNAMEtcp_drainstubfiqvectorif_printfselremove_knotenfs_symlinksys___sigaction_sigtrampprop_array_copy_mutablereplace_coproc_handlertcp_congctl_global_nameapmprintaccept_filt_setoptbpf_ops_handover_enterfifo_vnodeop_entriessysctl_teardownprop_object_copyout_ioctluvm_physseg_get_avail_startvm_map_lockuao_set_pgflsysctl_describecprng_fastsiggeticmp6_dynamic_rt_msgufs_gop_markupdatecpu_get_controlffs_snapshotmainbus_cd_prop_dictionary_internalizecprng_strong_destroyvn_knote_attachpmap_devmap_bootstrapuvm_pagermapin_KERNEL_OPT_KGDB_DEVufs_pathconfnfsm_reqhif_deferred_start_initif_activate_sadlrnd_system_ioctlip_tso_outputVOP_POLLentropy_ioctl_KERNEL_OPT_MSGSEGnd6_rtrequestselop_pollchacha_ref_implvop_fallocate_descsdmmc_io_write_multi_1sys_setgroupsbounds_check_with_label_KERNEL_OPT_NLOCKSTATacct_locksecmodel_suser_initif_nullinputvop_readlink_vp_offsetsKERNEL_BASE_virtpsref_class_createttwakeupboot_argsprop_dictionary_get_ulonglong_KERNEL_OPT_PIPE_SOCKETPAIRtcp_respondksiginfo_allocsemctl1max_bdevswsVOP_UNLOCKbpf_ops_stubuvm_pageoutradix_tree_clear_tag__divmoddi4nfs_sillyrenamekillpg1fifo_vnodeop_opv_desc_KERNEL_OPT_WSEMUL_NO_DUMBin_initdo_sys_connectm_tag_freemainbus_bs_w_2apm_v12_enabledether_crc32_lekcpuset_intersecting_pnfs_trueprop_dictionary_get_ulongvtruncbufin6_selectsrckauth_authorize_networkkauth_authorize_devicenfs_timer_srvfinimsdosfs_uniqdosnamesoisconnectedentpool_extractphys_map_KERNEL_OPT_QUOTA_KERNEL_OPT_CPU_XSCALE_IXP425nd6_cache_lladdruvm_map_advicesbinsertoobgenfs_node_rdtrylockmainbus_bs_w_4threadpool_job_donedk_strategy_pendingsys___lutimes50stoeplitz_hash_ip6if_nulloutputplatid_namedk_ioctl__aeabi_idivmodstoeplitz_hash_ip4sdmmc_io_function_enableatabusprintsys___posix_fchownksem_clogrtsock_oifmsg_14_hook_KERNEL_OPT_DKWEDGE_METHOD_RDBcpu_lwp_freeprop_array_iteratorvn_openchkrasops_get_cmapproc_free_memtcp_outputtcp_quenchvmem_freepxa2x0_i2c_waitpgrp0ffs_full_fsync_KERNEL_OPT_SEMVMXfiledesc_cdevswprop_array_setffs_alloclockdebug_dismisstty_attachgeneric_armv4_bs_w_2_swaprpc_autherr_KERNEL_OPT_DCCPBHASHSIZEm_freemmblowatpmap_postinitexphy_calwp_unsleeptcp_congctl_registerrn_addmaskmutex_tryenterin6ifa_ifpforlinklocalpcq_getsysctl_notavailpcu_discard_alldo_sys_mountkpauseffs_fsyncffs_specop_pm_get_ncpu_mpidrwsfont_add_atomic_dec_ptr_nvfd_sys_initcd9660_readxscale_cache_purgeID_Epcu_discard_KERNEL_OPT_NWLANlwp_pctrcfrootsm_tag_unlink__aeabi_memclr_KERNEL_OPT_COM_HAYESP_KERNEL_OPT_FONT_OMRON12x20xc_barrieruvmpdpol_init_cpuuvm_map_init_cachessys_setreuidufs_gro_remove_check_permittedsetstatclockrateuvm_km_initieee80211_chan2modeprop_number_uint16_valuevop_access_descdead_ioctldocritpollhooksblake2s_selftestpxapcic_scoop_cain_ifaddrhashtbl_pslistvec_ntp_gettimesys__lwp_unparkfill_eprocsys_sigqueueinfoitimer_mutexpty_checkgeneric_bs_rr_1sys_getpriorityraidframe_ioctl_50_hookudbhashsizesys_pwritevpxa2x0_i2c_initvfs_getvfssdmmc_mem_flush_cachesys__lwp_killfetch_and_or_4sdmmc_mem_initprop_dictionary_copy_mutablesowakeupnfs_boot_setaddress_KERNEL_OPT_CPU_XSCALE_PXA270KERNEL_BASE_physnd6_debugmutex_enterdev_findvendor_KERNEL_OPT_TCP_SIGNATUREvop_ioctl_descsys___vfork14defaultaddrpolicyffs_vfsopsuvm_coredump_walkmap_hookuao_set_swslotnfs_asynciopsref_class_destroyselinitentropy_globalpathbuf_destroyieee80211_notify_scan_donebufmem_lowatersoinit1_KERNEL_OPT_TFTPROOT_KERNEL_OPT_WSEMUL_VT100_UNDERLINE_FGsysctl_portalgo_availablemsdosfs_advlockspecificdata_getspecific_unlockedffs_isblockmsdosfs_dos2unixtimekevent_put_eventsuvmpd_dropswapcache_vnode_fininfs_fsyncvfs_detachpffasttimoq_to_bdo_sys_synciostat_isbusysys_fchflagscpu_switchtoexec_script_makecmdsipi_trigger_broadcastcpufunc_domainsufs_truncate_retrycpu_lwp_setprivatebinvalbufgenfs_ufslike_rename_check_permittedsys___getcwdprop_dictionary_get_int16fd_sharemodule_primeuvm_pgflcache_startpxa2x0_turbo_modeffs_itimeslltable_drop_entry_queuein6_cksumuvm_pageunlock2pool_totalpages_lockedprefetch_abort_entrycd9660_bmappte_l1_s_prot_ropcmcia_socket_enable__aeabi_memclr8insidepcmcia_card_deactivatecritpollhook_disestablishpool_printallin6_lookup_and_delete_multitcp_keepinitsecurity_setidcore_modepercpu_putrefgenfs_renamelock_exitsocloselayer_inactivescope6_ifattachrulwpsax88190_media_initnfsv2_vnodeop_ptcp_cwmin6_localaddrdevice_pmf_driver_child_registersys_fremovexattricmp6_rediracceptnfsfifo_closewskbd_load_keymapunp_rights_ratio__aeabi_memclr4getboottimesched_resched_lwpdevice_pmf_bus_deregister_KERNEL_OPT_CPU_PJ4B_KERNEL_OPT_PTRACE_HOOKSpmf_event_deregisterfetch_and_and_4mfs_vnodeopv_descspte_l1_s_cache_maskscope6_addr2defaultcdev_ttysoreceiveieee80211_node_leavegenfs_ufslike_remove_check_possiblesys___clock_getres50prop_number_uint8_valuem_xhalfemul_flags_translateataprintsigactsfree_KERNEL_OPT_MULTIPROCESSORmainbus_bs_barriermrt6_ioctl_KERNEL_OPT_KGDB_DEVADDRbus_space_reserve_subregion_KERNEL_OPT_PAX_ASLR_DELTA_STACK_LENudp_inputwskbd_compose_valuemd_bdevswcd9660_startvcache_rekey_exituvm_pagewakeupcom_loadchannelregswdc_pcmcia_cavfs_reffd_dupdo_setresgidlddonecd9660_getattrnist_sha256_hash_drbg_reseedvcache_rekey_enterptc_cdevswin6_ifattachvnode_to_pathvtw_statsrt_newmsgVOP_ABORTOPsoftint_schedulexscale_cache_flushDkauth_proc_forkcd9660_vnodeop_p_KERNEL_OPT_COMPAT_386BSD_MBRPART_KERNEL_OPT_CPU_ARM1136mountlist_iterator_initcd9660_accesscallout_setfuncsecmodel_securelevel_device_cbwsdisplayttypte_l1_s_nocache_modegenfs_lockkauth_cred_ismember_gidnfs_vfs_doneinpcb_lookup_boundsoftint_timingfragtbl8buffer_lockalllwpvfs_quotactl_putdosa_registercoredump_hooktcp_sack_globalholesudp6_realinputnfs_searchdircachekcpuset_attachedtcp_rttdfltmodule_autounload_unsafesockaddr_anyaddrVOP_REVOKEcompat_vndioctl_30_hookVFS_SUSPENDCTLieee80211_add_ssidonce_wdog_KERNEL_OPT_HZtty_ptmioctl_60_hooknv2tov_typerb_tree_insert_nodekauth_cred_geteuidpktq_set_maxlenspec_pathconfconstty_lock_KERNEL_OPT_IPSEC_DEBUGuvmfault_update_statslim_addrefsecmodel_registerifnet_listsys___timer_settime50m_xworddotimer_settimenfs_readdirplusrpcGetCPSRspectrum24t_secsymgeneric_bs_r_4_swap_KERNEL_OPT_TCP_RECVSPACEbpfopenata_channel_thaw_lockedktr_geniovpmap_curmaxkvaddrata_deactivate_xferblist_resizecd9660_fhtovpnfs_nget1pmf_get_platformufs_accessxsys_mq_close_KERNEL_OPT_KDTRACE_HOOKS_KERNEL_OPT_MPLSieee80211_std_rateset_11gvop_access_vp_offsetsdp8390_startnfs_vinvalbufsys_getcontextvop_openextattr_descrn_deletecpu_lwp_free2sysctl_lookuptcp_syn_cache_limitttyldisc_initlwp_unlockinterrupt_construct_intridsradix_tree_init_treedopowerhooksin6_addmultisysctl_destroyvconfig_cfattach_detachinpcb_losingnfs_mountsys___acl_aclcheck_fdmfs_vfsopsdo_sys_waitidwsemul_vt100_handle_dcs_prop_object_fini_KERNEL_OPT_WSDISPLAY_SCROLLCOMBOwsemul_dumb_resetoppserialize_in_read_sectionradix_tree_gang_lookup_tagged_node_reverseplatidsys___sigaltstack14rtsock_rt_addrmsg_50_hook_KERNEL_OPT_MEMORY_DISK_RBFLAGSmsdosfs_fh_destroywsemul_addexplicit_memsetprop_dictionary_copyoutinstall_coproc_handler_staticcpu_lwp_forkfd_tryexpandmsdosfs_readepmsdosfs_vnodeopv_descsshutdown_firstprop_number_equals_unsigned_integerpxadmac_cdifmedia_80_post_hookprop_string_equals_stringprocess_set_pcpmap_bootstrapdo_sys_peeloffnv3tov_typeuvm_swap_init_doneffs_dinode2_cache_KERNEL_OPT_NPTYVFS_ROOTunp_connect2in6_undefer_cksum_tcpudp_KERNEL_OPT_TCP_REASS_COUNTERSpcq_peekif_get_byindexprop_number_int_valuecd9660_readdirrasops_reconfigpte_l2_s_cache_mode_ptrip6_ctlinputsockargskauth_authorize_device_ttygetframecpu_reset_address_paddrsleeptab_initdevice_set_handleprop_dictionary_set_uint16uvm_km_kmem_alloc__config_hook_callip_reass_initsysentinphy_cadkwedge_get_parent_namesys___sigpending14ata_channel_freezeffs_bufrdttylockpager_map_wanteduipc_unp_70_hookfill_kproc2_KERNEL_OPT_NWSDISPLAYsolocked2ieee80211_crypto_availableip6_param_rt_msgwsdisplay_defaultscreenspool_cache_invalidatepte_l1_s_cache_mode_ptksem_maxVFS_UNMOUNTradix_tree_replace_nodeifreq_setaddrgetbintimepmf_device_suspendttyunlocksoisconnectingchainlengthin6pcb_rtentry_unrefisofntrans_KERNEL_OPT_NATA_PIOBMVOP_ADVLOCKthreadpool_putpmf_class_network_registerip6_notify_pmtu_KERNEL_OPT_EXEC_COFF_KERNEL_OPT_CNMAGICportalgo_randportsys__lwp_createm_clgetprop_dictionary_set_int32sched_curcpu_runnable_pin6pcb_disconnectpcmcia_card_detachdevice_compatible_matchsysctl_log_printdevice_locatorigmp_slowtimoprop_string_equals_cstringdp8390_mediastatuswsdisplay_stat_ioctlVOP_LISTEXTATTRsys_extattr_get_fdkcpuset_removeuser_cprngtcp_inputfgetdummyconfig_create_mountrootthreadsdevice_privatemfs_vnodeop_pbpf_ops_handover_exitllentry_pool_getvmcmd_map_pagedvnnfs_boot_setmtuwsdisplay_unset_cons_kbdsoo_statuipc_initpcq_destroyin6_matchlenpxaip_cdusermount_common_policycalcruturnstile_blocknfsm_disctata_channel_detachethermulticastaddr_slowprotocolsaes_cbc_dec_KERNEL_OPT_DKWEDGE_METHOD_TOSin6_undefer_cksumatabus_alloc_drivescopyrightbs_notimpl_bs_wr_2in6pcb_selecthlim_rtip_optcopyktr_geniosleepq_wakepfslowtimo_chthreadpools_initcallout_startup_KERNEL_OPT_SCTP_LTRACE_ERRORSprop_array_capacityVOP_ACLCHECKpool_cache_destruct_objectpager_map_sizeextent_alloc_subregionnfs_boot_flushrtscoop_resumedo_sched_getparammodule_load_vfscache_maxlenktr_emulpmap_page_protectvtw_tcpv4dead_bmapieee80211_ioctlmii_detachvn_readdirlwp_addreftodr_set_systimesys_sa_registerptcpollgenfs_pathconfpmap_pte_init_xscalevn_union_readdir_hook_KERNEL_OPT_NFS_V2_ONLYsockaddr_addrin6pcb_purgeifsoftint_init_mdif_transmit_lockconfig_attach_acquirelayer_node_createptrace_read_lwpstatuszapm_cdmq_def_maxmsgzombprocpool_cache_sethardlimituvm_vnp_setsizekauth_deregister_scopeuao_createtcp_delackip6_anonportmindkwedge_delidle__stop_link_set_domainsvop_putpages_vp_offsetsa4x_bs_w_2pktq_destroypcq_createieee80211_rssadapt_raise_ratedevice_parentipi_waitvop_create_descarp_debugdk_draindeviter_releasevn_default_errorwskbd_inputnfsm_mbuftouiocdev_writesys_recvfromifpromisc_lockedin6_ifaddr_locksoo_kqfilterm_tag_delete_prop_extern_append_chargeneric_bs_wr_4_swapuvm_lwp_getuareaSHA384_Updateifmedia_lock_for_legacyin6pcb_selecthlimprop_string_compare_stringptswritesys___getfh30vfs_hooks_unmountwd_cavrele_KERNEL_OPT_FDT_DEFAULT_STDOUT_PATHsecmodel_suser_machdep_cbcwdi0apm_do_standbyffs_snapshot_unmountxscale_cache_flushI_SEproc_specific_key_deletexscale_cpwaitsockopt_getsys_chrootbuf_setvalimit_KERNEL_OPT_CPU_IXP12X0in_selectsrcmutex_spin_lockopsevcnt_detachsecmodel_setinfonfs_timer_finirn_delete1rasops_initrtcache_copykpause_syncobjsetucontextspec_inactivevtw_tcpv6xscale_context_switchffs_donekernelstackdo_sys_chownat_KERNEL_OPT_ALTQaprint_naivefnullop_restartmaxcpusuvmspace_forkdisk_detacha4x_bs_w_4prop_dictionary_get_int8unp_usrreqsmrt6statufs_dirrablksnfs_sigintralleventssys_extattr_list_fdmsdosfs_donevn_lockitimer_initata_channel_unlockmfs_locksnprintbgetmicrouptimeprop_dictionary_set_datadevoutwskbd_hotkey_deregister_KERNEL_OPT_NFS_BOOT_GATEWAYsecmodel_securelevel_vnode_cbin6pcb_set_statesysctl_unlock_KERNEL_OPT_NATA_UDMAcompat_modstat_80_hookdefault_bus_space_handle_is_equalcompat70_ocreds_validcomcnspeedi2c_bitbang_initiate_xferpxa2x0_gpio_set_bitwsdisplay_cndetachspec_node_destroysdmmc_print_ciswsdisplayreadSHA224_Init_KERNEL_OPT_NET_MPSAFEscoop_cdsys_lremovexattrdmover_session_initializemm_initieee80211_node_authorizeraw_ctlinputif_allocsys_removexattrcom_to_tiocmts2timotty_initsys___fstatvfs190dmover_request_allocdisk_busysys___adjtime50prop_dictionary_set_bool_KERNEL_OPT_PXA2X0_DMAC_DMOVER_CONCURRENCYdevenodevnfs_safedisconnectif_ioctlcache_cross_mountsockaddr_any_by_familybufcache_lockdmover_funcname_xor7acl_nfs4_checkmsdosfs_fc_lookupencap_attach_funcuvmspace_freesys_readlinksys_setxattrcpufreq_setmsdosfs_initdmover_completed_q_lockrn_delayedinitarm_cpu_do_topology_KERNEL_OPT_COMPAT_14ufs_doneinpcb_purgeifchglwpcntwsemul_dumb_console_emuldataSHA256_Initgetticksrtcache_init_noclonedk_discardieee80211_authenticator_register_KERNEL_OPT_LD_SDMMC_DEBUGsys_issetugidether_set_ifflags_cbmodule_sourcetcp_del_sackholes_ucas_32ptcwakeupacl_posix1e_mode_to_permlboltitimer_settimeproc_allocpcmcia_childdetachedvop_openextattr_vp_offsetsmd_child_returnetherinitsys___select50prop_number_create_signedsys_bdevswsprop_dictionary_remove_keysyminstall_coproc_handlerffs_dinode1_cache_KERNEL_OPT_COMPAT_16com_common_getcvnfree_markerrw_write_heldmainbus_bs_wm_1msdosfs_loadvnodecd9660_vnodeop_entriesifpromisc_KERNEL_OPT_SYSCTL_DEBUG_CREATE_atomic_cas_uint_nipool_headcd9660_fifoop_opv_descdmover_processip6_nexthdrttyvenodevttclosplatid_mask_MACH_CASIOplatid_mask_MACH_HP_JORNADAtty_detachttyerrpolluvm_swap_decrypt_pagesprop_string_valuein_ifiniticmp_ratelimitpte_l2_l_cache_mode_pt__divmodsi4exec_locknfs_progsecurity_setidcore_groupwsfont_enumbufq_initrt_newmsg_dynamicwdc_reset_channelcngetsnnfs_kqinitprop_array_copybreadlayerfs_vptofhstrlist_nextproc_reparentSHA512_Updatemii_phy_downcpu_cdpxa2x0_a4x_bs_tagffs_blkfreesys___acl_set_fdif_nullstarttcp_congctl_unregistersyn_cache_count__aeabi_memmove8uvm_pageout_doneuao_find_swslot_KERNEL_OPT_SYSVSHMlltable_get_ifpieee80211_recv_mgmt_KERNEL_OPT_FONT_VT220KOI8x10_KOI8_Udevice_has_poweraprint_verbose_devcprng_fast_inituvm_voaddr_releaseprop_array_create_with_capacitycallout_haltvfs_timestamp_precisionsecmodel_securelevel_start_KERNEL_OPT_MEMORY_DISK_HOOKSin6_delmulti_lockedlltable_allocate_htbldumpmagdirhash_purge_entriesuvm_loanbreakgeneric_bs_w_4_swapvfs_mountallocxscale_minidata_clean_sizeuvm_fault_wire_KERNEL_OPT_NKSYMSkernel_lock_initprop_string_cstringsys_rebootsys_linkgenfs_gop_writetcp_usrclosedSHA384_Transformgenfs_erofs_link__aeabi_memmove4vmem_sizevfs_evfilt_fs_initVOP_IOCTLmsdosfs_readdirufs_bufiometadelayblist_free_KERNEL_OPT_BUFPAGESpool_cache_ngetsys_mkdiratfrag6_drainstubne2000_resumevwakeupip6_freemoptionsscoop_set_backlightpmap_removelwp_unstopcpu_need_reschedblake2s_finalieee80211_amrr_choosedomountroothookuvm_swap_markbadlwp_initspecificuvm_physseg_findvop_whiteout_descifa_psref_classpmap_enterrb_tree_remove_nodevfsinitaverunnableuvm_physseg_get_start_hintsysmonioctlbs_notimpl_bs_c_1icmp6errppslimvputrt_lookupcache_lookup_rawtcp_drainmii_phy_resume_bus_dmamap_unloadgeneric_armv4_bs_r_2_swap_KERNEL_OPT_INETproc_changeparentufs_lookupdo_sys_fstat_KERNEL_OPT_KSTACK_CHECK_MAGICuvm_physseg_get_free_listrt_timer_queue_destroydevice_is_enabledvacl_deleteentropy_pollieee80211_wme_initparamsvop_getacl_desc_KERNEL_OPT_PSREF_DEBUGarm_dcache_alignwsdisplay_emulinputvn_syncer_add_to_worklistsosetlockdevsw_blk2chrax88190_mediachangeuvmpdpol_selectvictimm_getptrlla_snprintfmsdosfs_mountfsprocess_write_fpregsgenfs_sizexscale_cpu_sleepdl10019_mii_bitbang_readprop_dictionary_get_ucharVOP_FALLOCATEiptimenfs_mknodmodule_holdsigproppcmcia_rescanpxa2x0_i2c_write_byteieee80211_chan2ieeecpu_earlydevice_va_p_KERNEL_OPT_SDHC_DEBUGproc_crmod_enter_KERNEL_OPT_XSCALE_NO_COALESCE_WRITES_KERNEL_OPT_KMSANnd_nud_hintpmap_initialized_atomic_cas_ulong_niswapsys_unlocksdmmc_cisptrpxa2x0_i2c_read_bytenfs_check_wccdatadomaininittc_getfrequencysys___mq_timedreceive50aes_setenckey256vop_lookup_descxdr_inaddr_encodein6pcb_purgeif0bannersockaddr_dl_setaddrwskbd_hotkey_registerscope6_ifdetachconfig_cfdriver_detachpmf_event_registerieee80211_dump_nodein_canforward_KERNEL_OPT_ATA_NO_DOWNGRADE_MODEkmem_initin6_nigroupsys__sched_getparamcomttyuvm_anon_releaseuvm_map_setupsecmodel_extensions_vfs_stopcopystrinpcb_connectdevice_register_post_configdtrace_getnanotimew100_consoleVFS_SNAPSHOT_KERNEL_OPT_NETHERdevice_find_by_driver_unitieee80211_classifyether_mediastatusieee80211_dup_bsssdmmc_decode_csdvop_fcntl_descvfs_stdextattrctllogputcharip6_copypktoptscache_revlookupmodule_autoload_lock_casvop_remove_vp_offsetscpufreq_get_state_indexcom_suspendlla_rt_output_KERNEL_OPT_WD_CHAOS_MONKEYiic_exec_KERNEL_OPT_NPXAINTCcd9660_sync_KERNEL_OPT_NW100LCD_KERNEL_OPT_KASAN_PANICsecmodel_suser_system_cbieee80211_find_rxnodedead_putpagesarm_netbsd_elf32_coredump_setupprop_number_schar_valuepxa2x0_bs_barriervmem_xfreealluvm_pagedeactivateparse_mi_bootargsttyclosesys__lwp_selfudp6_inputieee80211_compute_durationcpu_setstateuvm_anon_lockloanpgkauth_accmode_to_action_KERNEL_OPT_PMAP_NEED_ALLOC_POOLPAGEgeneric_bs_rm_1fc_wheretovlog_KERNEL_OPT_MBUFTRACE_KERNEL_OPT_TFTPROOT_DEBUGuvm_anon_pageinbgetvpwsdisplay_handlexvfs_hooks_initvrefpercpu_createpxa2x0_i2c_quickttylclosepathbuf_assimilateif_is_deactivatedgenfs_mmapprop_data_valuesysctl_root_deviceplatid_htonif_input_KERNEL_OPT_FILEASSOCcpu_read_cache_config_KERNEL_OPT_XSCALE_CCLKCFGkauth_register_scopeaes_bear_impltcp_keepintvlether_crc32_besession0undstackaes_md_initdeviter_initpopcountlsleepq_block_debugsym_dummyfunc_bus_dmamap_syncvntblinit_KERNEL_OPT_SEMMNSsockaddr_dl_allocuvm_init_limitsnfsdreq_finiprop_number_create_unsignedin6addr_linklocal_allnodesrn_newpairuvm_page_array_clearif_first_addr_psref_KERNEL_OPT_ARMV85_BTIsyncobj_noownerstopprofclockpxa2x0_bs_allocdk_cdtcp_cwm_burstsizeprop_dictionary_all_keysnfs_disconnectdisk_set_infoieee80211_inputprocess_read_lwpstatusvnopshandle_modctl_loadmi_cpu_attachata_queue_holdip6_anonportmax_kernel_lock_opskthread_fpu_exituvmcatqfutex_robust_head_lookuptty_acquireieee80211_media2ratespec_ioctlip_fragment_KERNEL_OPT_UFS_ACLbdev_cancelwskbd_cnpollcsockopt_getmbuf_KERNEL_OPT_FONT_TERMINAL8x13secmodel_bsd44_stopttymodemiic_smbus_send_bytepool_subsystem_init_KERNEL_OPT_CPU_ARMV5Tvop_rmdir_vp_offsetsudbtableicmp6_error2wskbd_cnattachuao_dropswap_rangelcdctl_camfs_vnodeop_entriesrnd_initsynch_initpmf_qual_recursive_copyvfs_unixify_accmodeigmp_joingroup_KERNEL_OPT_COM_PXA2X0wsdisplay_kbdholdscreensys_setpgidsecmodel_extensions_vfs_startaddress_exception_entryifafreertsock_rt_addrmsg_rt_50_hookieee80211_fakeup_adhoc_nodepmap_map_entrydomainnameVOP_FSYNCsys_getgid_with_egidwsfont_removepxa2x0_bs_freepanicenduvm_deviceopsw100lcd_caapm_minvertty_ttioctl_43_hookdk_bdevswrtstatudp6_initieee80211_probe_curchanffs_spec_fsyncraw_attachsched_setrunnablenfs_tickscpu_is_betterzaurus_start_KERNEL_OPT_NATA_DMA_bus_dmamem_alloc_rangekauth_cred_getgroupsbi_howtombinitif_pfil_KERNEL_OPT_COMPAT_60_prop_extern_append_end_tagvop_parsepath_descaddrsel_policy_initmount_initspecificwdcprobevop_bwrite_descstoeplitz_hash_ip4porthashdone_KERNEL_OPT_SCTP_MBCNT_LOGGINGsys_seteuiduvm_schedulervn_extattr_setuvm_pctparam_createsysctlnodesysctl_tcp_vtw_enabledo_posix_spawnaes_ccm_initlogwakeupuao_swap_off_bus_dmatag_subregionvfs_op_descstcpipqent_freesdl_printpcu_save_all_on_cpu_KERNEL_OPT_BTUARTCONSOLEexit_lwpssys_mlockallkcpuset_sysinit_KERNEL_OPT_I2C_MAX_ADDRin6mask0rw_syncobj_membar_consumerbadaddr_read_2sys_cdevswssys_timerfd_settimelxtphy_cacdev_openwskbddevprintnanosleep1vtw_earlyinitcd9660_mountrootdorevokeapmdevkqfiltermaxexecbpf_jit_generatesched_preemptedkernconfig_is_heldVOP_READLINKnfs_add_committed_rangend6_createsys___mknod50sys_clock_getcpuclockid2_KERNEL_OPT_NRASOPS_ROTATIONsimplehook_createcd9660_rrip_analyzetcp_disconnect1uvmpdpol_pageenqueuegenfs_accessvop_open_descpcmcia_io_mapnameiat_simple_kernel_KERNEL_OPT_SYSCTL_DEBUG_SETUPtprintfnd6_ifptomacsys_____sigtimedwait50xscale_cache_cleanID_rngnfsv2_procidin_socktrimsockaddr_externalizeuvm_availmemwskbdopenffs_newvnodeuvm_pgflcache_initcnioctlprop_string_appendpktq_rps_hash_defaultntp_update_seconddevice_pmf_class_resumenfs_renamerpcata_queue_freecv_timedwaitbtffs_reclaimsockaddr_anyrt_get_ifaata_read_log_ext_ncqinpcb_rtentrycompat_sysmon_power_40_hooksysctl_net_inet_ip_portsufs_gro_genealogycopyout_sockname_sbvn_rdwrrt_inithead_KERNEL_OPT_SEMMNUmainbus_bs_allocdoforce__data_startin_if_link_state_changeicmp_reflectpmap_pv_trackedtcp_closepercpu_traverse_enter_KERNEL_OPT_INET6ip_optlenpmap_pv_init_KERNEL_OPT_WS_KERNEL_FGtcp_xmit_timersys_sendmmsgbufmem_hiwaterconfig_pending_decrsdmmc_intr_taskrtbl_init_KERNEL_OPT_FONT_GO_MONO12x23_KERNEL_OPT_WAPBLnfs_getattrsys___clock_settime50zssp_ic_stopuvm_obj_nowriteback_ppte_l2_l_prot_uencap_initcd9660_strategyuvm_map_submapieee80211_set_shortslottimedo_sys_getvfsstatmsdosfs_updatewsdisplay_cdevswvop_print_vp_offsetsmax_datalenvtw_restartmountlist_appendpmap_unwiredp8390_configcd9660_defattr_KERNEL_OPT_FONT_SPLEEN32x64wdc_allocate_regswsdisplay_isconsolevrevoke_prop_extern_append_encoded_cstringifmedia_removeallsys___fhstatvfs190badaddr_read_4getmicrotimev_putcmsdosfs_deupdatarp_rtrequestuvm_pagefree_KERNEL_OPT_EFI_RUNTIMEcnkqfiltersys_chmodpmf_debug_suspendsosetoptpcmcia_check_cis_quirksdevice_pmf_driver_shutdownaprint_naive_ifnetuvm_ra_initiic_use_direct_matchthreadpool_job_destroyrootvnodein6mask128nfs_reqqsys_fchmodsys__lwp_continueufs_direntergenfs_eopnotsuppffs_fhtovppxa2x0_i2c_closelwp_setspecific_by_lwpfat_tcpv4icmp_errorttsetwater_KERNEL_OPT_NWSKBDffs_syncnfs_vnodeopv_descsuser_stack_guard_sizeip6_optlenne2000_detecttcp_tcpcb_templatedk_startprop_number_unsigned_valuedevsw_detachtime_initsoloanfreepool_set_drain_hooksys_uuidgenifmedia_finittynullioctlworkqueue_destroyrtalloc1_KERNEL_OPT_CPU_PRE_ARMV6fat_tcpv6nfs_proctzeroin_addrrip6_attachrw_vector_exitVOP_CREATEpffindtypemsdosfs_createdeuvm_swap_inittcp_congctl_bystructnfs_merge_commit_ranges_KERNEL_OPT_PAX_SEGVGUARDold_sysctl__start_link_set_domainszeroin6_addrffs_specop_entriesproc_vmspace_getrefsockopt_setmbufsys_timer_deleteuvmspace_allocukphy_cdkern_freeiic_onceata_queue_activeprop_data_copyufs_reinitelf32_copyargslwp_trampolinesoqremque_atomic_cas_32pfil_run_hookssys_chowntcp_new_iss1clfree_atomic_or_uintip6_protoxin6_get_hw_ifidnd6_ioctl_KERNEL_OPT_EARLYCONSmii_ouiproc_finispecific_KERNEL_OPT_CPU_ARM9Eintoabs_notimpl_bs_r_8bufq_putifmedia_baudratesdmmc_del_taskvop_getattr_vp_offsets_KERNEL_OPT_NFS_BOOT_RWSIZEuvmpdpol_tunein6_multi_lockedieee80211_state_namegenfs_renamelock_entergenfs_rename_knotegenfs_nullopirqstackuvm_pageout_startpfil_run_ifhooksttyvnullopmodule_unloadtiocm_to_compxa25x_pxamci_gpioconfif_alloc_sadlencapinitwsmuxreadSetCPSRip6_get_membershipgenfs_islockedsysent_nomodbits_KERNEL_OPT_SYSCALL_DEBUGcd9660_specop_opv_descpmap_fault_fixupufetch_intsys___pollts50fstrans_getstatecopyout_msg_controldo_sys_unlinkttywflushmd_root_image_KERNEL_OPT_CPU_ARM11cd9660_vfsopssys_ktraceprop_data_copy_valueuvm_obj_page_dirty_puvm_lwp_setuareadl10019_mii_writereg_KERNEL_OPT_PIMcomcngetc_KERNEL_OPT_FONT_SPLEEN5x8pm_fatblocksizeieee80211_crypto_registeriic_smbus_receive_byte_KERNEL_OPT_SEMMNI_atomic_cas_ulong_KERNEL_OPT_HEARTBEATubc_purgepxagpio_cdaes_setdeckey128bpf_jit_freecodekpsignal2nfs_getauthm_tag_copy_chainpcq_putpager_map_wanted_locklayerfs_snapshotuvm_pgflcache_freeiostat_renamedkwedge_find_partitionufs_renameipi_unregistergeneric_bs_wm_4_swapnet_inet6_nd_90_hooktcp_ctloutputfownsignaldirhash_purge_KERNEL_OPT_COMPAT_NETBSD32wsdisplaykqfilteruvm_page_physunload_KERNEL_OPT_IPSEC_TX_TOS_CLEARvop_inactive_descuvm_page_array_fill_and_peekdead_default_errorpxa2x0_i2c_writetcp_timer_initptrace_update_lwp_KERNEL_OPT_CPU_UCODEmodule_genax88190_stop_card_KERNEL_OPT_NWSMOUSE_KERNEL_OPT_DEFCORENAMEoutsw16vfs_sync_allrn_search_matchedthreadpool_percpu_putpmf_inituvm_pgfl_unlockgenfs_enoioctlpte_l2_s_cache_modetputcharprop_bool_copypxa2x0_dmac_free_xferpuffs_out_50_hookdotimer_gettimeconfig_foundm_pullupwsdisplay_set_console_kbdufs_getattrrss_getkeyufs_linkcd9660_vnodeopv_descspxa2x0_update_intr_maskskern_reallocsysctl_consdevudp_do_loopback_cksumdo_sys_renameprop_number_integer_valuefrag6_slowtimo_KERNEL_OPT_BUSDMA_COUNTERSextent_alloc_subregion1siginitufs_blkatoffkauth_uucred_to_credufs_truncate_allustore_longmld_initpfil_head_destroyget_emul_sunos_hookrootdevsdmmc_mmc_commandmutex_vector_entersoo_closefscow_disestablishuao_referencesendsig_siginfopmf_device_recursive_suspendieee80211_media_init_with_lockuipc_socket_50_getopt1_hookkauth_cred_getuidsys___futex_set_robust_listsbsavetimestampsysmon_wdog_findsys___quotactlspecificdata_getspecificsys_minheritcache_lru_maxscansys___acl_aclcheck_filerasops_rmaskether_ip6multicast_minaddrulwpufetch_shortbs_notimpl_bs_wr_8genfs_ufslike_remove_check_permittedicmpmaskrepl_KERNEL_OPT_DKWEDGE_METHOD_BSDLABELin6_sin6_2_sin_in_sockrt_timer_count_atomic_add_32_nvrn_insertget_bootconf_optionrt_addrmsg_rtmutex_obj_tryalloccallout_invokingspec_nfsv2nodeop_entriesfscow_establishbreadnnd_resolveufs_gop_alloc_KERNEL_OPT_CPU_ARMV4if_detach_KERNEL_OPT_CPU_ARMV6bs_notimpl_bs_wr_4uvm_physseg_initpxapcic_attach_commonnfs_iodlist_alluvm_obj_page_set_writebackradix_tree_lookup_nodebus_space_tag_createSHA256_Transformvop_open_vp_offsetspool_cache_bootstrap_destroycpu_dumpnfs_commitif_initializeaprint_normal_ifnetkrpc_callpte_l2_s_prot_wpfil_run_addrhookssendsig_resetfstrans_initfilelist_lockuvm_freelist_locksnfs_dirhashtcp_canceltimerssys___futex_get_robust_listrt_addaddrip6_statincuvm_obj_page_clear_dirtysdmmc_io_initin6_sin_2_v4mapsin6_in_socktcp_fasttimoconsinitiftovt_tabxscale_controlevcnt_attach_dynamic_nozerowsdisplay_clearonclosenfs_readdirrpcdest6_inputvm_map_busynfs_iodlist_locksonewconnprop_dictionary_get_intsb_max_setloginitsched_sleptiic_tag_initieee80211_get_rateatabusioctldp8390_readcpu_kpreempt_enteraes_selftestwskbd_pickfreein6pcb_lookuppte_l2_s_prot_uld_sdmmc_cavfs_copyinfh_freeaprint_normal_devip_setmoptionspool_allocator_kmemklist_removesys___getrusage50_KERNEL_OPT_PAGER_MAP_SIZEgenfs_abortop_KERNEL_OPT_CPU_XSCALE_80200bs_notimpl_bs_rr_1uvm_pctparam_checksys___fhstat50callout_stopbufq_getpcmcia_function_unconfiguretcp_drop_KERNEL_OPT_SYSCTL_DISALLOW_KWRITEsys_fchown_KERNEL_OPT_WS_KERNEL_BGpxa2x0_memctl_writein6pcb_fetch_peeraddrVOP_GETPAGESxscale_optionspxa25x_i2s_gpioconftcp_initnfsm_uiotombufcopyin_vmspaceifa_psref_initmodule_specific_key_deleterw_lock_held_KERNEL_OPT_UVMHIST_PDHIST_SIZEdead_inactivefbadop_ioctlsdmmc_mem_discardmsdosfs_unix2dosfnnfs_numasyncnullmodemprop_data_equals_datacallback_run_roundrobinpte_l2_l_prot_w_KERNEL_OPT_CPU_ARM7aes_ccm_enc_mbufvop_deleteextattr_vp_offsetsptyattach_KERNEL_OPT_COM_16650sbdropnfs_connectsdmmc_io_read_region_1uvm_maxkaddrdmover_session_createsdmmc_io_write_region_1sys_munlockvop_mknod_descziic_cduipc_socket_50_setopt1_hookspec_node_initbufq_canceluvm_map_inheritdp8390_mediachangevn_kqfilterdevice_printfrasops_ecmapustore_intsecurity_setidcore_ownerbr_aes_ct_keysched_stdencuvm_coredump_count_segs_hooksys_extattrctllayer_getattrsys___posix_renameuvm_pageismanageddo_sys_accessatsys_extattr_delete_linkproc_findieee80211_add_rates__udivsi3in_if_link_upiostatlist_lockwskbd_set_evtranssys___lstat50longjmplwp_migratecd9660_lookupttycheckoutqpcmcia_free_pfuvm_deallocatefifo_nfsv2nodeop_opv_desccdev_ioctlnfs_timer_srvinitaroundsys_lsetxattr_KERNEL_OPT_CPU_ARM7TDMIprop_object_typert_ifa_addlocaltimecounter_lock_KERNEL_OPT_COMPAT_90ostype_KERNEL_OPT_CPU_ARM9kevent1multicast_register_if6uvm_amap_initin6_update_ifanfsv3_procidsdmmc_decode_cidsysmonpolldmover_request_initializegeneric_bs_wr_4spec_printpcmcia_intr_disestablishif_clone_attachputiobufieee80211_find_node_with_ssid_KERNEL_OPT_NSLlwp_startupproc_find_lwpvtype2dtwskbdpollmodule_printnfsdirhashmaskffs_blkpref_ufs1VOP_MKDIRsys_modctlsqphy_cdallcftablesprop_object_iterator_releaseuvm_physseg_seg_chomp_slabmsdosfs_dosdirempty_KERNEL_OPT_SYSCALL_TIMES_HASCOUNTERsys_kqueuesdmmc_read_cis_ustore_16ieee80211_ieee2mhzip6_neighborgcthreshsys___acl_set_linkkauth_cred_getegidVOP_DELETEEXTATTRvasprintfcom_pcmcia_attachnfsdreq_allocicmp_mtudisc_callback_registertk_rawcckauth_authorize_device_specnsphy_cdconfig_attach_pseudo_acquiredodupchdir_lookupdo_sys_fstatvfspmap_kenter_rangeether_ifdetachhook_establishuvm_coredump_walkmapclock_secs_to_ymdhmssys__lwp_suspendcom_init_regs_strideisodirino_KERNEL_OPT_NARCNETttyflushether_ifdetachsobindplatid_wildgetrealtimedkwedge_addsecmodel_suser_generic_cbdevice_lookup_privatepxa2x0_dmac_allocate_xferwsemul_vt100_opsrindexpmap_lockmif6tablecoredump_netbsd32_hookin6_purge_multicoldsys___acl_get_filein_if_downsys_flistxattr_KERNEL_OPT_POOL_NOCACHEschedhzwsevent_wakeupwskbd_srcopscpu_setmcontextvfs_hooks_reexportuvm_map_reservesys_posix_fallocatetcp_init_win_maxentpool_selftestpxa25x_pcic_gpioconfttywaitfstrans_donettydefcharsif_set_sadlprop_array_copyin_ioctlzkbd_modstatePMF_Q_SELFcoredump_netbsd_hookstrncasecmpucas_ptruvm_pagemarkdirtypsref_heldiskmemdevdo_posix_mknodat_KERNEL_OPT_KGDBstrcpysysmon_wdog_critpolluvm_page_recolorin6pcb_lookup_localVOP_SETACLin_multi_unlocksdmmc_set_relative_addrpcmcia_intr_establishudp_usrreqsmsdosfs_printgenfs_directiottioctluvm_swapisfullufs_quotactlsecmodel_suser_stoptvhzto_spllowerdkwedge_find_by_parentproc_sessrelenfs_invaldircachevattr_nullfc_fileextendsata_set_modebr_aes_ct_bitslice_invSboxkauth_proc_setgroupscache_lookup_mountbdev_flagsip_next_mtubdevsw_lookuplltable_foreach_llelayer_fsyncsoshutdownpfslowtimo_nowkauth_cred_groupsyn_cache_adduvm_pglistallocprop_array_countffs_flushfilesufs_symlink_KERNEL_OPT_WS_DEFAULT_BGttwriteieee80211_reset_bss_KERNEL_OPT_UDP_CSUM_COUNTERScpu_getmcontextin_first_multicallout_syncobjwdc_childdetachedgenfs_node_rdlockcfiattr_lookupi2c_bitbang_write_byteprop_array_getsys_sa_yieldsys_pipenfs_initnfs_advlockwsevent_kqfiltersys_unmountnfs_savenickauthnfsv2_vnodeop_entriessdmmc_io_write_1in6pcb_initxscale_cache_purgeD_KERNEL_OPT_SCTP_MCORE_INPUTno_devmon_insertuvm_proc_exitnfs_boot_cleanupnd6_lockdevice_find_by_xnameselect_sobjcpu_lockpxa2x0_i2c_initiate_xferVFS_VPTOFHmount_finispecificcpu_lookupinpcb_bindwsdisplay_maxscreenidxbs_notimpl_bs_r_4sys___pselect50_KERNEL_OPT_ARM9_CACHE_WRITE_THROUGHpopcountcnpollacct_initpercpu_getrefapm_v11_enabledmii_phy_detach_KERNEL_OPT_SHMMAXgeneric_bs_sr_1pxartc_cavirtual_end_KERNEL_OPT_FONT_VT220L8x10aio_suspend1xscale_cache_cleanD_rngiic_smbus_write_wordmodule_mapprop_number_equals_signedVOP_STRATEGYcurcpu_stabletodr_lock_ownedin6addr_linklocal_allrouters_prop_intern_skip_whitespacew100_alloc_screenmsdosfs_statvfsmodule_basedkwedge_find_by_wnamesys_aio_cancelpool_cache_sethiwatdmover_backend_list_lockmsgbufaddrsys___settimeofday50ffs_fifoop_opv_desccd9660_rrip_offsetpathbuf_stringcopy_getvop_mkdir_vp_offsetsglass_consolesaost_cdnfs_rcvunlockuvm_loanin_multi_lock_KERNEL_OPT_ARM11_CACHE_WRITE_THROUGHsys_extattr_delete_fdieee80211_cipher_tkipdev_findproductufetch_longrt_timer_queue_createevcnt_attach_staticsbappendwsdisplay_set_cons_kbdwdcintrnfs_reconnectbootsyncpool_cache_put_paddrcred0sockaddr_in_addrdo_sys_mknodbufinit2sbappendstreamnfs_timeruvm_km_protect_KERNEL_OPT_WAPBL_DEBUGrt_refinesmq_max_msgsizenfs_attrtimeoufs_gro_rename_check_permitteduvm_lwp_forkSHA384_Finalifmedia_matcharplookupcomstartsys___futimes50pxaintc_cddl10019_media_fininfs_loadvnodeieee80211_send_nulldatamodule_getspecificpxa2x0_intr_establish_prop_intern_decode_stringprofhzkauth_cred_getdatapps_ioctltty_countsysmon_wdog_initkcpuset_ffssched_schedclockspec_initmax_processesproc_find_lwp_acquire_proccoherency_unitmii_downkauth_cred_getfd_putfilewsevent_setversionbs_notimpl_bs_r_2ieee80211_rate2mediaudp_outputkern_mallocip6_forwardwsemul_vt100_scrolldownxlat_mbr_fstypeata_channel_lockproc_find_raw_KERNEL_OPT_GPROFin6_sin_2_v4mapsin6kmem_intr_zallocVFS_STATVFSnullret_atomic_dec_uint_nvdevice_compatible_pmatchcoredump_write_hooksigclearall_KERNEL_OPT_VMSWAPdirhash_lookup_freedsoftint_disestablishcv_timedwait_sigptsclosewskbd_add_muxpxa2x0_probe_sdramitimer_transitionrtl80x9_media_init_KERNEL_OPT_NVCONSnd_attach_domainrw_downgradebus_space_releasedevice_classconfig_fini_componentaes_ccm_dec1vop_setacl_vp_offsetsprop_dictionary_get_longlongatabus_cdieee80211_get_rtsuvm_physseg_get_endether_ip6multicast_maxcomcnattach1pps_eventnist_sha256_hash_drbg_generate_KERNEL_OPT_FONT_VT220L8x16in_maxmtudk_openip6_getdstifaddr_KERNEL_OPT_MSGTQLaes_cbcmac_update1ipstat_percpuentropy_bootrequestpffasttimo_chchacha_selftestmii_phy_updatephysical_start_KERNEL_OPT_PGSHIFTuipc_syscalls_50_hookirq_idle_entrypxa25x_com_hwuart_gpioconfinitprocchild_psignaluvm_map_lookup_entryudp6_ctlinputpcu_loadsys_extattr_delete_filedp8390_intrin_delmultitcp_ackdrop_ppslimconfig_unhookncpuonlinegenfs_deadunlockspec_node_lookup_by_devwdcrestartcpu_getmodelsys__ksem_unlinksysmon_wdog_kticklevop_revoke_descsys_setuidstrlist_appendtcp_autosndbuf_incVOP_CLOSEEXTATTRlockdebug_abortproc_free_pidcom_pcmcia_detachsysmonclose_wdogscoop_set_mic_biasdtrace_vtime_activexchacha_streamcpu_intr_pnfsv2_vnodeop_opv_descsys_lchflagscv_wait_sigprop_dictionary_get_longconfig_cfdata_attachnfs_mkdirsoacceptlwp_getspecificdevmon_insert_vecturnstile_wakeupsys_ovadvisemsdosfs_fc_purgekauth_deregister_keyuvm_pagermapout__stop_link_set_prop_linkpoolswdccommandshortprop_data_datattstart_KERNEL_OPT_KERNHIST_PRINTtcp_msl_enablenfs_writerpcptm_cdevswa4x_bs_wm_2_swaprt_addrmsg_srclim_freeprop_dictionary_copyin_ioctl_sizenfs_node_poolktr_mibiocv_broadcast_KERNEL_OPT_FONT_LUCIDA16x29do_fcntl_lockip6_v6onlywsdisplay_getactivescreensys__ksem_destroy_KERNEL_OPT_CPU_XSCALE_PXA250ipforwardingvop_whiteout_vp_offsets_ufetch_8_KERNEL_OPT_FONT_DROID_SANS_MONO19x36vfs_quotactl_quotaonspec_mmapswi_handlervop_pathconf_vp_offsets_KERNEL_OPT_COMPAT_10kauth_listen_scope_atomic_inc_32ip6_dad_countkernel_debugsys_epoll_ctlieee80211_cfgset_KERNEL_OPT_CPU_SA110disk_unbusyif_vlan_vlan_input_hookpmap_devmap_bootstrap_done_KERNEL_OPT_SHEEVA_L2_CACHEsys_mq_setattrvmem_xcreatedevsw_conv0_KERNEL_OPT_RASOPS_DEFAULT_HEIGHTarm32_mmap_flagsip_defttl_KERNEL_OPT_SHMMINrn_initheadwsdisplay_screentype_pickstrcatip6_hopopts_inputdomain_attachptimer_tickdo_sys_waitcritpollhook_establish_mountlist_nextprop_data_create_copyufs_opennestiobuf_donein_multi_groupapmdevclosedumppcbtickadj_KERNEL_OPT_VNODE_LOCKDEBUGrt_timer_addsys_revokeuvm_km_pgremove_intrsafedo_sys_mknodatresettodruvm_physseg_get_nextudp_ctloutputnd6_resolve_KERNEL_OPT_NCOM_KERNEL_OPT_WS_DEFAULT_MONOATTRbs_notimpl_bs_rm_1cpu_clusteridprop_object_equals_with_errorttypendvop_abortop_vp_offsetsip_statincdesiredvnodesfrag6_draina4x_bs_rm_1_KERNEL_OPT_COMPAT_110pmf_debug_transitionacctsuspendtvtohzvfs_opv_initffs_clrblockbdevsw0sys_shutdownip6_hdrnestlimitkobj_affixinsw16_KERNEL_OPT_SYSCTL_DISALLOW_CREATEsdmmc_set_bus_powerrw_vector_enterieee80211_wme_updateparamssys_timerfd_createuvm_extrapagestrace_exitacl_copy_acl_into_oldaclpipe1ifmedia_setxscale_cache_flushD_rngtcp_usrreqsxscale_cache_syncI_prop_stack_init_KERNEL_OPT_FONT_SPLEEN8x16lim_copynd6_ns_inputuvm_shmexitinpcb_bindableaddrnetaddr_matchnd6_lookupdevnullopcompolliic_smbus_block_read_KERNEL_OPT_PTRACEVOP_ACCESSXgeneric_bs_rr_4_swapfifo_nfsv2nodeop_entriesprocess_read_regsraw_detach_KERNEL_OPT_FFS_NO_SNAPSHOTextattr_check_crednsphyter_cdlayerfs_suspendctlnfsspec_writenfs_readdircoredump_elf64_hooksendsig_sigcontext_16_hooksysmonopen_wdogtcp_do_ecnpnaphy_cauvmpdpol_pagerealizemutex_syncobjmodule_errortcp6_vtw_enableconfig_detach_allbs_notimpl_bs_w_8in6_clearscopem_catwqinput_inputkernelpagespps_initiic_tag_fininfs_vfsopsin_setmaxmtuiic_smbus_quick_readgetdisksizecprng_initlo0ifpaprint_debug_ifnetcdev_detached_KERNEL_OPT_FONT_GLASS10x19tcp_do_autorcvbufSHA224_Transformrn_refines_KERNEL_OPT_STUARTCONSOLE_KERNEL_OPT_PMAP_TLBpool_ngetkauth_cred_holdarpintrmd_cdatacmd_toncqmutex_spin_entersdmmc_io_set_blocklenvfs_quotactl_cursorcloseifq_enqueuebrgphy_caieee80211_dump_pktbiowaitprop_dictionary_set_ushortsecmodel_securelevel_sysctlfiqhandler_stackllentry_freertsock_rt_ifmsg_50_hook_KERNEL_OPT_COMPAT_12vop_readdir_vp_offsetsaddupc_taskpxauart_canmountcompatnames__divsi3apmdev_cakern___acl_delete_pathamap_cow_nowacl_freeformat_bytesshutting_downdevice_compatible_pmatch_strlistinpcb_initvop_seek_vp_offsetsPMF_Q_DRVCTLsys_pollsleepq_changeprientpool_stirwsdisplaypollmsdosfs_fh_enterklogprigenfs_can_extattrhexdumpbs_notimpl_bs_w_4apm_battlowbs_notimpl_bs_w_2bpf_set_copsyscall_disestablishfiledelayptsstartkpsignala4x_bs_r_4_swapprop_dictionary_get_shortuvm_km_va_starved_pufetch_charkobj_load_vfs_KERNEL_OPT_MODULAR_KERNEL_OPT_TCP_CONGCTL_DEFAULTgenfs_kqfilterprop_object_iterator_resetif_registernfs_renameitrtredirectvmem_destroyptimers_freelayerfs_startarmv4_tlb_flushD_SEtcp_do_autosndbuftcp_do_abcw100_emulopssysmon_fininfsm_srvwccvmem_xallockcpuset_fillkauth_cred_getgidselsysinitnfs_vattr_poolwdcdetachuvm_physseg_seg_alloc_from_slabplatid_search_datart_replace_ifa_matched_entrieslwp_drainrefs_KERNEL_OPT_FONT_DROID_SANS_MONO12x22generic_bs_wm_4prop_dictionary_get_uint16cpu_infovop_setextattr_desc__udivmodsi4msgbufphys_KERNEL_OPT_NPXAGPIOsys_getpgidcd9660_fifoop_entriesVFS_MOUNTplatid_mask_MACH_HPkthread_joinkauth_cred_topcredvfs_vnode_sysinitdosetitimersys__lwp_wakeupusb_subr_fill_30_hookifmedia_delete_instancereaddisklabelnfsfifo_readbufq_freearpannounceuvm_waitsysctl_needfunccd9660_printhook_listsvshareklistsys__sched_setparamcopyout_procconfig_cfattach_lookupitimer_poisongetnanouptimeplatid_unknownsched_nextlwpip_pktqw100_show_screencn_tabSHA1Transformsocantsendmoreprocess_validdbregs_atomic_swap_32uvm_ra_allocctx_KERNEL_OPT_PXAGPIO_HAS_GPION_INTRSktr_nameisys_memfd_createcreate_idle_lwpprop_number_ushort_value_KERNEL_OPT_RASOPS_SMALLpcmcia_config_free_KERNEL_OPT_APM_V10_ONLYthreadpool_percpu_refsched_cpuattach_KERNEL_OPT_SEMUMEgenfs_null_putpagesieee80211_rssadapt_updatestatswskbd_init_keymapifmedia_match_lockedwsevent_injectdevhandle_impl_subclass_KERNEL_OPT_SCTP_LOCK_LOGGINGvacl_aclcheckuvm_anfreeuvmfault_anongetnfs_xdrneg1_KERNEL_OPT_NRASOPS24coredump_offset_hookipi_unicastwsfont_rotatebpf_cdevswVOP_OPENkcpuset_atomicly_intersectvfs_quotactl_cursorrewindtstohzmsdosfs_unix2winfnieee80211_encapcomprobe1amap_extendwsscreen_attach_syncpxaiic_cageneric_bs_r_4vmem_roundup_sizedevice_pmf_class_suspend_membar_acquireip6_setpktoptsthmap_destroyundefinedinstruction_bouncesys_pipe2ax88190_media_finimsdosfs_close_KERNEL_OPT_FONT_SPLEEN12x24genfs_gop_putrangebdev_discardpmap_needs_pte_sync_KERNEL_OPT_KLOADERraw_sendsysmonioctl_wdograw6cbtablenfs_sync_KERNEL_OPT_NPFSYNCvop_fcntl_vp_offsetswsdisplayioctlconfig_create_interruptthreadsif_export_if_dataieee80211_getmgtframenfs_false__acl_nfs4_sync_mode_from_aclqsphy_cdicsphy_cduvm_swap_putsys_setrlimitnameiat_simple_user_KERNEL_OPT_FONT_LIBERATION_MONO12x21acl_posix1e_checkndqbsyn_cache_initpanicstrfiq_getregsmii_ifmedia_changesys_mq_unlinkconfig_probesys___aio_suspend50com_cdevswspec_nfsv2nodeop_pmodule_machineether_strip_vlantagthreadpool_schedule_jobin6ifa_ifpwithaddrsys_preadprocess_validfpregsuid_initmsdosfs_startieee80211_notify_node_joinchgsemcntsched_lwp_statsamap_refVOP_INACTIVEuvm_physseg_get_lastuvm_physseg_get_highest_framedo_sys_recvmsg_KERNEL_OPT_WSEMUL_VT100_HILIT_FGnetbsd_elf32_notekauth_cred_getsvuidieee80211_notertcache_validateprop_dictionary_create_with_capacityieee80211_aclator_registericmpsrcbpf_validatefd_getsockvop_link_desckern_rebootarp_pktqvop_setacl_descsigprocmask1sys_aio_write_KERNEL_OPT_EXEC_SCRIPTcomintr_atomic_swap_uintbrelvpsys___syscall_KERNEL_OPT_CORTEX_PMCip6_keepfaithnfs_vgetpsets_initcopy_procargstcp_ack_on_pushcrashme_remove_KERNEL_OPT_SHMMNIamap_freesys___sigsuspend14config_init_componentsa_stacks1vn_extattr_getplatid_matchsys_aio_errorrw_obj_holdarm_scachesys____lwp_park60_KERNEL_OPT_ARM11_COMPAT_MMUprop_data_create_data_nocopyscoop_suspendsys_pset_creatend6_nud_hinttodr_save_systimemqueue_getm_append_KERNEL_OPT_COMPAT_80bufcacheuvm_map_pageable_alliophy_cd_KERNEL_OPT_NARP_KERNEL_OPT_CPU_SA1100itimerfixconfig_connectcallout_destroyuvm_pgflcache_pausebr_aes_ct_orthouvm_obj_page_set_dirtycpufunc_faultstatusdevice_propertiesdk_dumpieee80211_merge_print_intvlipi_broadcastsched_resched_cpumountlist_iterator_trynextsys_epoll_create1ptsreadconfig_defercpu_countunpst_recvspaceblake2s_updatedmover_request_freeieee80211_pwrsave_KERNEL_OPT_WSDISPLAY_COMPAT_RAWKBDaprint_error_ifnetzssp_cawskbd_get_mapentrycom_probe_subr_KERNEL_OPT_QUOTA2uvm_fault_unwirepxa2x0_dmac_start_xferfixjobcuid_find_KERNEL_OPT_KTRACE_atomic_add_32mutex_ownedaes_setdeckey256sched_oncpuproc_isundermutex_obj_holdsysctl_map_flagsstopsigmaskprop_dictionary_get_schardevice_release_KERNEL_OPT_RASOPS_DEFAULT_WIDTHpmf_device_deregisterieee80211_add_neighborucas_int_KERNEL_OPT_DKWEDGE_METHOD_GPTpxa2x0_irq_handlercpufunc_idpmf_device_subtree_releasecpu_rescanm_gethdrcpu_processor_featurestcp_backoffa4x_bs_r_1vec_ntp_timestatusproc_crmod_leave_KERNEL_OPT_NVERIEXECmsdosfs_unix2dostimepmap_deactivatestart_init_execwsevent_reada4x_bs_wm_4_swapuvm_physseg_get_avail_endtcp_do_win_scale_KERNEL_OPT_XSCALE_CACHE_READ_WRITE_ALLOCATEsys_getppidrip6_ctloutputsysctl_freecpu_fpu_presentnestiobuf_setupsys_extattr_list_linkgettimeleftbus_dma_tag_destroy_KERNEL_OPT_PAX_ASLR_DEBUGsysctl_net_route_setupspecificdata_key_createprop_dictionary_set_uintsecmodel_extensions_vfs_sysctldead_vnodeop_opv_descpsref_acquireprop_dictionary_set_int16ieee80211_find_vapVOP_SETEXTATTRufs_bmaparraymfs_initpool_inactive_timein6_mask2lenmsdosfs_readdedkwedge_autodiscoversoftint_bytes_KERNEL_OPT_NFAITHkcpuset_destroysys_madvisepps_ref_eventip6_mforwardgenfs_gop_write_rwmaptcp_abc_aggressiveuvm_loanbreak_anontcp_congctlhduvm_pagelookupgenfs_badopuserconf_promptifinit_postif_mcast_opuvm_obj_destroysys_sa_unblockyield_KERNEL_OPT_RTC_OFFSETinpcb_notifyallmountnfsgeneric_armv4_bs_rr_2_swapdata_abort_handlerpxa2x0_bs_mapvop_unlock_descstrlist_pmatchvop_getacl_vp_offsetstcp_autorcvbuf_inccpu_proc_forklayerfs_renamelock_entersdmmc_mem_send_op_conduvm_physseg_init_segffs_writebadaddr_readktr_cswfd_allocfilespec_openieee80211_node_attachpxa2x0_memctl_readkcpuset_cloneproc_getauxvspec_reclaimprop_object_releasecom_pcmcia_validate_configamap_splitrefieee80211_end_scansdmmc_needs_discoverpte_l1_s_wc_modekauth_initsys___socket30vmem_subsystem_initrtbl_search_matched_entrynfs_vfs_initgetfstypenamebuf_nbufproc_free_lwpidconsttime_memequalsdmmc_mem_scanbufq_movemsdosfs_degetitimer_unlock_bus_dmamap_load_bufferstoeplitz_initufsfifo_writesysvipc_sysctl_50_hookdo_futexsys_lseekdo_sys_bindprop_data_data_nocopyffs_fifoop_entriespool_primeif_schedule_deferred_startif_nullinitmii_attachlltableinitpmap_pv_trackgenfs_node_unlockinet_pfil_hookmaxlockdepthttpollsockopt_inittprintf_openunpdg_recvspaceip6_use_deprecatedevcnt_attach_dynamicuvmpdpol_needsscan_psys___sysctlktr_sysretmsdosfs_unmountcpufunc_null_fixupsecmodel_securelevel_network_cbmfs_printnfs_timer_startsysmon_wdog_shutdownsimplehook_has_hooksapm_userstandbysfnullop_kqfilterblist_allocttyoutputproc_setspecificvfs_relevfs_quotactl_objtypestatip6_sendredirectsnfs_delayedtruncatedomainnamelenkauth_cred_setsvuidwsemul_dumb_attachsys_llistxattrlog_cdevswoptstr_get_numberpxamci_card_detect_eventieee80211_add_scanraw_disconnecttc_detachffs_cgupdate_netbsd_keccakf1600vrele_asyncrtsock_oifmsg_50_hookkernconfig_lockvop_setextattr_vp_offsetssys_openptyttyvfs_unmount_forceonewdc_ata_bustypeata_queue_free_slotmtsleepieee80211_crypto_setkeypte_l1_s_prot_maskmainbus_bs_tagdo_posix_fadvisem_adjnfs_setattrrpcld_cdevswptspollmsdosfs_winSlotCntlltable_rwlockuipc_ctloutputbootspec_KERNEL_OPT_DEBUG_EXEC_KERNEL_OPT_SEMOPMsys___getdents30interrupt_get_availablecpu_simd_presentproc_specific_key_createlltable_drain_KERNEL_OPT_NFS_BOOTSTATIC_GWIPmemhookwdc_do_resetdmover_funcname_copy_KERNEL_OPT_NSATAsoftint_establishdo_sys_utimensvsnprintf_KERNEL_OPT_KASLRsyn_cache_reseticmp6_mtudisc_updatepmap_protectpmf_system_shutdownuvm_analloctprintf_closesys___utimes50sys_futimensraidframe_netbsd32_ioctl_hookbrelselkauth_authorize_process_KERNEL_OPT_ARM_HAS_VBARvmem_add_btssys_fdiscardraw_usrreqgenfs_fcntlstrlcpyvnalloc_marker_atomic_or_ulongaes_setenckey192mfs_reinitsys___futexcpu_umull_presentwdc_exec_commandkfilter_unregisterwsemul_vt100_handle_csitcp_pulloutofbandcn_set_magicuvm_map_pageableieee80211_node_dectestrefdumpspecb_to_qmsdosfs_extendfilewsdisplay_emulbellpsratio_KERNEL_OPT_RTCACHE_DEBUGsohasoutofbandsysmonopenmsdosfs_pcbmaplwp_thread_cleanupipi_cpu_handlervop_fdiscard_vp_offsetspollcommonvfs_busyexec_removelwp_lockcpu_initclocksvfs_hooks_lockdevice_active_deregisterip6_initpktopts_KERNEL_OPT_NWSFONT_GLUEdead_read_KERNEL_OPT_NIOEXPiostat_allocffs_specop_opv_desc_KERNEL_OPT_SCTP_MBUF_LOGGINGspecificdata_domain_deleteffs_freefileminidatacleanzkbd_cdrt_assert_inactivepte_l2_l_prot_rotcp_msl_remotecomparamrnd_init_softint__stop_link_set_evcntssysctl_extensions_user_handlerax88190_init_cardieee80211_setup_ratesnfs_boot_enbroadcastieee80211_beacon_updateVFS_STARTsys___setlogingenfs_parsepathpmap_kenter_paunixsw_KERNEL_OPT_MAXUSERSconfig_rootfoundtty_setctrlcharlayer_setattrproc0_initvop_kqfilter_vp_offsetssin_print_KERNEL_OPT_PXA2X0_DMAC_FIXED_PRIORITYprop_dictionary_ensure_capacitymsdosfs_fatentrypathbuf_copystringtcp6_segmentlddiscardendwsfont_map_unicharradix_tree_await_memoryunp_rightsieee80211_notify_node_leavehostnamepty_isfreert_delete_matched_entrieslwp_lockedrtl80x9_mediachangefree_control_mbuffd_getfilecomsoftbr_aes_ct_keysched_KERNEL_OPT_TPIDRPRW_IS_CURCPUconfig_connected_calluvmpageropsif_nullstoprootfstypefstrans_mountether_add_vlantagffs_reloadbufq_unregistermodule_start_unload_threadpool_allocator_nointrtcp_timer_persistrt_settagsys_getsockopt2ip6_forward_rt_percpua4x_bs_w_2_swapforkhook_disestablishcomclosecpu_signotifyieee80211_saveiert_addrmsgresource_initvfs_delrefsysctl_lockkthread_exitpmap_unmap_chunkw100lcd_cnattachsys__sched_protectbs_notimpl_bs_sr_1pfil_add_hookinvalhashget_bootconf_stringieee80211_reset_erpdevice_compatible_match_idlayer_bypassffs_setextattr_KERNEL_OPT_DCCPsockaddr_in_cmpprop_string_createffs_inode_cacheVOP_BWRITEkmem_zallocsyn_cache_insertbs_notimpl_bs_wm_1layer_revokemodule_specific_key_createpps_capture_bus_dmamem_mapcn_set_tablayer_closephysical_endfd_alloccoredump_elf32_hook_KERNEL_OPT_NATARAIDttylockedmsdosfs_accessdeviter_nextcnflushttyretypefrag6_fasttimointerrupt_destruct_intridscwdshare_lock_cas_endvfs_magiclinkspktq_rps_hashuvm_mapcoredump_elf64icmp6_errorsys___msync13maxdmappfil_remove_hookieee80211_add_wpakcpuset_copyinlayerfs_synclinkswsetdisklabel_KERNEL_OPT_UVMHISTvop_close_vp_offsetsapm_op_inprogconfig_hook_initsys_ftruncatefbadop_statrawcbtableroute_enqueueuvm_mremapswwdog_ca_KERNEL_OPT_SYSVSEMieee80211_crypto_decapsysmon_attach_minordead_lookupsimplehook_dohooks_KERNEL_OPT_ARM_CBARmii_phy_autodirhash_enter_freedprop_dictionary_set_and_relata_kill_pendingprop_dictionary_copyin_KERNEL_OPT_NPPPOEdo_ksem_open__end__module_builtin_addtty_getctrlcharfork1in6_domifattachsys_readvuvm_fault_internalwsemul_dumb_opsvec_sctp_delete_ip_addresspmap_createprop_number_create_unsigned_integerkcpuset_iszerorw_entersun_nonamesbwaitsigcantmaskufs_reclaimtty_releaseuvm_pglistalloc_initpxa2x0_i2c_intr_subip6_unknown_optgenfs_statvfscompat_vndioctl_50_hookpxa2x0_i2c_read_KERNEL_OPT_SCSIPI_DEBUG_TARGETpcmcia_function_initcpufreq_resumebdev_sizesys__ksem_waitnfs_clearcommitSHA512_Final_KERNEL_OPT_TCP_NDEBUGfiledesc0ipi_multicastsys_munlockall_KERNEL_OPT_COMPAT_LINUXgeneric_armv4_bs_w_2ata_queue_get_active_xferpktq_flush_KERNEL_OPT_KGDB_DEVRATEfc_lfcemptyffs_blkallocmodule_hook_exitbpf_validate_extttreadether_aton_rsoroverflowkauth_cred_setdataffs_vptofh_atomic_and_uintbpf_destroyvfs_composefh_alloc__aeabi_idiv0kthread_fpu_exit_mdwd_cdevswmsdosfs_deextendplatid_name_table_sizekauth_cred_groupmembervoidopuserconf_initcd9660_vnodeop_opv_descufsspec_writeprop_bool_valuebuildinfo_KERNEL_OPT_PIPE_NODIRECTdmover_funcname_xor2pim6_inputuvm_pager_realloc_emerg_KERNEL_OPT_SHMSEGconfig_deactivatevn_syncer_remove_from_worklistrpc_msgdeniednsphy_caiic_initcpu_countsvirtual_avail_prop_string_internalize_KERNEL_OPT_INSECUREcpu_childdetachedvop_listextattr_vp_offsetsrt_gettagvshareilock_KERNEL_OPT_GATEWAYconfig_detach_releaserpc_auth_unixtcp_rst_ppslimclallocconfig_cfattach_attachctty_cdevsw_KERNEL_OPT_NLCDieee80211_crypto_delglobalkeysif_get_byllaffs_discard_initunp_externalizeknote_clear_eofvmem_xfreeip6_savecontrolsys___acl_get_linkarmv4_tlb_flushImsdosfs_findwin95_KERNEL_OPT_NFS_BOOT_BOOTSTATICbpf_createreassignbufttylopengenfs_unlockchar_typearm_cksumdatakauth_cred_freeieee80211_cancel_scanswap_bdevswcv_syncobj_KERNEL_OPT_NKMEMPAGESrevarpinputsys_rmdirsys_lpathconflwp_alivevflushbufvop_aclcheck_desc_KERNEL_OPT_WSDISPLAY_CUSTOM_OUTPUTcv_inituvm_vnodeopsif_percpuq_enqueuevn_fifo_bypasscd9660_tstamp_conv7sys_faccessat_KERNEL_OPT_FONT_VT220L8x8aprint_verbose_ifnetnfs_printifattr_matchspldebug_startsys_sendtofetch_and_add_4tcbhashsizefstrans_heldether_mediachangesdmmc_mem_enableif_nulldrainsigacts0ieee80211_iserp_ratesetprocess_dodbregskprintf_unlockpxagpio_cagenfs_deadlockuvm_pgfl_lockpxa2x0_bus_dma_tag_KERNEL_OPT_NRASOPS1in_len2maskfd_set_excloseknote_proc_execip_savecontrolselrecord_KERNEL_OPT_ARMFPEsdmmc_io_read_2ttyldisc_lookupcallout_expireddmover_funcname_xor6ufs_removekauth_authorize_generickauth_cred_getrefcntigmp_fasttimosys_sa_stacksarp_ifinitsigispending_KERNEL_OPT_WDC_NO_IDSbdev_strategycheck_posix_spawnrt_ieee80211msgvnode_offset_next_by_lruaprint_errorarmv4_tlb_flushID_KERNEL_OPT_FONT_SPLEEN16x32entpool_enter_nostirmainbus_bs_r_1lwpinit_specificdatauvm_pctparam_inittcprexmtthreshvmapbufm_copybackdk_detachip6_lowportmindevice_pmf_bus_privateufs_rootgenfs_getpagestcp_do_rfc1323dmover_funcname_xor4dofhopensleepq_uncatchzaurusmodttyldisc_attachmatch_bootconf_optionlayerfs_donesys_extattr_list_file_KERNEL_OPT_BPF_BUFSIZEnfs_reqq_lock_KERNEL_OPT_WS_KERNEL_MONOATTRtcp_slowtimo_init__bss_startin_ifaddrhashtblsys___wait450prop_dictionary_removemq_recv1rtcache_lookup2_KERNEL_OPT_RND_PRINTFip_slowtimoproc_lockvop_lock_desc_KERNEL_OPT_CPU_XSCALE_80321ip_allowsrcrt_KERNEL_OPT_APMDEBUGlayer_bmappopcount32config_detach_commit_KERNEL_OPT_COMPAT_43sched_rqinitidlestacksb_maxdmover_funcname_zerowsfont_findcons_cdevswpowerhook_establishwsbell_add_muxsys_listenundefined_handlersmii_phy_auto_restartprop_array_copyout_ioctlttygetinforuspacestrlist_indexdead_writeuvm_swap_allocdoexechooksvfs_syncer_remove_from_worklistexit1uvm_map_referenceknote_proc_exitsockaddr_const_addrttyinput_wlockcpu_kpreempt_disabledin6ifa_ifwithaddrgenfs_revokegeneric_armv4_bs_wr_2_swapwsdisplay_internal_ioctlcpu_mainbus_casys_lchmodiic_smbus_block_write_atomic_inc_32_nvdmphy_caunputcufs_init_KERNEL_OPT_NFS_BOOT_DHCPtcp_mtudiscconfig_finalize_mountrootntp_initin_purgeifffs_updatemii_anarnfs_advdmover_algdesc_lookupexec_maxhdrsznd6_ifdetachmsdosfs_detimesgeneric_armv4_bs_rm_2_swapfragtblsokvaallocin6_ifawithifpmii_phy_statusvop_bmap_descvop_getextattr_descdl10019_mii_readreg_KERNEL_OPT_NFS_BOOTSTATIC_MYIPip6_reass_packetnfsm_rpcheadkauth_authorize_systemfutex_release_all_lwpiso_uiodirsigpending1uvm_unloansys_pwriteblake2smax_devsw_convs_KERNEL_OPT_MODULAR_DEFAULT_AUTOUNLOAD_UNSAFEffs_extattrctlsleepq_removepool_cache_cpu_initapmdev_cdevswdounmountvdevgonetcp4_vtw_enablesleepq_timeoutin_undefer_cksumip6_lowportmaxa4x_bs_r_2_swapgeneric_armv4_bs_c_2wsscreen_lookup_syncdevice_handlewdc_reset_drivegeneric_armv4_bs_rr_2_KERNEL_OPT_NETATALKDEBUGkauth_cred_getsvgidfd_getfile2pmap_kremovewsfont_matchesiso_shipdir_prop_stack_pushunpdg_sendspacepmap_remove_alldo_sys_utimensatuvm_pageenqueuevfs_quotactl_delmsdosfs_lookupgetiobufmsdosfs_clusterallocuvm_km_kmem_freea4x_bs_wm_1ip6_mrouternptyaddlognfs_iodlist_idlein6_prefixlen2maskbs_notimpl_bs_sm_1addupc_intrdevice_compatible_lookup_idkpm_lockiicbus_printwdccommandextsbappendcontrolffs_vnodeop_entriessogetoptin6_domifdetachprop_dictionary_set_uint8ether_inputuvm_physseg_get_prevmfs_startmii_phy_resetieee80211_node_delucastkeymodule_releallcfdrivers_KERNEL_OPT_NRASOPS16_atomic_dec_ptrgenfs_node_wrlockvfs_unmountall1pmap_virtual_spacegenfs_ebadfsoftint_schedule_cpuifaof_ifpforaddramap_copyrasops_cmapktr_namei2_fini_oncecallback_head_initether_inject_vlantagdo_sys_quotactlvfs_quotactl_cursorgetnfs_decode_argstcp_maxpersistidlemsdosfs_syncspec_lookuplayerfs_rootgeneric_armv4_bs_r_2kauth_cred_setegid_KERNEL_OPT___BUS_SPACE_HAS_STREAM_METHODSvm_map_lock_readmainbus_bs_mmapbufhashtblvn_bdev_openpmf_class_display_registerlwp_find_firstmq_max_maxmsgxscale_cache_syncI_rngtcp_do_sackcpufreq_suspendfbadop_closesys_sysarchsdmmc_check_cis_quirksieee80211_channel_anycprop_number_equals_unsignedcom_cdsdmmc_mem_write_blockprop_object_copyin_limitifnet_mtxmachdep_initip6_maxfragsmutex_exitsys_unlinkatieee80211_notify_replay_failurewsbelldevprintieee80211_find_node_with_channelmemchrSHA1Initprop_dictionary_get_keysymuvm_pagealloc_stratwsdisplaymmapvtw_delcdevsw_lookup_majorpercpu_foreachip_drainstubicmp_initsysctl_createvpmap_procwrgetuptimearp_draindoforkhookskmeminit_nkmempagesnfs_in_tobecommitted_rangesys__lwp_getprivatene_pcmcia_validate_configata_timo_xfer_check_KERNEL_OPT_PAX_MPROTECTieee80211_beacon_allocsys_write_lwp_getspecific_by_lwptcp_msl_localentropy_kqfiltersdmmc_function_freecoredump_savenote_elf32localcount_drainpxa2x0_gpio_configsdmmc_io_read_4config_mountrootuvm_km_alloc_KERNEL_OPT_INET_CSUM_COUNTERSsys_getpgrptcp_ctlinputfsetowntcp_stataddpmf_system_resumemsdosfs_fhtovpwskbd_cndetachsolockedkill_vmcmdssys_vforknfs_timer_init_KERNEL_OPT_KCOV_prop_extern_end_linein6addr_loopbackdp8390_activatedevice_cfdriverSHA256_Finaluvm_pgflcache_allockobj_load_memif_tunnel_ro_percpu_rtcache_freert_update_preparestrcasecmpsys_recvmmsgnfs_del_tobecommitted_rangegeneric_bs_w_1_KERNEL_OPT_PPPOE_SERVERufs_readdircpu_printfataltrapspserialize_read_exitptyioctludp6_outputgeneric_armv4_bs_rm_2phtree_SPLAY_REMOVEin_ifaddrhash_pszprop_dictionary_set_longlongdisasmzssp_read_ads7846mb_cachefiqstacksys_mprotectkauth_authorize_vnodekobj_renamespacedkcksumuvmspace_share_atomic_inc_uint_nvmii_phy_setmediavn_isunderrt_updateieee80211_setmodechgproccntxscale_cache_cleanIDmodule_builtinskauth_cred_dupxscale_minidata_clean_addr_KERNEL_OPT_WSDISPLAY_COMPAT_PCVTvop_closeextattr_vp_offsetsentpool_enterm_makewritablepxa2x0_gpio_intr_disestablishSHA224_Finalwsdisplayclosesoputwsemul_dumb_translatevfs_quotactl_statkthread_fpu_enter_mdzssp_write_lz9jg18ttyldisc_defaultwsmuxkqfilterkcpuset_atomic_setnfsrttonlcdctl_blank_KERNEL_OPT_COMPAT_ULTRIX_KERNEL_OPT_FFUARTCONSOLEwsdisplaydevprint_KERNEL_OPT_RASOPS_CLIPPINGtcp4_segmentarm_dcache_align_maskinittodrif_dl_createmodule_hook_unsetnull_childdetachedidle_loopsysctl_destroybuf_initpte_l2_s_wc_modecpu_coredumpnfsspec_access_KERNEL_OPT_EXEC_ELF_NOTELESSfileheadsignal_initcpu_info_storetcp_do_rfc1948cd9660_node_poolcv_timedwaitprop_string_sizepxa2x0_gpio_intr_establishubc_init_KERNEL_OPT_PAX_ASLR_DELTA_MMAP_LENne_pcmcia_matchrtsock_rt_addrmsg_src_50_hookhashstat_listcallout_activecpu_neon_present_KERNEL_OPT_FONT_QVSS8x15sys_nosyscpu_resetprop_dictionary_copy_KERNEL_OPT_MODULAR_DEFAULT_AUTOLOAD_KERNEL_OPT_MEMORY_DISK_IS_ROOTdmover_session_destroymsdosfs_unicode_foldmapufs_gro_lock_directoryNSM_NOFOLLOW_NOEMULROOTdisk_waitdo_ksem_initksiginfo_queue_drain0pathbuf_copyinthmap_stage_gcpool_cache_destroy_KERNEL_OPT_WLANffs_snapremoveieee80211_mgt_subtype_namelayer_lookupsys_flockata_queue_unholdshutdown_nextwsmuxclosebooted_partitionprefetch_abort_handlerphysiosys_extattr_set_fd_KERNEL_OPT_NFS_BOOTSTATIC_SERVADDRvrefcntsys___fstat50rw_exitsys_munmapip6_maxdynroutesencap6_inputras_forkmm_md_page_colorffs_vnodeop_pthreadpool_job_initopendiskaccept_filt_getoptuvm_mapent_trymergeuvm_page_rebucketsleepq_initcdev_closetodr_initw100_suspendrootvpcv_timedwaitbt_sigvfs_mountrootsysctl_dispatchmodule_find_sectioncpu_startup_hookuvm_loan_initget_random_bytesm_prepend_kernel_unlockrip_outputktr_kuservop_unlock_vp_offsetsffs_clusteracct_KERNEL_OPT_PAX_ASLR_DELTA_PROG_LENmount_setspecificvfinddevukphy_statussockaddr_dl_init_KERNEL_OPT_KGDB_DEVPORTaes_xts_decinpcb_purgeif0ffs_fragacctmii_mediachgsysctl_copyoutcd9660_vgetdevice_active_registerttyenodevbremfree_KERNEL_OPT_NFS_BOOT_UDPpmap_devmap_find_paplatid_name_tabledkwedge_delnfs_setattrpfctlinput2ifq_enqueue2uvm_loanuobjpagesVOP_FDISCARDpxa25x_com_ffuart_gpioconfexphy_cd_KERNEL_OPT_ARM11_PMCa4x_bs_rm_2_swaptcp_vtw_entriesvcache_getsys_closemainbus_bs_mapmsdosfs_pathconfphysio_initializeddp8390_stop_KERNEL_OPT_SHEEVA_L2_CACHE_WTkauth_cred_alloclayerfs_fhtovpbr_aes_ct_skey_expandkauth_cred_seteuidsys__pset_bindip_mtudiscdead_openlayer_removeprop_dictionary_set_longiskmemvprip6_inputufsspec_closeip6_defmcasthlimmsdosfs_create_KERNEL_OPT_NAGRsys_umaskvop_lock_vp_offsetssig_filtopsrtl80x9_mediastatussys_setcontextdkwedge_discoveruvm_map_lock_entryieee80211com_headsys_pathconfcompat_elf_check_interpvfs_quotactl_cursoropencopyoutstrkauth_cred_setgidm_dupfd_checkstdconfig_attachfiq_nullhandler_endccd_ioctl_60_hookswap_cdevswsoisdisconnectedcwdinitfd_putsockfc_lastclustprop_dictionary_keysym_cstring_nocopygeneric_bs_rm_4_swappool_cache_primeprop_array_make_immutabledevice_register_KERNEL_OPT_NATABUSgetcwd_common_KERNEL_OPT_WSDISPLAY_COMPAT_SYSCONScpu_topology_initwsdisplay_emul_cadevice_compatible_lookup_atomic_inc_ulongkern___acl_set_pathcpu_synchprim_presentsys___sigprocmask14msgbufp_ustore_32vop_bwrite_vp_offsetspcmcia_config_alloctcp_log_refusedieee80211_ibss_merge_atomic_add_int_nvcpu_configuresched_newtsa4x_bs_rm_4_swapcom_is_consoletimer_create1max_hdrwskbdioctlMD5Initmsdosfs_freeclusterchaindp8390_media_initgeteblkbcopy_pagekill1outswm8tcp_new_dsackvop_kqfilter_descVOP_MMAPdevice_pmf_bus_registerif_stats_to_if_datakauth_cred_copyrt_update_finishffs_mountfsifmedia_addpmap_updatenetbsd_elf32_signaturevmcmd_readvnapm_suspendslim_privatiseaes_setenckey128devincom_pcmcia_cauvm_mmap_anonprop_dictionary_get_dictrss_toeplitz_hash_from_mbuf_ipv6pxa2x0_intr_bootstrapkevent_fetch_changesclock_ymdhms_to_secssys__sched_getaffinityuvm_obj_wirepagescd9660_rrip_getnamedevhandle_is_validrnd_seed_KERNEL_OPT_UVMHIST_MAPHIST_SIZE_rw_initrt_clonedmsgtcp_congctl_availsockopt_setintextent_print_KERNEL_OPT_WD_SOFTBADSECTsecmodel_bsd44_initloopattachip_idip6_raw_ctloutputdl10019_mii_statchgacl_posix1e_acl_to_modeptcopenip6_auto_flowlabelvop_reclaim_vp_offsetsgeneric_armv4_bs_sr_2softint_picklwpxc_waituvm_obj_initmi_switchfsocreatedead_rootmountstoeplitz_cache__stop_link_set_modulesunpst_sendspacespec_vnodeop_entries_KERNEL_OPT_PAX_ASLR_DELTA_MMAP_LSBsys_fexecvesys_accessin_if_up_KERNEL_OPT_HWUARTCONSOLEuvm_uarea_initsys__ksem_initkcpuset_atomicly_removemodule_hook_setzaurus_restartbootconfignamecache_count_pass2msdosfs_reclaimpxa2x0_gpio_get_bitprop_dictionary_get_uintptrspec_strategyvop_strategy_vp_offsetsffs_load_inodesigaltstack1set_statvfs_infosys_clock_nanosleepp2p_rtrequestsofreescoop_check_mcrprop_dictionary_setuvm_page_array_peekuipc_socket_50_sbts_hookepoll_ctl_commonVOP_RECLAIMswi_entryrss_toeplitz_hash_from_mbuf_ipv4_KERNEL_OPT_DKWEDGE_AUTODISCOVERinterrupt_distribute_handlersys_setegidcpu_set_onfaultencap_attach_addrip6_tso_outputfd_getsock1_KERNEL_OPT_CPU_ARMV4Tgenfs_ufslike_rename_check_possible_KERNEL_OPT_COM_16750sogetcom_init_regscprng_strong64do_fhstatvfsissignalstrncpyieee80211_rssadapt_inputiostat_findnfs_request_KERNEL_OPT_NGIFcpu_mcontext_validatesys_mincorenfsdreq_free_bus_dmamap_destroyttysigdo_sys_statprop_dictionary_iteratordisassemble__udivmoddi4sys_fstatatnfs_zeropadicmp6stat_percpuroute_infovm_map_lock_tryrtsock_rt_ifannouncemsg_50_hooklayerfs_renamelock_exitsbunlockwskbd_default_keyrepeat_datauserconf_bootinfolwp_userretuiopeeketextsockaddr_allocworkqueue_waituvm_growposix_spawn_fa_freestrlist_countlwp_ctl_freemii_findproduct_hookdeviocschedppqin_multi_lock_helduvm_page_array_initfstrans_start_nowaitsoftnet_lockmainbus_bs_w_1uvm_physseg_get_startxdr_string_decodein_broadcastptckqfilterxscale_setup_minidataif_heldcomcnputc_KERNEL_OPT_KASANras_per_procgetmicroboottimewi_intrprop_number_long_valuepmap_destroypmf_device_descendants_resumesys__ksem_getvalueprop_dictionary_creategenfs_pollcdev_cancel_KERNEL_OPT_COMPAT_BSDPTYata_get_xferwsscreen_detach_synclwp_lendprixscale_cpufuncskobj_find_sectionuvm_map_protect_uservt100_setnrcstrlist_matchm_xbytedevice_unitwsemul_removeget_pc_str_offsetpmap_map_sectionxscale_tlb_flushID_SEfstrans_unmountufs_dirbadwsmuxpollrnd_add_data_synccdev_read_atomic_cas_32_niencap_detachprop_dictionary_get_uint32icmp_dynamic_rt_msgkmem_asprintfpowerhook_disestablishrt_ifmsg_KERNEL_OPT_SOSEND_NO_LOANfiq_setregsudp6_statincnd6_useloopback_KERNEL_OPT_READAHEAD_STATSsleepq_abortuvm_aio_aiodone_pagesmsgbufmappedmountlist_removefd_set_foclosepage0genfs_can_access_acl_nfs4prop_dictionary_set_cstringarp_stat_add_KERNEL_OPT_SPLASHSCREENroot_is_mountedsimplehook_disestablishmfs_mountrootscoop_set_headphoneprop_number_intptr_valuelookup_for_nfsd_indexrn_mkfreelistsbdroprecordprop_number_int16_valueifmedia_ioctlcomdiaguvm_obj_setlockip6_freepcboptssoisdisconnectingvfs_drainvnodesdevice_acquireaes_cbc_enccomcnattachuvmpdpol_pageisqueued_picmp6_statincmsdosfs_unicode_foldmap_entriescpu_in_cksumffs_log_changeoptin6pcb_rtentrydevsw_blk2namesys_setprioritybswap64vop_create_vp_offsetsin_next_multipercpu_foreach_xcalldo_sys_recvmsg_sokcpuset_copysecmodel_evalicmp6_nodeinfo_KERNEL_OPT_NGREprop_dictionary_set_string_nocopydmover_backend_unregisteruvm_obj_clean_pdkwedge_print_wnamesieee80211_amrr_node_initdmover_request_cachenfs_kqfinidevice_pmf_class_private_KERNEL_OPT_NMBCLUSTERS__stop_link_set_ieee80211_funcsrtsock_iflist_70_hookpxa2x0_gpio_set_dir_KERNEL_OPT_SEMUSZ_KERNEL_OPT_TCP_CSUM_COUNTERSgenfs_do_putpagessecmodel_securelevel_process_cbi2c_bitbang_send_stop_KERNEL_OPT_MROUTINGvfs_quotactl_getufs_mknodnfs_null__aeabi_uidivmodsodisconnectclock_settime1sys_utracedmover_completed_siprop_dictionary_get_cstring_nocopy_KERNEL_OPT_SCTPprop_data_create_nocopy_KERNEL_OPT_BIOHIST_PRINTacl_allocuvm_pagewanted_pprop_array_copyoutacctresumecpu_is_type_KERNEL_OPT_TODR_DEBUGlayer_renameieee80211_media_statustty_ttioctl_60_hookmfs_inactiveif_deactivate_KERNEL_OPT_COMPAT_30rnd_detach_sourcertbl_walktreepmtu_expiremii_phy_add_mediamodule_load_vfs_init_KERNEL_OPT_KCSAN_PANICip6_log_timewdccommand_KERNEL_OPT_ATADEBUG_MASKip_drain_atomic_inc_uintgenfs_can_chmodttyldisc_detachselcommondevice_is_activepcmcia_config_mapinterrupt_distributettyputinfoa4x_bs_w_4_swapufs_vinitsys_aio_readrw_destroysoinit2extent_alloc1sleepq_locksuvm_uarea_system_allocmclbytes__aeabi_memcpy4check_execinpcb_rtentry_unrefpfil_head_getgeneric_bs_rr_4vfs_hooks_detachsecmodel_securelevel_system_cbpcu_valid_ptcp6_mtudisc_callbackdo_sys_getsocknamefscaleproc_find_lwpidmax_protohdrip_reass_drainlwp_trylockpercpu_traverse_exitwsdisplaywritetcp_syn_bucket_limituao_detachnfsm_srvpostopattrbus_space_reservepmap_pv_protectkauth_cred_ngroupswsfont_lockmaxslpwsdisplay_switchmount_domountip6_auto_linklocalwsdisplayio_get_ediduvm_pagezeromfs_mountundefined_entrycom_modemfiq_nullhandleruvm_page_physunload_forcensphyter_ca_KERNEL_OPT_WSEMUL_VT100_UNDERLINE_BGmutex_vector_exitpci_chipset_tag_destroyprop_string_create_formatdevice_set_privatemii_phy_matchufs_vget_KERNEL_OPT_PPPOE_DEBUGpxa2x0_bs_tagboot_filemii_tickbzero_pageuvmpdpol_scanfinitcp_congctl_releaseprop_dictionary_set_uintptrsysctl_kern_vnodedirhash_putpmap_kmpagessys__lwp_ctlscoop_set_irledfd_dup2ieee80211_alloc_nodesdmmc_delayaes_decxdr_string_encodenfs_writesoo_ioctltcp_autorcvbuf_maxmodule_unregister_callbacksdisk_findfifo_vnodeop_ptcp_hdrszforkhook_establishpcmcia_function_enablesched_pstatsprintf_nologmbuftypeswi_attachentropy_extract_ufetch_16inpcb_notifyVFS_SYNCsin6_print_KERNEL_OPT_ARMV83_PAC_KERNEL_OPT_WSDISPLAY_SCROLLBACK_LINESieee80211_std_rateset_11bsdmmc_io_function_disableget_expose_addressudp_sendudp6_usrreqstc_initphysical_freeend__aeabi_memcpy8entropy_readyconfig_rootsearchkern_proc32_copyin_hookip6_forwardinglog_ts_precxscale_cache_purgeID_rngvop_poll_vp_offsetspcu_switchpointradix_tree_gang_lookup_tagged_nodeuvm_swap_freeinswm8ne_pcmcia_disablepstatsfreecdev_stopipi_trigger_multii2c_bitbang_send_startrw_tryenterip6_mcast_pmtuSHA256_Updategetnanoboottimeuvmpdpol_initvn_bwritescoop_akin_pullupmsdosfs_gop_markupdatedmover_backend_releaseuvm_map_checkprot_KERNEL_OPT_NFS_BOOT_BOOTPARAMmodule_listcd9660_fifoop_plltable_link_entrynfs_initdircacheffs_snapblkfreesat_printrn_search_mwsdisplayopenprop_number_uchar_valueufs_readlinkmsdosfs_inactive_KERNEL_OPT_FONT_COMIC16x34fiq_releasepxa2x0_i2c_pollif_cvtcmd_43_hookaes_xts_enc_KERNEL_OPT_MODULAR_DEFAULT_VERBOSEapmdevpoll__start_link_set_modulesdevice_pmf_class_deregisterubc_winshiftpmap_pv_untrackmd_is_rootplatid_searchtime_adjtimelayerfs_loadvnode_atomic_inc_ulong_nv_KERNEL_OPT_MSGMNIip6_mrouter_setvop_strategy_descprop_dictionary_keysym_valueprop_array_copyin_ioctl_sizecpufunc_nullopdevice_pmf_bus_resumend6_dad_stop_KERNEL_OPT_NDDBkcpuset_copyoutin6_sin6_2_sinnd6_recalc_reachtm_intervalacctchkfreqnfs_boot_initrt_ifa_remlocalamap_lookupprop_dictionary_get_uint8rt_missmsgwsdisplay_kbdinput_KERNEL_OPT_NFS_BOOT_OPTIONSieee80211_beacon_missshmctl1pxa2x0_gpio_get_functionsdmmc_mem_set_blocklennfs_renamelayer_printdirhash_initprop_string_copy_KERNEL_OPT_WAPBL_DEBUG_PRINTieee80211_find_txnodew100lcd_accessopssys_chflagsbpfilterattachsys___posix_lchownsys_mq_openVOP_REMOVEphysical_freestarttrace_enterxscale_cache_flushD_SEblock_userspace_access_KERNEL_OPT_CPU_ARM1176wi_pcmcia_caarm_pcachenfs_node_donecom_iflushgenfs_node_wrlockedsys___acl_delete_fdieee80211_crypto_newkeymsdosfs_removedeVOP_READcputypepci_chipset_tag_createether_disable_vlan_mtuprop_dictionary_make_immutable_atomic_add_ptruvm_estimatepageableuvmpd_trylockownerpxaip_cacpu_startuppte_l2_s_prot_roturnstile0ifmedia_init_with_lockprop_dictionary_set_intata_thread_runmodule_init_classsockopt_getintieee80211_notify_michael_failureprop_dictionary_set_ulongtcp_sack_globalmaxholesmfs_reclaim_KERNEL_OPT_CPU_ARM10_KERNEL_OPT_CPU_XSCALEmountlist_iterator_destroymsdosfs_vptofhif_purgeaddrstcp_sack_numblksitimer_lock_heldfutex_sys_finikernel_pt_listtcp_do_loopback_cksumgenfs_can_chowntcp_keepidleureadccd9660_specop_pvm_map_locked_ppmap_link_l2ptxscale_cache_flushIoptstr_get_macaddrkernel_lock_dodebuguvm_physseg_plugmsdosfs_getattrocryptof_50_hookdostatvfsieee80211_media_changetcp_newtcpcbin_purgeaddraes_ccm_verify_KERNEL_OPT_NLCDCTLnd6_initudp_initsoo_readinphy_cdradix_tree_set_tagpool_allocator_metacall_listtcp_ecn_maxretrieskmem_meta_arenamodule_hook_tryenter_KERNEL_OPT_EXEC_ELF32generic_bs_rm_4rasops4_initcom_hwiflowholdrelelset_stackptrip6_defhlimfd_closeexecmodule_setspecificdata_abort_entryin_ifaddrheadpcmcia_card_attachacl_posix1e_mode_to_entrymd_open_hookndflushsys_extattr_set_fileuvm_pctparam_getaccept_filt_addsdmmc_print_cidvop_symlink_vp_offsetssysmon_wdog_setmodewsdisplay_noemul_camsdosfs_dos2unixfnm_copy_pkthdricmp_mtudiscmsgbufenabledfc_lmdistancechange_rootsysmonclosemsdosfs_fh_removepxadmac_caax88190_mediastatusif_flags_setif_stopvfs_composefh_freepanicstartrt_gettable_KERNEL_OPT_RFC2292tcp_reass_maxqueuelennd6_option_initdo_sched_setparamvmem_xalloc_addrarm32_dma_range_intersectifa_releasein6_purge_mcast_referencessched_pstats_hookvfs_getnewfsid_KERNEL_OPT_FONT_DROID_SANS_MONO9x18if_domain_link_state_changeip6_mrouter_versecurity_setidcore_dumpmsdosfs_vgetfnullop_fcntlprop_number_sizenfs_iodinitswwdog_rebootffs_setblockwsmux_attach_scata_xfer_startuvm_uarea_freesysmon_wdog_releasevfs_fhtovp_KERNEL_OPT_COMPAT_NETBSDin6_delmultisigaction1sysctl_portalgo_selected6_membar_enterbs_notimpl_bs_wr_1uvm_kernel_objectfbadop_writesbreleasegenfs_putpagessys_readdirhash_dir_isemptycalc_cache_sizetcp_sack_optionsbappendrecordsys___nanosleep50xdr_inaddr_decode_KERNEL_OPT_SCTP_DEBUGkern___acl_get_pathbpf_setopsieee80211_rssadapt_lower_ratepmap_extractgenfs_rename_cache_purgetcp_delack_tickskthread_sysinitw100_free_screendevice_lookup_acquirelwp_startVFS_EXTATTRCTLkcpuset_clearieee80211_proto_attachelf32_populate_auxvarp_nud_hintnd6_rtr_cachert_setgateinittimeleftieee80211_iterate_nodes_prop_extern_append_cstringether_ipmulticast_maxin6_setscopemiiverbose_loadedzssp_ic_startkfilter_registermq_open_maxuvm_pagereadonly_pkmem_va_arenaexechook_disestablishlooutputturnstile_initxc__highpri_intrcache_have_iduuid_printf_atomic_cas_ptr_nisleep_syncobjuvm_swapisfull_factor_atomic_add_intprop_string_cstring_nocopyif_tunnel_free_ro_percpuieee80211_rssadapt_chooseether_ifattachpxa2x0_gpio_clear_intrifa_heldxscale_cache_purgeIDdo_sys_pstatvfsm_align__aeabi_memcpyata_probe_capsscoop_discharge_batteryprocinit_sysctl_atomic_or_32nfs_commitsizem_copydataconsttyarmv4_drain_writebufffs_blkalloc_umpkmem_strfreecpu_dumpconfbs_notimpl_bs_rr_8prop_array_removesoftint_blockcom_cleanupnfs_strategyip_directedbcaststatclockrt_msg1proc_uidmatch_atomic_add_long_prop_object_externalizechgsbsizedmover_completedmover_backend_listif_tunnel_check_nestingemul_find_rootlcdctl_paramsleepq_transferin6_ifaddlocaluvm_vm_page_to_physsdmmc_stop_transmissionprocess_dofpregsstrtoulwdcbit_bucketaccept_filt_getcallout_hardclockcpu_softintr_psys_aio_returnVOP_GETATTRtcp_init_common_KERNEL_OPT_VERBOSE_INIT_ARMudpcksumlwp_specific_key_createether_ioctldevice_pmf_driver_deregisterrw_vector_tryenterextent_alloc_regionkmem_va_meta_arenadmover_process_initializesigismaskedmii_bitbang_readregwsdisplay_preattachrt_freea4x_bs_w_1if_nullslowtimowsscreen_switchwaitpxa2x0_i2c_send_startkauth_unlisten_scopecpufreq_get_statedo_sys_sendmsg_KERNEL_OPT_APMDEBUG_VALUEsys___mq_timedsend50ffs_listextattritimer_gettimeproc_leavepgrpdmover_funcname_xor8_KERNEL_OPT_ATADEBUGbdev_detachedkmem_intr_freeffs_getblkieee80211_node_joinzapm_callentry_pool_putundefined_initVOP_BMAPvop_fsync_vp_offsetsencap6_ctlinputcdev_pollconfig_disconnect_KERNEL_OPT_NRTL80X9device_pmf_driver_set_child_registertshztouprt_msg3ip6_use_defzoneproc_getspecificffs_snapshot_readwsmux_getmuxproc_find_reflockedNSM_NOFOLLOW_TRYEMULROOTstartprofclocksysctl_relocksys__lwp_setprivatexc_broadcastVOP_PRINTnfs_createbawritenfs_mount_countuvm_phys_to_vm_pagesys_socketpairin6_addrscopecpu_dump_mempagecntVOP_MKNODsowaitblake2s_initufs_advlockgeneric_armv4_bs_wr_2fragtbl124kmemsizevflushbdevvppxa2x0_dmac_abort_xferstoeplitz_hash_ip6portifaref_KERNEL_OPT_POOL_QUARANTINEtk_nout_KERNEL_OPT_PAX_ASLR_DELTA_STACK_LSBieee80211_find_rxnode_withkey_KERNEL_OPT_FONT_VT220KOI8x10_KOI8_R_KERNEL_OPT_COMPAT_15vop_ioctl_vp_offsetsVOP_PARSEPATHuvm_vslockcpu_is_1stclasspuffs_in_50_hookmainbus_bs_wm_2sbappendaddrchainkauth_cred_uucmpdisk_attachsys__ksem_timedwaitmountroothook_destroyktrace_onuvm_obj_page_clear_writebackrtsock_iflist_14_hook_KERNEL_OPT_ARM32_DISABLE_ALIGNMENT_FAULTSsyscall_internnfs_initdirxlatecookiephtree_SPLAY_INSERTin6_joingroupkcpuset_countsetdevice_active_KERNEL_OPT_SETUIDSCRIPTSicmp6_initufs_bmapvm_map_unbusyudp_ctlinputdevsw_conv_KERNEL_OPT_NNULLCONS_KERNEL_OPT_SEMMAPinpcb_fetch_peeraddrpfil_add_ihookieee80211_debugvop_deleteextattr_descufs_mkdircdevsw_lookupreal_coredump_elf32pxa2x0_gpio_clear_bitrip_inputppsratecheckpmf_device_subtree_resumecopyout_vmspaceufs_makedirentrymodule_hook_initsys_killfc_bmapcallsmodule_initprocliststcp_sendspaceencap_lock_exitgenfs_insane_renamesys_sa_setconcurrencyipi_sysinitdevice_pmf_bus_shutdownifmedia_80_pre_hooksys_pset_destroyffs_balloctcp_timer_funcsufs_diremptyitimer_finirw_obj_freetcp_init_win_local_KERNEL_OPT_ATADEBUG_WD_MASK_KERNEL_OPT_ARM_HAS_LPAEloopinitmax_linkhdrbufq_registersys___posix_fadvise50layer_reclaimnd_set_timernfs_inactiveuprintf_lockedrttimer_queue_headlcdctl_onoffexithook_establishsimplehook_destroypxa2x0_gpio_intr_unmasksysmonkqfilterlwp_setspecifickauth_authorize_device_passthrugenfs_seeksbcreatecontrolvfs_hooks_attachprop_dictionary_countmsdosfs_strategypktq_dequeuekern_logsigexitsys_fgetxattrvop_accessx_vp_offsets_KERNEL_OPT_WSDISPLAY_COMPAT_USLipi_percpu_inituvm_iosetrootfstimebs_notimpl_bs_c_8zerodevsaost_resetrw_obj_allocipi_triggervop_accessx_desctodr_unlockin6_if_upaes_ccm_selftestsys_getrlimituvm_fault_rndsourcenfs_boot_sobind_ipportmsdosfs_rmdirvfs_resumerasops_erasecolsata_queue_drive_active_xfersys_fchmodat_KERNEL_OPT_EXEC_ECOFF_prop_object_initdofilewriteuvm_pageunwireVOP_SETATTRvfs_quotactl_cursorskipidtypevop_getpages_descsys_lio_listioupdatefatscd9660_utf8_jolietskpcvop_abortop_descpgrp_findarm_cpu_topology_setata_delayip6_pktqmount_specific_key_createmsdosfs_denode_pool__aeabi_memsetvcache_tryvgetsbcompressbufq_peekbs_notimpl_bs_c_2ip6_mrouter_detachusb_subr_copy_30_hooklwp_need_userret_atomic_cas_ptr_KERNEL_OPT_MAXLWPin_ifaddrhash_pslistsys_getgroupsip_srcroutecd9660_vptofhcpu_spawn_returnamap_addip_dad_countnfs_vptofhrnd_cdevswpool_cache_set_drain_hookpdevinitsys___setitimer50prop_dictionary_get_uint64rnd_attach_sourcespecificdata_finiuvm_km_bootstrapdp8390_ioctlcomioctluvm_md_initpcq_maxitemsrpc_auth_kerbdead_poll_KERNEL_OPT_FONT_SONY12x24nfs_rcvlock__aeabi_idivuuid_dec_be_KERNEL_OPT_PPS_DEBUGvfs_quotactl_quotaoffmsdosfs_writedevice_pmf_unlock_rnd_add_uint64_KERNEL_OPT_TPIDRPRW_IS_CURLWP_KERNEL_OPT_DCCPSTATESchacha_coredo_filereadvbs_notimpl_bs_c_4dkwedge_readsys_fchownat_prop_xml_intern_find_taguvm_proc_forksys_eventfdprop_dictionary_set_uchardo_sys_utimesieee80211_drain_ifqtcp_optlenarpresolveuvm_page_array_advanceprop_object_equalsstrlenpte_l2_l_cache_maskuvm_kentry_lockpool_cache_nputcomopenipsendredirectsuioskipbr_aes_ct_bitslice_Sboxieee80211_sysctl_attachcom_rbuf_sizepool_chkether_multiaddrsdmmc_select_cardkpreempt_enableprop_dictionary_get_ushort_KERNEL_OPT_FONT_DEJAVU_SANS_MONO12x22sys_fsetxattrrw_obj_tryallocpxaic_baseelf32_check_headerm_tag_prependrip_initprop_object_externalize_with_formatsysmon_initkcpuset_intersectvop_bmap_vp_offsets_KERNEL_OPT_MIIVERBOSEdp8390_detachpool_drainwsemul_dumb_outputm_tag_copypffasttimo_nowdkwedge_initif_addr_initif_first_addrpxamci_attach_subrb_tree_iterateuvm_swap_getptsstopaprint_normalin6mask96uvm_map_inituvmspace_addrefsys_mkfifokthread_createkprintf_initvn_marktextmodule_builtin_removedead_newvnodesched_kpreempt_priamap_allocrip6_outputsigactsinit_KERNEL_OPT_FFS_EIcdev_flagspxa2x0_i2c_attach_subtcp_templatechacha_md_initsched_tickuvm_page_physgetcprng_strong32pmap_boot_freeqiic_smbus_quick_writepfil_head_createnfs_sendlayer_accessspec_nfsv2nodeop_opv_desc_KERNEL_OPT_WS_KERNEL_COLATTRdead_strategyufs_dirremoveatastartata_kill_activeif_stats_initif_acquire_KERNEL_OPT___BUS_SPACE_HAS_PROBING_METHODSne2000_detachnfs_removemsdosfs_vfsopssys__lwp_exitvn_bdev_openpathnd6_ifattachmodule_verbose_ondevice_pmf_class_registerspec_node_getmountedfsacl_nfs4_is_trivialif_do_daduvm_swap_stats50_KERNEL_OPT_NFS_BOOT_BOOTP_REQFILEmd_root_sizesdmmc_io_function_abort__start_link_set_dkwedge_methodspfil_initbus_space_tag_destroybooted_nblksbufmemether_set_vlan_cbbpfjit_module_opsvop_rmdir_desclf_initinpcb_lookup_localrip6_recvspaceiic_mtxktruser_KERNEL_OPT_DDB_VERBOSE_HELPnfs_closesecmodel_suser_vnode_cbpage0_endcd9660_mountnfs_removeiticmp_statinckprintfnfs_in_committed_rangemutex_adaptive_lockopspxa25x_com_btuart_gpioconfmainbus_bs_subregionuvm_km_pgremoveip6_lasthdrcd9660_tstamp_conv17process_doregsv_flushieee80211_begin_scan_KERNEL_OPT_MSGBUFSIZElwp_parknfs_getnickauthsys___mount50vop_getpages_vp_offsetslocalcount_finiin6_src_ioctlkauth_authorize_actionsys_sched_yieldplatid_match_subdo_fhstatmii_phy_ticksysctl_net_inet6_addrctlpolicyieee80211_crypto_unregistermsdosfs_setattrsockaddr_cmpuvm_swap_stats13memlocksys___acl_delete_filertcache_unrefcomreadcom_breakcomhwiflowpxa2x0_bs_vaddrtcp_mss_from_peericmp_mtudisc_callbacksmfs_bmapata_exec_xferin6pcb_rtchangegenfs_compat_gop_writeata_queue_get_active_xfer_lockedmodule_register_callbackssigsuspendsetupisocharfd_copyprop_dictionary_set_shortdk_caw100_attach_subrnd6_optionswsemul_dumb_cnattachextent_destroynfs_doiosys___acl_delete_linktcp_congctl_init_KERNEL_OPT__ARM32_NEED_BUS_DMA_BOUNCElookup_for_nfsdtrace_is_enabledlayer_getpagesnist_sha256_hash_drbg_destroysched_wakeup_KERNEL_OPT_NDRVCTLmii_findvendor_hooksys_setregidffs_getextattrld_panic_KERNEL_OPT_MEMORY_DISK_SERVERnfsv3_typeufetchstore_faultdevice_getlocksys_getgidpathbuf_stringcopy_putpcmcia_read_cisvcache_newcallout_resetipi_registerturnstile_unsleepm_defraggenfs_accessxtk_canccin_tunnel_validatelxtphy_cdieee80211_authenticator_getnfs_repheaddo_sys_chdirvfs_syncwaitin_ifaddrhead_pslistlcdctl_cdsuspendschedsys__ksem_postrnd_ioctl32_50_hookuvm_swap_statssoftint_pendingrnd_add_data_KERNEL_OPT_UVMHIST_PRINTsys_pset_assignwsemul_vt100_resetvop_mknod_vp_offsetscdev_kqfilternameiat_simpleamap_unaddubc_pagerproc_alloc_pidcdev_discardinpcb_destroyuvm_cpu_attachrt_matchaddrffs_readif_nulltransmitnfs_readlinkrpcexec_setup_stack_KERNEL_OPT_NFS_BOOT_BOOTPsched_dequeuesdmmc_io_read_multi_1sys_fchrootvcache_vget_KERNEL_OPT_KMSAN_PANICsleepq_lendprienxio_KERNEL_OPT_SCTP_USE_PERCPU_STATonce_smapm_initedsbreserveether_addmultisys_mmaprtsock_iflist_50_hookif_clone_detachscanccpu_intr_countifa_ifwithnet_psrefmsdosfs_winChksumamap_pp_adjref_KERNEL_OPT_COMPAT_100in_domifattachicsphy_casaost_cadl10019_mii_bitbang_writesysctl_copyinrtcache_updatevfs_unbusyprocess_read_fpregs_KERNEL_OPT_FONT_COMIC12x25wdctimeoutcpu_topology_setspeedin6addr_anybdwritepmap_clear_modifybadaddr_read_1comcnmodepte_l2_s_protolwp_park_syncobjprop_number_ulong_valueseltrue_filtopscdev_mmap_KERNEL_OPT_KMEM_SIZExc_ipi_handlergeneric_bs_sr_4_swapsdmmc_intr_enablepool_cache_bootstrapieee80211_send_mgmt_bus_dmamem_mmapthmap_setrootvfp_fpscr_changable_KERNEL_OPT_SHMMAXPGSuvmpdpol_pagedeactivateinitmsgbuf_atomic_dec_ulongnfs_rootffs_statvfscpu_is_idle_1stclasssetjmpradix_tree_insert_nodert_walktreewsemul_vt100_ellwp_delref2icmp6_redirect_output_bus_dmamap_createlwp0_inituvm_uarea_system_freenamei_hashthreadpool_percpu_ref_remotew100lcd_cdproc_stoptrace_KERNEL_OPT_FONT_BOLD8x16lwp_specific_key_deletene_pcmcia_casysmon_wdog_refconfig_attach_pseudopmf_debug_eventtcp_nownfs_getcacheblkpmap_extract_coherencyprop_dictionary_get_dataprop_dictionary_get_uintne_pcmcia_dl10019_get_enaddrpcmcia_print_cis_KERNEL_OPT_DKWEDGE_METHOD_APPLEuuid_snprintfapm_strerrorVOP_CLOSEpxa2x0_i2c_openmutex_obj_refcntnullcnpollc_KERNEL_OPT_COMPAT_20pxa2x0_gpio_set_intr_levelsys_wait6nfs_boot_sendrecvif_free_sadlwsdisplay_predetachthreadpool_percpu_gettcp_rttlocalnfs_getxid_KERNEL_OPT_NMODULARtimespecaddok_KERNEL_OPT_PAX_ASLRpxa25x_pxaacu_gpioconfnetbsd32_reg_validate_hooktcp_sack_output_KERNEL_OPT_SYSVMSGubc_nwinssysctl_inpcblistttyldisc_lookup_bynumVOP_PATHCONFcompat_offseterruvm_uarea_allocgenfs_suspendctlwskbd_cdevswuvm_setpagesizesysctl_file_marker_lockkcpuset_atomicly_mergeamap_wiperange_KERNEL_OPT_RTFLUSH_DEBUGcd9660_rootvop_rename_vp_offsetsttyinputwdc_init_shadow_regsffs_fifoop_p_bus_dmamap_load_mbufsysctl_portalgo_selected4ip6_mrouter_donepmf_device_descendants_releasecom_pcmcia_enablesecmodel_suser_network_cbwsemul_pickrnd_ioctl_50_hooktcpipqent_allocvdead_checksys_mq_receivegeneric_armv4_bs_sr_2_swapbiohist_initprop_string_create_copyvn_extattr_rmsys_fktracebus_dma_tag_createvop_print_descvtw_addnuidhash_maxsockaddr_freemsdosfs_winChkNamevop_putpages_descturnstile_lookuppte_l2_l_nocache_modepmap_get_pdegeneric_bs_sr_4_KERNEL_OPT_NWDC_COMMONSHA512_Transformcache_lookup_linkeddead_getpagesnfs_putdircacheSHA1Updatebpf_ops_kernelconfig_init_miufs_gro_renameuvm_kick_pdaemonpmap_referencecn_destroy_magicVOP_RENAMEpsref_target_initcnwritedl10019_stop_cardprop_number_unsigned_integer_valuefs_filtopsvop_setattr_descvmem_allocprop_number_uintptr_valuew100_resumerip6_sendspace_KERNEL_OPT_PAX_MPROTECT_DEBUGmsdosfs_removeuvmpdpol_pagedequeuewsmuxattachclock_gettime1_KERNEL_OPT_NNETATALKprop_number_int32_valuesdmmc_io_scankmem_tmpbuf_allocclock_getres1config_matchin_anysomaxconnsecmodel_deregisterttyrubsysmon_wdog_unregisterhostnamelen_KERNEL_OPT_CPU_FA526in_lookup_multivop_advlock_descnfsspec_readffs_freefile_snapi2c_bitbang_read_byteturnstile_changepriaddrsel_policytaboptstr_getmi_cpu_initonce_initsdmmc_card_intrinterrupt_get_assigned_atomic_and_32pte_l1_c_protouvm_lwp_exitwd_bdevswin_localaddrdirdelaysdmmc_go_idle_stateinpcb_fetch_sockaddrpmf_system_bus_resumevop_getextattr_vp_offsetsconfig_finalize_registerieee80211_init_neighboruvmpdpol_reinitsys_posix_spawnuvm_pageboot_allocprop_dictionary_set_uint64reset_entrylockdelaypmap_copy_page_xscalerasops_lmasksdmmc_intr_establishnd6_maxndoptiostat_waittime_secondrasops8_initsoo_writetcp_totbackofftcp_newreno_ctl_KERNEL_OPT_KLOADER_KERNEL_PATHexec_sigcode_allocpool_allocator_vmem_metaif_linkstate_change_disestablishrn_walktreeso_setsockoptvfs_mount_sysinitprintf_nostampnfsrv_errmapin_undefer_cksum_tcpudpffs_checkfreefilesys_obreaknist_sha256_hash_drbg_instantiatenfs_readnfs_unmountspldebug_stopaes_setdeckey192sys_timer_getoverrunmf6ctable_KERNEL_OPT_LOCKDEBUGrevarpwhoarewesys_fpathconfifmedia_unlock_for_legacy_atomic_dec_ulong_nvnist_sha256_hash_drbg_initialize_KERNEL_OPT_makeoptions_SPLASHSCREEN_IMAGEcoredump_netbsd32_KERNEL_OPT_NRASOPS32generic_bs_wr_1wsemul_vt100_scrollupieee80211_crypto_encaparpioctlacl_posix1e_newfilemodewsfont_make_cookiein6_selectroutekcpuset_atomic_clear__start_link_set_sysctl_funcsesymtcp_free_sackholestty_freeprocess_write_regsnfsspec_closewsdisplayio_get_fbinfodevhandle_type_KERNEL_OPT___HAVE_GENERIC_STARTsys_extattr_set_linkktr_pointieee80211_authenticator_unregisternestiobuf_iodoneieee80211_wme_updateparams_lockedsdmmc_io_enablelwp_finispecificuuid_dec_lesbflush_atomic_cas_uintvfp_attachip_do_randomidrtrequest1getbinuptimecom_resumeVOP_READDIRwsdisplay_cnattachw100_ioctlieee80211_set11gbasicratescdevvpdo_sys_symlinkvop_link_vp_offsetsproc_comparesys___acl_get_fdnfsstatscom_init_regs_stride_width_KERNEL_OPT_NO_DEV_PTMdevopnkinfo_vgetfailedufsfifo_readtcp_usrreq_init_KERNEL_OPT_SCTP_WITH_NO_CSUMprop_number_int64_valuedo_sys_fchdirprop_string_copy_value_KERNEL_OPT_SCSIPI_DEBUG_TYPEufs_createieee80211_node_detachifmedia_initxc_unicastinpcb_lookupbpf_opssched_lwp_collectuvm_kernaccvm_map_unlockstub_compat_70_unp_addsockcredbdev_dumpkcpuset_setexecsigs_KERNEL_OPT_SCSIPI_DEBUG_FLAGSrasops_eraserowsdefault_bus_space_is_equalmp_online_KERNEL_OPT_NSATA_PMPdevice_compatible_lookup_strlistcpu_infosieee80211_get_cts_to_selfuvm_map_unlock_entrytcp_iss_seqin6ifa_first_lladdr_psrefapmdevioctlufs_dirbadentryufs_gro_directory_empty_pconfig_hookifa_is_destroyingtcpipqent_initclock_timeleftieee80211_fix_rate_KERNEL_OPT_NWDnfs_bmapvop_readdir_descamap_share_protectdo_sys_sendmsg_sokpreemptpktq_enqueuecpu_jump_onfaultktext_writeidentify_arm_cpuieee80211_next_scanexplicit_memset_implcache_enter_idsys_mq_notifyufs_whiteoutsys_fcntluvm_map_findspacemfs_initminiroot_prop_number_internalizert_check_reject_routen6expire_KERNEL_OPT_FPU_VFPuvmpdpol_sysctlsetupcd9660_rrip_getsymnamevop_setattr_vp_offsetsVOP_LOOKUPgenfs_node_initmd_attach_hookiostat_busy_KERNEL_OPT_CPU_ARMV3xscale_cache_clean_addrsys_syscalldead_renameufs_inactivein_directraw_inputgeneric_armv4_bs_wm_2_swapsys__lwp_getnamein6pcb_bindvop_mkdir_descufetch_ptrpsref_releasesys_truncatedp8390_getdl10019_media_initsdmmc_intr_disestablishpercpu_freesched_idlesysctl_ip_reass_setupnfs_renewxidsys_rasctluvm_swap_shutdownuvm_map_clip_startconfig_search_KERNEL_OPT_NFS_BOOTSTATIC_MASKvacl_get_aclgenfs_compat_getpageslwp0bs_notimpl_bs_rr_4ttylistvec_sctp_add_ip_addresspcmcia_cdvacl_set_aclwskbd_cngetcvunmapbufwsdisplay_paramsa6_anyiostat_countsys___stat50_KERNEL_OPT_ACKDEBUGdo_sys_chmodatsysmon_wdog_finipage0_dataifmedia_list_add_KERNEL_OPT_COMPAT_NOMIDne_pcmcia_attachoptstr_get_stringvfs_unmountallata_timeoutconfig_found_acquirecrashme_addgeneric_armv4_bs_wm_2xscale_cache_cleanD_KERNEL_OPT_APM_POWER_PRINTenosysieee80211_node_table_resetfstrans_start_lazydmover_funcname_fill8sys_fdatasyncspecificdata_inituvm_page_numa_loadsched_proc_exitvmcmdset_extendprop_dictionary_get_intptrsopollbpf_filtervnis_markerwsfont_unlockpxa25x_i2c_gpioconfin6_sysctl_multicast_setupfd_abortuvm_physseg_valid_p_KERNEL_OPT_UVM_HOTPLUGprop_string_create_nocopyubc_uiomove_KERNEL_OPT_SDMMCCISDEBUGnd6_dad_startcd9660_statvfsether_ipmulticast_minsys___dup3100drm_ioctlpxa2x0_i2c_resetvfs_list_lock_KERNEL_OPT_CPU_ARMV7_KERNEL_OPT_CPU_ARM8sokvafreethmap_gcsqphy_ca_KERNEL_OPT_UVM_PAGE_TRKOWNufs_getlbnsbs_notimpl_bs_rr_2nfs_rmdir_KERNEL_OPT_SOSEND_COUNTERSkcpuset_zeropmap_copy_page_func_KERNEL_OPT_APM_NO_V12_KERNEL_OPT_CPU_ARM6kcpuset_mergevop_mmap_vp_offsetsdo_timerfd_settimeuvm_pageactivategenfs_can_stickysys__lwp_setnamehumanize_numbersched_enqueueconfig_twiddle_fnpte_l1_ss_protodo_timerfd_createsysctl_locatefd_initbufinituvm_page_array_fill_KERNEL_OPT_VMSWAP_DEFAULT_PLAINTEXTsys_kqueue1nfsm_srvfattrufsspec_readnfsm_strtmbufuvm_pglistalloc_contig_lock_KERNEL_OPT_NKMEMPAGES_MAXrotatedfontscdev_typekmem_intr_allocdeviter_firstcd9660_specop_entrieslwp_setlockboothowtoffs_blkpref_ufs2osrelease_bus_dmamem_allocpte_l2_s_nocache_modeamap_pp_establishstoeplitz_to_keynd6_na_inputif_clone_list_KERNEL_OPT_XSCALE_CACHE_WRITE_BACKata_recovery_resumecache_purgevfspcu_ops_md_defsuvm_pagegetdirtyieee80211_announcepxa2x0_gpio_intr_maskSHA512_Initpcmcia_io_unmapsigsuspend1pserialize_not_in_read_sectionuvm_pagecheckdirty_atomic_dec_uintuio_setup_sysspacekthread_fpu_enterether_snprintfdo_ksem_waitapm_damn_fool_biosdevhandle_invalidinpcb_disconnectpool_reclaimin6pcb_connectmutex_destroy_KERNEL_OPT_WS_DEFAULT_FGrn_searchprop_dictionary_keysym_equalsieee80211_media_initin6_presentcprng_fast64_KERNEL_OPT_SCSIPI_DEBUG_LUNuvm_pager_initnfs_reclaimdp8390_disablepmf_set_platformgetrusage1settimeofday1xc_encode_iplmount_getspecificsys_renameatigmp_initdk_done_KERNEL_OPT_COMPAT_09soinitrasops_unpack_attrvop_islocked_vp_offsetssofamilyaes_ccm_tagpserialize_destroyworkqueue_createradix_tree_gang_lookup_nodekauth_authorize_machdepieee80211_aclator_getuvm_ra_requestbrelsein6mask64sysctl_createudp_init_commonsys_getrandominet6ctlerrmapsosendtodr_locktcp_mss_to_advertiseprefetch_abort_handler_addressvn_statpktq_ifdetachlocalcount_releasemsgctl1scdebug_initwdc_cdffs_vnodeopv_descsxscale_cache_cleanD_Epxa2x0_i2c_detach_subpffinddomainmainbus_bs_rm_2sys__ksem_closecd9660_deftstampidentify_featuresclockctl_ioctl_50_hook.symtab.strtab.shstrtab.textlink_set_moduleslink_set_sysctl_funcslink_set_ieee80211_funcslink_set_domainslink_set_evcntslink_set_dkwedge_methodslink_set_prop_linkpools.data.bss.note.netbsd.ident.ARM.attributes.comment.SUNW_ctf.gnu_debuglink@;!<_<2ء_رHt_ta_r_H_ _ `PM!@MP AO@PP Aph A)0 Aw0B"BCE CEq JH2K