08CN!f<  CN!fww/< <CN!f@@<@T 08CN!f<  CN!fww/< <CN!f@@<@TU CN!f<HACN!fCN!fCN!fACN!fCN!fCN!fA&CN!fCN!fCN!fx5ACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fCCN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!f$p CN!fCN!fCN!fmC CN!fCN!fCN!f (08@HPx$CN!fCN!fCN!fhpxE$CN!fCN!fCN!fD$_xCN!fCN!fCN!f (0=$yCN!fCN!fCN!f8@HPX`hpC!CN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f!CN!fCN!fCN!f4!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f B!CN!fCN!fCN!f B!CN!fCN!fCN!f!CN!fCN!fCN!f"!CN!fCN!fCN!f"!CN!fCN!fCN!f"aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f \!CN!fCN!fCN!f\!CN!fCN!fCN!f \!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f\!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f$!CN!fCN!fCN!f4!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f !CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f \aCN!fCN!fCN!f\aCN!fCN!fCN!f \aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\aCN!fCN!fCN!f\$!CN!fCN!fCN!fi!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!f B!CN!fCN!fCN!f B!CN!fCN!fCN!f!CN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!f!CN!fCN!fCN!f!CN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!f aCN!fCN!fCN!faCN!fCN!fCN!faCN!fCN!fCN!fCN!fCN!fCN!fbpf!CN!fCN!fCN!f $CN!fCN!fCN!f$CN!fCN!fCN!f$CN!fCN!fCN!f$sCN!fCN!fCN!f$CN!fCN!fCN!f$CN!fCN!fCN!fACN!fCN!fCN!fmCN!fCN!fCN!f$jCN!fCN!fCN!f $CN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!fACN!fCN!fCN!ff{(!ݼc]B& > PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF( 4 4 (h h%h%h L8h h%h%PtdNetBSD/ NetBSDearmv6hf  -H0H 0DP`PUL(0@`&a`@03/T:$(4$ -AL MPR@a !1 P`0 RP 0S  /S 0SP10S QG <1 R ! ,10  0S1 0듞0 X *0p )p03/ Wp}0pW *0@(@03/T FM< `0 00P0 0D0 09$TtzP؄$\$,$ -@Lp pp]PhaV pPOU< nP 0$J@ n 묉x%|s P-L@ KhQFH0`  BR` pRp R嶴X Xp/% % -P pbL00CS0fp@f Z(0S TpWpT0S 0T0 R0S  16@ G 0S8 l!l\X16@ ; T 0S* $p&1 T0S! ^p( I0S TMp -p @000 ^p T@? @xp 0 @0@ 8@P嗘000`00$06@$%% %%pǓ -@Pp`0帀L0Y  .P 0Q ᅳ@Plc0 P0 <@0 P0@T0`00 0S%%ӛxLp -LM1Vu5 AuP$0S!(0SKᐟP<0 S(0(` V,0P$ 3$ 0R+( , $ `Vp( $`PPp p$ ͝P0!  00 K%%Ǔp -LMPDqDa@@1tt@0X4 (P@tt@& R Ო@PK0p0: S ờ3᜝@P弗0 P00 P0THe0s s0T ᘝ0S$K%%ӛxp -Lv0 喲^sx% 000/& --LM` l0@   A'  A{{`z$$l(K KЫ Y@&Wx% -L$M@4K00@K fP GK~  t1-0`QzL@0  fP 0SP ((*PFPP 0V;0PM7P  P W 0XpV 6p0-SP?p 0S 0<PVPP =%& -LM  ᭜pp  T5X`0S D50S850S (50SH50S+ U%嵱00CS00 4 Pp@@   BR 0 m0  YYXKP dp <Dpǝp 0: S +FpP300屝 +5pP 3P DBp埝h gP TlE'R,K0@X܌K 00 30 ,K+K%0R 000 0 p p  p@܂Ԑ А T1#0 d0כY |@ -K ?-K0@iS -KK{TDP0S  0Kj(›0Pa@ @0S $P ٕʛTƛBP@ @@0 ?oR20S 0  `1 0RKP 展@ 0R 10:#:؛PᒛP 嚕@0S 5P@ |0 Gp  0S00S (K&&&&&%=%x%&p&&%&&& 0-LMPAK@A )p  0K0U4@ h坜P XXFAK@@BPAKA0,0P XK0=%& Q0-L@ XwPLL<5P ,00$0P0K0h=%& Q0-L@ \UPPP"<君P ,00$0P0K0h=%& -L0 㬭x%0$/(&0$/h& -L -L  -L! -L7p  1-LM  0㜄 0 KL& 1-LM  0㊄ 0 K\h& 1-LM  0x 0 Kh(& 0-LM  0f 0 Kt& 0-LM  0T00 Kh&(& 0-LM $ 0? P K苑A% 1-LM (0 *00 K薑& -LM800 0 0 0 K &h& -LM800 0 0 0 K &(& ,0-`LM!q!PAU- @P x =P `000PS @ <1 040,K,@ P,  0 ,  0003/0  R0B=00 B  o/0  R  P 00P ! 7000X0X0TL00Kh&(& &őD#=O&i\(4 00-L0\@ tP !QP0800 0@P  nPQP &(&h&0  /(&h&  - LR벐p -L  - LE밐p -L -LM80@0K(3/P $ 90: S80 0 Kt(3/P 0   0(1/0 QP 0S 00 0Kpm8@ -(PLU@𨝈80 03/`P8003/(` p-@P`LM, KL㞘80 (0(3/@l  P,K㑘f PKp& -LM,CP  0 0`S< 80 #KZ#K20 0FԃKR ~ 0P  p8p (1/0 QP2$  lr4 P0 0$ LS  0S $ 020 r# 0#1!# 0#! 0 `# 0##K SRq!܃K SR ! 0!,! 0!'! 0!#K SR 0 0S0$$0- 0 0 $ 9#K R 0r K0 40`p#K P0!QP#K![*0  `Z 000L0! PA0 4(Ko賗(Kh&& &p&"F -LMt2 @  `㚗 0  D㓗K@G0}S% b@@_HD0}◓) ?@TP0!!!! d K !@PKK c" StRp d!dK׫KK O" S$R  !dKëKK ;# SR  dK⯫KK '?8p<` !0/0d0 /^X dp`K⎫KK $K&dK&ړܭ2IQ @-LLh゘ -LM8A 0PP004 !"08P (1/0 QP5$ `0@p 0@DT% 80 $0(3/P 0 d0d$ `V`P 0S0C0<Y$ސ$K(&p &A% -LMA 0P004 !"08( 1/0 QPK`p/ 03K004 K00 800(3/P9' $ #WVĠ.*  !QP` p $ 80 $0(3/P`p#WVL@:03K800 04 K((3/p$ (Kh&mp P-0@0 LM 00 0K0 K K袑 -LMp K`P @P@[KP PNV@K贔 -\@LP`UPE Q Po & -#MLM<1  Q Q  Q 0S=(KoP@8X1 0S0'0S 0 ! P 0pSD ᗥ &K@ >K0CKKZ P  KAPN@(K & 1-PL@d  1 QP  1 {PC p l堪hHdaPpU1TA U000<0p&P( ʮ 兪00CS0)00 ' ! m 0p0CS000x00 %0U0 囮H DVTX  ? $0&(&0&,&Ix%ޘX&&y|&\ 0-LR R 0S R/S&F 0-$L @ 0R0 10PP 0 P00 T@% .P 0 P 0CPP0PPP B0SP Ph 0 P 0PU 0<00    0&X&A%|&&|& 0-DP@L00 00@0@000000&|& -`L?#PP@ L < 8婩4 0p S@@ft V'0S  yP) ˭ 冩0000  0T0?x` 0 宭< 8iL  @  ? Ix%y (&,&ޘ0& 0 -0 L?0妔PKP@@~P  0P/S;R0 @P+.p` pl0P  H @tP&t&5/H<d&X&Uo,&pr -`LP P|@ @: 0``\P PP 7 & P@P 00@,&X&<x%(&0& D0P-PL ,@_ P  &0 0Ꭶ,&X&  -DL@宁fP(0( 00000 Sx&%&8&@-44@ @00 c R   X&8&//// -P`0LSp.@l000$P帬 su00CS000  [0`0CS0P000 D&8&H&&Ix%y|&C- |0| Pxp0`EP @^ PV00V00\08&<&H&T0@-P @L00T0P 00\08&@&H& -LM2PP 0p#K20K 2P4@K 0KQ@P@dbS&HPD P? PU#  PP00   R R 0`00 SnPT1@t@00S PR P PHF0KP ,A00 S5 S<!0 0< 80 #P80< 廫 vx00CS000  ^ 00CS0l00@0   s(Kdl&dK&\&%l&&Ix%y|& -@xPx`0L00h0@`0@\0@X0@$0@0CS0800 &H&<&@&8&D&|& -L M@p0P U U`P-0开 帐RP00@P0U1P 0S 0 @0 0 hoP P@JP(Kl&͙&t&`&H0`  BR` pRp RRX Xp/% % -$L MpP3@0S 00CS0up` F0 `A0`@"U1 UL0@00@p240 0 "P0 4000 彪H Dx@z00  B R?0@0CS0 20  Xv`V0 `1P  V R4儁 U000t1 40 0 M"P0 40{@ <68800C0S$ 10 00CS000 V00` 0@ Q U h00x0@ H00 P00S L00S TD(K&&T&L&Ix%y|&t&P& -LM,R@ $bp00 80 040 200010S 0@1࡟p@0P<0 91 D0 1 PD0 0 Y 00 0x! D0 PD0  BR  ID10 D 00CS010<0@0h?oT20S 408 SR 0S W04 0_ R 0SW@T00W080040 (0 0S@@(KP&t&|&&&&L&|&x% -0L!S@`∶MPP p 0*EpP 0!S0P X 0LLL D00S 4 ,0fL<x%"9&Q& -` tpL@PT 0ST U_P@ !$ ܤ&Ix%V -L MpP0` 00 R +@ĐĠ00U0S P! 0U R x R  0 40 P40P@`000S @@(K&|&t&P& -p0L!SP`@͵ᒤP` 嵨 0o P!0!StP 在 0XXVXX P00S @,KT d<x%h&Q -@L M`,R00CS00 zU !aY8q00 0014p T P0 4000 J 00  BR Ql10 I 00CS0(10z0 S0 1  Z @` 000 0 0 $p @0s0S e £ 0`00t0 ` V `0 T0 <0 (K%&\&&Ix%y|&t&&l& -LM<0 P0 SP`UP@E%P 002` U Ur   ~P> 00CS0 20  X0 z 0 C00LS@E0P   R R L~PU!) Uq80 4 AP4 80 o *,00C0B  BR d! p 40 D1040S @EP 100 C00S@EpU/@ U0000<0pP+  00C0Sl00u v0p0CS0400gi00P(Kl&t&&|&\&Ix%y -@LP`p P@`U4  0@T]@ 0@^S00\P0S\Z*0@800P 44P 00i@ 趚A% %OĚ -LMT @0D K㹎P 1[S( 0C01[S 0C0 K|&ht@A% d0d 0-ST0P 00PPL$00R7 d&`&&|&F -LMPpP@* `X 0T@T@@DT 0 PP 00S 0 ^0 0 ᆄP@0S (K&t&|&͚ -PPLp |0|0Sӻ`@ 0 PP P@T  PF|&& T0-0L008 ,0aA!R   %֚&& @0-0L00 $0a@ KhY %&֚ -L Mr삟`R R  3`` @-T %T  T $T` T+T |'Tq 9T0T>*.TQ /TW ?TT ^T ;Tzi  R ,# 0 0  "@q 0 0 "Q^T-T b  @ ^T-T  QL# 0 0(!@r "RQ  .T 'Q /DoP( T  Q 00GPQ  l ;T00000T 0P0V Z0 Z Ѱ(K&%l&Fd&&|& 0-Pp0@0`娀L00(P 000000 ,R;R 0S0S0 0;S0P 00pd&&&`&l&p@- 0 P@@ RS@@ aVQ B0\ p&& 0-LP@P 尤, (k$m  000Ix%y Q-L 0Q\SAo 0- LR,  @0`S! P<pP qPP @P o0 S@/R/    *p0 A|&|& ,0-LQ  @|& 80- LR$ @ȫ|&& -騁paL M10SPZ x1P00S S d!0`00MP0SG00 SeP0.S0 S 0 @00 000PP  BR '00 Y W ~ xpP 00S T0 00CS0400 (Kl&&p&\&%|&X& -L M 0`R`FppRVQ0 0@00 ?<00p 1 F 2P00CS0 P T  #P 410 > 3 T` pp` p  T000`00b0@|0@x00S  \0 00CS040 (K&|&`&|&&p&X& -L MpdAda\1@0TSPPTPU@d0gpp 0d@0P @00 T<@T2:   O PP 4 W4   pP  BR   0 ^  l0 00CS00u00@00 (K`&&&|&X& - Q 0L0@0[P` 00CS020 !+ gPpH0TC@00S  0@h@@d`0pX0 0@0CS0$0|&|&p&&X& -LM2p0S 0 B`P00VD b0P   Rh1 R ,80 4 P4 80J  00CS0v0 o    BR   0`PtA0 `S#000`1U<0`P j $ ǝ 0 `0CS000 0  #P`%0P0pGp0P00CS0p00  sP  `0 00CS0 (K|&|&Ix%ydK&X& - QLpX`0C4000p@P堡 []00CS0$ D00CS@00 \R pR  p `\ 0 C|&Ix%y -LM0pE00 0S 0S Tg0K|DePp` 00$PS0 S< 0P ( P@ 00CS0B40 : 0$P0CS(0l40! (0d P%S $0Z$$0( 000\Q0 0 P 0 S !SW#0SE(#U, 080 P80 $00(0CS0D30 $$3 U  U  (<0 P 0$0CS(0200( 000S "$0|r Z( Z ( 8 eP8 唠8 4O0Q00CS00T 0$0CS(00KM0(0P` S7*,0qSu ,a$00 P(0 0Pj P0<  (80  P80 $00(0CS00 0 BR0   p004ܐĀ`U0 U00<0`P 0`0CS0P00 (L 0P  !@o(K|& l&Ix%yh&&%& ,0-LQ  @|& \00-0LS@ 0!S 8UP /PP 00|&lQ  -LMa00 S2 10Q @p@T R 00 R KP\0!S 8P \A pDL 0 S8W0A,qPW+0|000RP傟 =?00CS00  &0,q0CS00000P 0 0 S 0     bP 0Kl&%9h&J|&Ix%y -?/L0@P @T@ C`hV $QV EV !V =V: VHV  PV GVcVA WV aV / VVeVg M:fV gVqV lVL jV do.nV [:pV uV sV wV :xV  zV.  cpQ@00nQlQ@@n@P7 0nQ pQ lQ@@@0DN`(P@-0nQ pQ lQ@@@0- R -4!R| - R< X000@ `P @,0nQ pQ lQ@@@0D- R000@ P 0!S@|,  0nP pP lP@@@0|@T4 <PG@oGFoP㨂VVP + 0nQ pQ lQ@@@0@000&;0S 0nQ pQ lQ@@@0;0Sr 0nQ pQ lQ@@@00S@* [pQ@00nQlQ@@:OPF 0nQ pQ lQ~@@@0 Pp @)0n\ p\ l\x@@@0 : P 0nQ pQ lQi09PyP90S `V90VZ@@X@T(0nQ pQ lQ?@@@08P 0nQ pQ lQ408P  0nP pP lP#   0@80S' 0nQ pQ lQ070SL'0nQ pQ lQ0000@| 70S7 7 3`Pk @&0nQ pQ lQ8@@@0gp0匆 9R0R* R(@3pR rR gR @@@00%/ o~<@p$0"SX6<*@1@0@1 T    630  ]Q\ Q ]S -LM☑@`P0 SS [S \S PP X0 SH@KPP0`f( V1 q V0,00<0 @P-Ϙ 劔00CS0(0@ ,@ r0(0CS,A000,A  T0 0PS 0(Kol&V&&Ix%y|&t& -0!L0 PH P10!@R =0P S0i@P `0P 00So PP0Zx tppX0p\00 DP0P D0 0z00q0l&͙&&Ix%y&' -LM(#(S00 %Q0Q @ 000SQ2 Q= \Q@A 0004@ Sxr^000`2< Tl`@2`80 P80< 00 F 壓00  B RY0`0CS010 = P%A$4@p0 S0p10Sdqda4 4P4 0`00?00P S@T.` T000<0\P北 GI00C0S00 00CS0T00L 0@  (Kl&&&&Ix%y|&p&\&%& -@p@0@L Y0P`@ P) 0 R0 Y000@ 1BQP Px@p 0"S 8PgR0000l&& -LM@<0 d4dT`4 0 @0 @0P$0 0cS@t0&SQ00080 0080 c R8 0d4 6 R# D P㬃D 8ږ 啒  B R |30 5 {00CS0830  R@ 0\SN01 CRI< 00CSE0 0"2  c80 R8 0`d4 |) R`"D NP4bD  |, (7$9  B 00CS010  Z@ 0 `1 圡T( Tl0``00PX FT PL00C021!0`0CS010eg ` 0 @``̀T'P T000<0` P p ͑|00C0S60`0CS0H0024 0 (K&&&& &Ix%y|& -LM  2 @" 0P2  40S 0 0 $2 00?KtP `P2B#20 (2 2S4 "`RU "0  Y" 6 Y 04 3(KA%m4\ߡ00CS0 s0 / -LPMDPp k000㸄$t000 0000SZ@@4Ux$x4P  l$kPL0H$73p 44Q 9U0$03 #kkP0 0,0#3p 3Q  U0#0x3 p#JkP 0`#2T#030S@3PRlPb 20#2 qp 0: S 2 v20k0 0 S\ KlP S0 00 00 QP0S00000!S   R RgR 1 a pQW10R SNXXPX~K 0C 0b>K 0C0@6BK0<60 86 @{U B>K 0C 9| BK @rBK AfUr(K4F% %w'(w'' w'.h'D'A%UН'OU -LM|B|0xRS0000`b0ST20S 0S <2 P;U @P00S3 M,L##00 3/P0  1S 0 1#*0U`00S T),@DTD A?d,,(K$F%E%&4F%(w'&" -LMq@0P`0,K@(F80 80S PPPPUVPd21PT 0@@10S8% 4+P0@0$03/0P& 0 R T 80 3/P 'P00S++@ A`0 0L Q < L80 2/P80 D  0(K(w'&M4F%sw'&h' -LAM`/@P)pA^K PEp)P /0P0 Vd0d +T0o"/0P0 0PP0 +Kw'&$00CS0 y0 / -L,M0C80 0PpW aPJ P0,03/P3000@0 ]t3K0Sd1!PL[P <P (PP 080 30SW '#P$ Pb4 CSR cP8 S7">+ Fh `P 8K& g v0/SP V 8KS 10S 8&P0S S100$Km 1 !x000@03/`P8KT : 0S TQ0S <19008K '04 KD083/8KP 0S 젟0S 0`U!KP00CP0PPPGU  xb l00S "0403/d(K(w''T'w'''ĝ''w''h'X'h'x' 0-D@LⰭP( *020& 0-Lcp@ K0h n*0 0-L@cps0 ^*K0hԫ 0-LMPcpa0S  S SS NS TK@cp 0: S I@K0 -LMRPgA0H03/P0 03/P\`phQPI 0AS0, K@0a43/P(1C"K(5P2)P%P)jP$0/SP A0 00C06@ x )P0 CP0(03/ 8a{ K(w'w'X'w'w' %%h' -LMP\tE0H03/P0 03/P P\85 K0S (53bP %)50S P>P 0AS0 K@0a3/P4C,KP P  p4 C\HPT40S KDbP 8d0S,40S KbP0S4 R 3(KR0 3'KR00S3(KcPP mU F0/SP 4c0S(30S KSbP0S 20S 2(KR0 2'KR02(Kb0S S20`0-KDT l2 4S P P20Sa@20S P^4S S# 0CSKG  0Sq GX G0S7 a0S3 100-|0S4cpP P1$a  F Fp0 K@03/0SC 0S `0S 000Z0C,K4S 0S D00(03/ p` (K(w'@'0F%''w'X''w'''''|'d'T'''L'8F%h' -bL@WPP T T 0 '0H03/P10 03/Pa0S0 pW PPh0S\10S P1P L1nu @1 K  P]?K ?]K PkP:8 T$#=]K!QP*0(WK^PR:8 <$ G?K KQP 0*(t#[?K_K R0 d!R MP0(K\'aq&B% -@L,PUP&`p{P ڈ00P(00$0 ? \00S0,0 P(0 P0 v'B%&'(w'' 0 -LM"K0TTA($``l?P 0P`p0( 1Pş 04#K 0. e1!p, K^P*"K`VpK`pЀ 0 V0$0(`P0{P00 P 00(`V(p$Kv'p'' -鄐pP` LV$0(aPSPPfUP@@(  `d(pv' -LM=Ё0pQ` 0 AK ]PD@TLH 0!3#L0 Q 0@ 0 X0/$0(`PPA?X0KD0 0K (^P0010S(0  S    R 0(0XW R =P0 X0 |0 0SPW0 0 j4 R q"(K qv'ĝ' -L M1`P0qP P0U" 0P X1!P1U00$0SPe@PTE0@P ?U @1 $  00 00(0U2Pc ( -P ? 0`` @ 0(000Q <Q  0 nP0 D V$ Pc 00 (Kx''HB%v'&(w'' @00-<@0(LP0$P `0(PK0hi&v'B% -退`PpLU$0(`PT0UPU@@(0 0(0`Pdv'B% -鐐`p LV0$0(`P`0.P_V0@@P( `V(pv'B% -LMM=`ApB WK``10S WK [P:80!!(T0$0( bP1P@DZ6?T ( YP&(0@T_(0 j(K ^[Pj8h ! GK(KQP j(D#!@ j8 (K\'av'B%z -LMPKZP\0@T@ K [bWV *KQP  @ K耝'د 0-LMPK@ZP&00S!0: SYP#ZPU 40H ZP40哾)0$ !K0耝''" 0-LM@ K+K 0 S '1 PR 00SK@ZP0S'Kt,Kᓨ 00S &Kd+Kቨ 0t KYP 0NS 0<  0SKYp K0DF%@F%3O -L@P`ZP  7YP $00  謝'z 0-!L@$YP0$00 K0h ꬝' -LM@0p/SP /㟉`P/ 0K0YP/00  p/00 0S  YP KYP[0 Kdq/00Pu KYPPPZYUP$Kȝ' -PLP 00/S 0APG 00AQ $Kk^XJP00  +`0S 밐p0 lkFP𫝨0S Pl0e4` PT@$<YPv' 'D'"', -LM`PK@pYP9$10S B+KQP *KQP T20: S P XP^YPW 0x  PXPW@0$ { K耝'=[l -LM:(4P: S =!R `V0000K @0KXp 0: S $0 KtK膱: P/  0 e -LM`Q[ZDT@WP70H!"@1P @$<a10SP((tS|(t쀟PWW00a00S00S 0 00! "4S `cWP`0@ X0( 40 K赱ȝ'`'v'DF%@F%ر' -KMLMZt#W30`@ (p40CSN$%%%%%%3P&30S" KAW0P4 4: SBK<# AVp 0(#Z) H,0K4[BNK4@ @D Z<zz= sWV    V P kY Y  PD20S 00" E|@$<P20S @$<z ?o2P0S((4QR0(44匡S<X1@P6 WP!KAYWP 08!e 0Q4Y0S4(4 +0 0S0S00S 0 + 0S00S 4m0C?o2 000! "(KН'+'JD',ȝ'`'DF%p@F%/ -p`@LM0 Vi 0S0 0000VPP0e00`e0S 0S :R0 00Q WC@?@ pP0: 0 1 w w"؀ؠԀԠ0P aP0 40 T400000  U W 08 B@00c(K舲ԝ'''؝' p-RL M`P @0@ P020@  8LUP(0 KphKp農v' 0-LM@PPcU00<00S  = J"K0x' -j@ML,MpQRT U [# ;K,0C K@0 UP =K0C0 P=!YXJ(KAVPJ8 :K,0C->C#QP J(hJP0P P0ȤJ8 (Kղa  -'g0d Kxg4 CR+ \S+L g O"ṷ KT'I]oz  -L\M@="TKp:hK(280T KhKK艴 0-LM@PppP Q 0 KK!!K0P:R" 00 S 00 C R20C Q A CR27Ca CR/2WC/00 CR10C Q//@-Pp@`UVUQ/0C0\R! \0W  @NΌ! 0 S:0CΌ 0SC$*0G-\:R900 S00 Cr ZRB ^ ^$ACz Rrb ~ 0aCz0S 0 000Cs R !. !  ^Ѝ0@- 0C0\ R#P@U T0@W@L@  Ό!B 0 S:0CΌ 0SC$*00 800-@LT@@  0H' -P8q`0LP VA-PP@@@@TQ S Kh;Kh9>:TP0 ` 0:SH 0V000 ((,f?@@l.v'H%ʹx%/ p-L M K`'1 @PPQP9 0V6 kR bR mR wR$ $P 0 0 @P$ 0*S xS S   !R0Kp 0P-L 0SƁpP$ Y@ @ @R 00T0 0S ,^P=Y`P HX@,P 0P :w' -LLcx%Q$0 -RrL 4F% <@-L0( ,cx%ص\V p-L M K@`P0l #300 0  R R0 0  P@P (0  PE [00Kpw' -pLx_5@hؽ`PSp` Y /000  ` -LtM/@?P0_0PO P ` P/?倠 删 0 @?@|/ cp? zP`PFPKAPKDFPKPKPKPKPKFPKF`FpFxFPKPKPKPKFPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKFFPKPK F(FPK0F8FPKPKPKPKPKPKPKPKPKAHEPKPKPKPKhEtEEPKPKPKPKFEPKPKAtEPKEPKEPKFPKPKPKPKPKPKPKCCPKCCPK4DPK@DHDTD`DPKhDDDDD EDE E,EPK@EN?d=P Xڀl>0>X>0 -R(-Q0 000 Y =, < =<=0S _P <  < << 0S < 0,0,0h,t t<_)\=P$ @ P9$1PE/ L1E * T1D %l |1/!C0t1PC1-PB  1B  1A  1A  1P "  22 "2 0$"0B 08<"<2` ? Q P00?  0"0S R0 pbSR00u? QB PP00o?  00! _Pa0d0?o0cs  C_|00CS0 p`,0 &PH00S(!(1 0S3VVVVTVA0Y* P 00000Y;I 0uP@ o]2P0000 S X0 (Kn G 0.+x%b%dE%(w'H%O'B%0P  /w' h0-LPT0T0 P 44e_,0,Pw'(w'vx%Н'+ -` PL @*R" R X?R [R, R0S/0S08!PP PS>\ PS70*S0 S 0PS 0 PS$\  !^@@]P P p-W p]WW \\ @\ !NoT^Q ꈝ' 0-L@ /TN@@` P0D0\\$A$*0C0SS$a%*0/ p-ML M1PKP,K`P K P <[S.SL[T|Kl`.K] T @KKpН'I|ν lQ׽(O -cML Mc=K(0CKK34@DK`p.^KV  000c=K0C @Pc=K0Cc-K0 B00 ;RS@ՄȄX 0cK$A0cK; A 0c=K 0C0T:hXPHcKA00Q &Q \Q01CP cK A c-K$ B 00CR/c-K B2 &S\ScKA  @c=K0CP  R0`Sc-K B  dScK ,L0#-c=K,0C0@c=K0C 1 h ,c=Kc-K 0C B0 0bP;T6 0S3 0jX-`c0S 0T:00;T0  R S 0 %JKS,@D8TS   'c=K(0C0+0 8TS 88]0 ( ](Kw'z x%; -MLMPP R`$\S``0S?R00`0S1 \S`, R)TyP 5ᔌhu#@P p qNP B.K; BCB.K0 B ] `p P.SS GS0000SPS pS sS gS0000J0 0@< 0P@@@@ K׾!oJw' -`PLp 0Spc@P\P`P80 PP p@ @@ @荿w' 0-PL0L@T 0 U(P \@0w'ϿIx% `1- LRPP jDTPK 4PUD P8\)QQ"xP 0S/  00 0S/  0P0ᢷ @0/S000 0D 0T 0 RHPP  04w''' 0-j40L@PTp 00S 00S0 00/S 垳Pt0D0S@TL0o0 eP04w''' 2-0LS@P! 0`.S0.S0S/S 8P0 R0 fR S.R S.R0S/Sq 10S10S( >_ QP:$0BRSR    AP P:4 CSR 0! (aPU: 0/S0S.00 pͶ ۦ00C0U00 PU C 0C0T T0A0 B!"00 00 C0@00C2#DSd00 0@0 C0T2#10C0 0@0 C0T00C2# 0 0@0 C0T00C2#0 00 C000C2#0Tp`% -ALpPW : V00S; - P  PQ @PP!@TQ CT Q BT@T0S,w'= -@PL= PU: `0SP, #U \U0#S@]P@  2  6@G]lᴶ`pQU 0 T 0StP0$ ,w'=.a -@PL= PU: `0S8P, #U \U0#S@z[P@    @_[lh`pQU 0 T 0S(P0$ ,w'= -PL 0SH/PP000 P`V 0F P,VY B00#.V00S  i0@Pc U 0S00`PE R MR CR cR mR000000(h :>0S P 000Y 0S  P H 0  `V00 l6 0T 0P @ @@ @,$ #;_,w' 0-LZ`pP 噵P WVU Y@P@ 0 01`0A @w'=; 0-@@L0S 0$P 0@w' Z -LMl1pX9 Z4S7 8Z4 k##K44IAT1 80 !KQP"QP 0@80 T @P ttP " #K! 10 A  h  4 S0 0400CS008 0(K@w'  0-@LT:8$R𫝘4 CSR𫝘 clX!WV@"UT Q$Kk@w' \0-0LS`C'<@PUTpPW@w' 0-@L0S%WP @| |0 S0`P00T0p@i08 T D@0@w'G''HF% 0-@@L 0S 0$P  0@w' 0-@@L0S 0$P 0@w'=4 -L P -LM2@0Sz kЂKKЃYX KK yPP  Q+ YXW #KcKp`#KSRZO  `PP= #KSR00 00S P/ 0 " 00 p0` >P#K0 QP 3P a0 P 0 K0$K` b#  46 ,3  "$K#(K@w'd 0-@@L0S 0$ZP 0@w'= -LMl`0S Pp0@TD0PU ! pD(@T K@w' -LM` #K!#K0@T, gPQ !WV SR (0%0P@0  r@0P K!Ka( 1@(Ko(K@w'=  -0L@`Tp *AT !YX( SR (@00  @w'=/ -LM`0P0pS 0/S AK APP c(@P  tZT Kh%rP 000 0 0$` @ Kw'?V@w' -LMP`@pT& 000S$0S 0Sp00S ! fD00S @K@w'`'DF%@F%000\0L$*00  - R 0R40: -MLM0A Rp1\p`.P0\  *RJK$@D0PC ?R*K$ B0PC0@ಀ A@TJK$@D0pC0K$N N0*K$ B0  C0/S :K40C KoSKP :K40C KdSKP:K40C\ PKXSKP:K40C4 $KMSK K%  0- L + -L@Q`e\ 1e #Khr pP   _00S  /`w'|0-@^\Q4PP`w'ܝ'  Q0-LP0S   pPd 0s L00 @0T000)LF% -p夀L@P" P+P 0 xp0d l `\P  BR0 8004F%`w'`Lz -`LM@P೉("Ꮂ:0Z840K0CS1!`60 !01 -  d (l <t @ |} =-0B0C2Q0 1Q $ 8$($)KAPaKQ  vԀ B` $($ *($5Q/P $($)($ 8$ Ёp(xP`(B /R00C0$K$'؝' 'ԝ' -LEMZ@0@S#Њ<$$$030S J(J( J(J(Pt9PQ_KX9p KHS9p *KQP)KQPK0o;0 000/' -Li LJ?x% -Li LJx% -P0@ |p L aV  `P'U00CS000S$Kk)'@'' -0PL2 R0'a@' -LPp@T% `IP PPPp`00000?=;@@DT@ 00PU Pp@P'' 0-LL9P aP0,@00S 0000Q' -`LPp0002@2 w`2 S 0 0`000@0C S000 S$Kk'' -LP`f@T ǨPV 0@ -LP P-L`@PqP1P@aD1AT 0S (N=P00CS00 N 0 @P'U,=gP"P |N@PUtNP00CS00 M 0 00O H%H%@' -LM 3 S`@sß 0⎀Ḁ (Kᕥ2(00 `2 2 "00pd1댒 凣0p`+Rt !Rg R8 R 6 R000/ R- .(R( %R[ &RJ &)Rh *R- =R! /RK -RR :RW <R, ^RP >R ?R%R |R ~R$L "I@`0=S= >S?000|S04  =R 8.0<S0 =S,0$0&S0 0=S0   +R  -Rt&#0 00 0 0$K%'(''')Gk 0-L Y' p-L M0P0`0Q0`~0@S PPx@ l0R@8 K ᩤ@P00S 00S $Kp'̪'$G%! 0-LN \ THp0<Ь$Ĭ4 , QP@@|   ^Z0V01#00P0? t0? t0P0R0 0R0 P0SR  SR  0 !00 -L`p@PX\/ \# \. \F41p "\ $\3 \= Z@tPp`0p#S,J(0Xp "  :|0 50 0 D0 '0  1#'' -p`LMP80 @#K0 4K̐@ 0DS&00S^^ PU @ 0  0DSL0`@0T8 pQUU (K''4 -L Mp`H0 @BTp0@P@P0SX0 @00 TQ@@Pt@ K'' -L`d0@0PSL0p 000 0'' -L Mp`될@0P%Se000 0&S P1XH0 S00 S00 0 (K'.' -L0M0@ p$K9T`0@P S0 DK+WP@V DP@ 0 F4P@4 P@8KG 8KDNK'| -PLMp0Kf/`pLMdP 0IS 0NS @ AdP@@d@L0L@PP0`Sp $0KN/K'''< P-LA8P@5 !qQ 0 ` R  BR ԥ å0/ 0 @@ T B Rå `0/ `0R @å/ @`.@@0P@ 0$J0袑G%G%'̪' p@ -P 0/SSS00' -`LL.P}P v.H0Kh..늧0"S@ V%L'X p-LMM0` R" ך@P 0/SS_Kp4p K 4p +KQP *KQP7. 0KpF%o' 00S/' -L"X(c 0S*SP QC000000000CS020S Q  TM 2$KkMM$KkO᪢-p2d2dR0`r00@/S 0 R 00CS00X0ĥ@.0X@00S/S0@D00P  T%P)0000t/S0S P /00CS0ĥ~.@z.0X@00S 00CS00X0@0T /00CS0ĥ@_.@P̀U00V.000P0@  P P 00i- PL DL00CS0 00S$KkJ''''lo'G%'G%lQ 0-PL0@00u2P 00CS000S ) 00CS0X00S T @060S40Q (`I000''$G%'I -LM42`04P$0@TrM@P4Y$ qPU ፄ`P ᢡP ១,P a{0` ᐡY@ 0-S0SL1@T41@` 41R@0.S00.S000/SS00 $MP ,Kl2P K< PP0: SV 0.S0/S0Sὢ;P$K0$G%'s''' -L=,0Q   KhK Kh'o 0-L@LN30Ps@000S iLT0@ xK lKYH`@00CS00 G 0 0 m'''lo H% -@P@PLUpB00CS00 G 048P@`p 0P``pp@P葟0Si @TQ \T  R: @eT' aT 0T \T. +bT cTZ &rT @% fT @! nT @ tT @ vT @ @0@ @@  0BPA0@D@S\@00CS00 aG 0@00S 00CS00 MG 0 Wl @&G0 H%{rZ -@`0 LSP 0S SG0 Ra GU  ~GT GT Ip `Gd@00CS00 F 0  KhFH%'!$H%3pH% (0-0LS t' ' @40-,Q0L00 8H'' -LM|0@x0T   $K@$@ @ @ @ ;/D00S 8060S 㕔K'''$G% --LM 0 R    4' --L M  0p-L4' --L M0@0 ѣ < -L@P`ģ / @--L M  " @-L --LM00 塣  K 0-P@L╣ K0h --LM  K  0L -LP P   FD'0/' -L@x/PPPP .p` .`P .p` .` 0-PLMP \06 F -P0@T BH@G,0 @0 K0$G%'d' -LM`P0@S',<0pᛟ0c:&kG{{'zfk[`[ B06S00S \ޚ ኞ 0P0S@0P.S K N@('R 0 0 0 0 0/','0'(' 0-LM@PKT! P 00CS  000 P 0 a1@K0 0-LM@PU"PP0K _p [)P  PP0KD_p 8 0  00K0('F%F% -LM@P 0S0S 1P 00 0 KW Kd' -LMp0S0dA0`00!PDU: 0(0 0S ,KPV{-+   ^'P00CS00S V=(0S,^-(= VT-(,`Q-P0P`SP$00CS000S $K''W4' -pPLPc V0S V0S 0S`TlTD(d 0V0S3 V0S20S2@T V0S2@T20S T0S 0S `2\2K1DLD@T  4@@({DC >v=0Sa 0S^ 11(1eDcDR FKgV0SEh1@TA\1XY@9 P R3/ ,)  @0@"= 0?o2040 R   @@$@1D|C@t00S B 0S(00S@@T 0B$G%'4''̪'h$H%|xH%' p-@LM0KP (d0 ,T@T`:P0 S V0S0K(C0K(Kp̪'G%$G% P-L>P@5 pP 0 ` R  BR ԥ å0`( 0 @@ T B Rå `0N( `0R @åE( @`o'@40 0 0G%G%'$'4' -qP`@L000y0V0S+0S 0S 00CS000S 00CS0 d0 0d S0S S N0`S00C00`'0'$G% '4' -L,Mpb@KV0P S1HPKD'䁟@DP T  Rh@D 嬁@AHP  UㄑW 0S/ 1|1/BlB B00CS00 B 0= C100CS00 wB 0 WB  FP0VP R R  BR R`  BR P  B @K&(K$G%4''H%0''̪'$H% ' -@L$M@K`& 0HK D 0ؐc@T* 0pS$PU 00H0kP 0㈐删 RVPU0 SP0 0xU0 @P@00 @K0&(K̪''$G%4' -paGoL@t0媢S 0S h1d1.8BT6BPU  <7>P0+B$A$Q000 R$P00CS000S W<W !000CS0|00S W0S0S00,0.A4A,KoiA$G%'̪'h$H%''4' -L$M`8KP%00000 0?o 2VpQ0S1@@K000TP  #P00S |@)<l:00<)@0 000CS0(00S c8K% K$G%'W' -LgM@> 0A 0x1 > 0SK1 >! 0^1 >@%>@1 > >Kl1 1@0T S 00 0=S0 K(0@l1^@1 tZ?Kd1 1@T -0  0d!1 0p1  =R ZK@S!0 ! %p1 S!  00|1 <=60S 0=0S1S10|1 Ř1!10c1 <0S1St V?K DR~   P[ 0 8'4'OU -LM @P`RI 1$K0p00( ;pWZU x; .Q d;Q T;L;&Q <;,;U $Q000GKr00CS000S `;0K;;~ 0@S 00CS00 ; 0* 00CS00 ;H0 0 $Kd'$<EpN''X^b H% 0-PH@LP 0S%S0PP @0 0-P@@LP 0R<P0@00- H0H1S Q QP 0 RF%@' 0-pP` 唀 L @@P 0S0SS0W00@P|U00CS0$Kk/'F%@' -`P@0p0L0 Q Q:RR:QppR %Ru`"PPP0V:S@0004@ ?P0SuPd''F% 0-`@ 儀 L pPU 0Sp000Gᛵ`|V00CS000S$KkF'@'' 0-P`SL R"T0AqT kPp@PPTPU |P0000 @0 0 P00CS0$00S 0p@'''<' 0-P,@LP 0P0@00 0-D@L000400 $00CS00K0hX'<' -LMP/`@0 SP @@@ K#P00š00S ޖ0S ږ00300P@ SuP @^P R R R   HQ R 0#"  " /R0  WpPZ0 R"000  KpPi 2Q 0S/R x P 2pP dP2T P0SvK#P g R c R _ * R31 R -1@`9 P R  |@%Dh1 @ RؠK R ؠK $ Z 4 1 @ 039)0 @ RؠK R ؠK p  BR | R Z 0  000(Kd'F%8'G%'H%<' -PLM@p`d#0P$ b0CSllllllllllllll`p@PY 000@1 p` Y@0 儡& "|1 Z 0STVXW S000  @ @ Y6T@0@0 Y,  P 0StLlV 00S=XW 0 08K IU 3[s  P eG9(K'd'@'F% -x@L0`000PS SD000 00 00000CS0Khh' 0-LMl@ 0P0002KP0>01KgD K 00CS000S K0'$G%' -LyP 0SD -LM`@Pp"P pP vP@ VPP0cS    $p  RcS# T7袟`VP< T 7V0 PU 0RᤑPl7 PP T7`H~7`00S ,R00CS00 7 0 X P` #K 0 0 8KT#[RF\l|/^PPXd!0` <  <K@ N`VZT!ZT7@Q7 PTG7T~p8T T T 7mT7peTtH000(K'I1?O H%d'UaY\r -L$MbR@Kp0졟c0@T' TT*/T! :T TTT:T @KY R    BR @å0H bH0@,AZ  W0000S :`PA7P` `i7@KVp& X" W 0 S00CS00 ~ )00~0000CS00 å00 (KG%ؠ''$G%+ -LAL0PS81 pR$a1P 000U00CS000S  U0) 0QR0U 0Rppt`00P 000(000CS0000S  U𫝨PĠ'Ƞ''' p-L M0@!SP 1=*S@S``00P3 Q0C/ P- R (00C S%͒ ` K@ƒ0S 00S=ST`00 P0 T 0AD1U 0  0S 0SKpG%'ħ' -h@L0pS`P  R R`00` PĠ'Ƞ' -LM<3pc( pXV' 00"""p4''F%\C0'$G%' -0LSP`p@0000V 7Np 0V'`` l0S J Ao PQ`00CS0 00SKh'!' 0-@h0 P L P @00CS0000S0K0h'' -LTM@p` 0 %ԐY `Y   0\`s   P@_oSRPUP P `Q 00SЀ 0Yp0 J0X434 0bC1$0,!W+  |  !"W -  "lK%"lK%lK~P l0K"0 % ~P rl0Kz40"$0 lK`"%)l0KL"%#S R"$r00?S " P l0K  lK!m%0 l0K}l0KP@ e l0K}PlK% 00CS0$0P U $P p0S& 00CS0$0 00CS0$0 | p00Csp0   %P0㓉(ЀH00CS0$0Ѐ p8_$000S@(KJ<<' #F%:DIQZ%_ix -L MPP` 0%SN = P   @\0S0%S S+S -S 1 I10sX |!| ## >@`1XJ0S 0S0?S0  00 _P00 T:@ PpT0# P  0QJ R R" P 0R `0R@02# RV9 (KF%~<' -$QL 0Sap0_0@S00cC1  0$А0X!&$ꔀ00CS00 # 0 $0 R  0 S<'' #x H% -L00@`Pp0T l#@00CS 000V#0 0S 0 00袑' H% <00-@LT $P0@@d0<' -QL0pS P`VJ0S @00@00S<ZaP0009>@8 x 0 R! P00s@0 2$00SA0Q0C  S0 00S  R@P0000000h000W@00CS0 00S <''t'4' -@S`!LPp@!T\1@WV% L1F0S! U 0S0P P V 1,p$ }V!!U 0S PP | P llW H060S ZWTT $0 蔥'4'$G%F%g.<'0< F R Q  R  P f$G% -LMppB0 Kp`{0S0S P,2, P @8 <0 08#TD*0S? 0 02"@  @ S&*|! V~] Lo ^ \ PSP~ Lo ^ \ 0Q R00S R0 @U 04<S 00S  06 R  U R P |0)00<0< 00CS0 H00S  P (K''<''$G%H%' -L Mp0 J@FP1F0St AP U @ p~\# -P`@ V! R R RZ R X R   0`@X(K$G%F%<' -PL[ P lPPPx0x@60t`S0@P0S 0p 0 0 S{d$G%' H% -lALh, dq0S00 SNS@8Q8a0P`0"S* R Q 0p- 00 S0C0@ p@ 0P0T0S Dt@@60S0000P OP 0Sup@<''$G% -L`r PhA0000SU0S 41!p}w"!0S 1!00cC1  S  02#0@oP#pP  S P R#pP xRS00 ~n0S00CS0000S j'F% <' #' p1-LQ`0@SHz@ P`0U ! P Q00CS00  0 d!P`p0U p 0UD}! |APpP000C0@0CS0<00S <'px H%F%'' -L 00 Khꢑ' 0-@L K0h~ꢑ 0-|@L 0SP0 R\ PU40 00 0000<'G- 0 p"0l2P `r```^ ^"0N0P0@S SG =ST $Sh 'Sf "SS \SF^S< S"0!\ $0!Y0! S@$0SS1 .:SV /@0 O@   R  @000C S R@1 0 0 0#!S0,"0 ,11  }0$)0 !,"0 Q 0a1 }S` :0 P 0  0b\0 ^0 R0 Sq00PЍ(','F%%+3(!"B p-LM@DcT 0S0Scdc\d\dDdccddddde4f4fdeteecee|eee,f,fcc R@|tPU 0S LP 0S ~ | v@ 0S  cW u0tPU l` h0 SLLP@440. $Q  Q Q Q Q P0R 0K 0K00CS 0S 0K 0K @3{Kp,'9HMRUYuB\`hp 5u|hE<?BE!x 0-@PLT U0JU 0S A@0 -x0`t `6LPP@F@T@@Hp@0S. @D0   0 ('$G%,' -P0L0@S`p R 0F0S P 0S0WX0HPT  000P000V0 蔥'$G%F% -LP`p*p@ P 0 KhzX @00CS0@00S }E$0 '' -0PLM0 0Q00Sy 쁟@K1a 100 000 0T KpPK@]0SV  0 Q S/R ;iCKP 0%K%KP000 R00S6 Qq  aP:PY 00Sp p Y p r ,p00CS00  0 %K @`(K8'8''@''''G%G%H% -LMPA`8K&Pp<10S 6V@oP 1Nn0V0 0P1U00V0S'V0S$P60S .0S P P VXl 0P0C?o208K8K"P P!8K K$G%'H%$H%G%H' -@L000PPf00CS000S bU𨝸|P@T` `@V0`0T @D0 s0S V  0 T00Kh''$G% 0-t@L00P0P*00CS0 ,P(00S "EK0h'.' 0-L@P5PT@<04' -LP( -L⏕P 0-L@t-0 -@0PUL~Up~p`0000  00p0CS0000S 000PePG%'' P-L (g 00`00(G%40  0 000 00  /G%'' 0-@P  | |`L h0R 00ɖ   @0 00CS0$00SKhp''G%'' -@ p`00c?oW20SPkPLP# `00000P0 000 PS W%0 00CS0L00S$Kk4F p0PPG%'''' 0   `/G% -TPL@ H`P T @D@00d0C0G%' -,P,`0@L@d00d0G%'(`0 `00 00a0/G%' -@L$MxS8@ t0P pS0@80 T3p0SDT jP ?P3C0 `P#<0 0@  -KD0 PD07- [R \R8Q -K8PD0(- [ R V B`R - [ å0o- [0  R <H0 D 3PH0 D  3PD H06;PiPP@СT  J0  @C@ 0Z:0<80 3P80  X3oVPJPA ,UP V U U$ PQ `AQ å0w - [0 rY  000 w@ 0 ^VPZAQ å0- [0 (K褧'3'7<'G%G%' -LM|pPlR0`00@00CS0<20S ,20PUGYA  r0P00Kw $0K0 CP@x $0K0 CP$0KP0  0Er0,0K0w$ K B0x$ K B0$ K0  Cr0p(0Kw $0K0 Cpx $0K0 C p$0K0 C0K(0K, K= 91 000 000Cs R0S#000%pP 5%@ᩔ00CS0T00S ZW  zv 0w3$K耋'''r% -LMf@P`<P SP` aPP HP@`lr0S 0TpP20X% U0S ,(UsP|  0 /Q9QʒLS%0A ?Q ) @1#BP+U' @Pq0S[ 4K CKBK0 Wd2 UTT-  ?0@ 0,P!p@P4Kopu*X0 BKSCK4KP"u}SCKBK1 UTp ?0 0LH@Q$KH';\ p2 BR0S0/00/@0S  R // -L M0 0 0@00C SX Ko 0TS 0S0 apWV tKШ000C S0S//Q0@-H000 ^  @P ^@B\$G% 0-@L6=FK0ho$G% -pPL@R]Q5 `8@q1S 0 S@T`A00CS00  0 @paq Q 0 p1R  d/@TP`(q0 R !R(  @T`@00CS00  0 Q qP @@mTP@@`Q qPKhZ`V0 8$G%3B H%3 0-L8P Kh60S 0 $G% 0-0LS@P@D0P K0h蚒 -@`L1S`Ap@DPU K @P0`0 P謧' -PPa p1L  0SJ -\ \B -\0SB @+\@ 1 cP00S U& PoP0S U0 R U U\0\\U@0PPU0S,Kox訧''L'$G% P- B00`0QL 0Sq |00S10S0060圁S pWfP fP6p6 `1R R6 F D1R6 F  010QSCS RC 1qPQ0S 0`00000S 0S R t  R00 h0   8P ^  P$Kkꨧ'$G%'ħ''-' P-L PP@0UڤPp`0e 0 XJ0S \0_Q0C R 0 0CS0$00S ;'L'' P0- L0K0h\@000D00S 00CS000S 0''' -0L00C S 5P 0 謧' -LMp0S` RQ R @0?P0fC10@`g0-S0\ -Q R P@U T0:S 8K7@K8PK)@ p?P9:Q  :R&0S0Z`:V 8K8PK7KP@   @ Z00 @ @00fC10``0`| 8K,8Kd8PKP@ 8K 7PK0 PPZ(Kbi$H%}! -PLMH9DP  Q(0 000C= K'' 0-0LS R R00-S@0T -Q R  Q \l :\:P0S8 0 R$ 0 0蠧''' -`@L`0<0SuPD 00CS0P0P <00C<0G%'  0-RL0@T Џ0  B 0 0-@L0S @0 0-@L0SP0hg0P0 0#T"  0 -Lk $ $4 <  b G%D0 S S S  0 S //-00 00 0S 00//) -0 0L4DG% -`R`L@PP  0-S0S0 0V  -LMbp04 8 00 p@0S |"|2x"Pt<0 40S T@t0S5 T ^ P  T3S100010  p P  ^  R P@ k@  hr P   @T!00CS00@ť>v0@:$80S\T  BR @ťPeP@H P@   BR ťPWP@    BR @ťPIP@ T000'p@zo"p@j< @d),00@00c(KF%dG%G%'G% -L@M0P0` R@k P0h h d01 0\ "LKLKd,V0< U$0, 1 0vLKG%d -P@LM8K[0D 0P0Pk`p@WwpPT @T@倌P@DP @0 hP8KC KG%G%P' 0-x0L0 0S d0P@U U L0UH0@0<0P ,0P00G%'2''F% 0-L Kh' 0-@PL00CS00 ӥ\PZ P \ 000P00<  P< ?  FK0hB0''F%G%š -LM01 H58 0IK0D! @1 0(1 (50<1 500c41 ?P (1S (噍8 40 XpUPc>P0 |P00.&P00(U<P_ >P &P000p00 ,,0 p 9-P 0,0  000P(pC0 0 0 $ 0p4 0(K+0 0C00$00i?(P(Py 44A  B"!  B "0pM 0 K} {XA0`0 0Ap *#P)}P! ß尐 yY }PH    2Ȣ0  AQǥpp0#0H PAQǥpp|Y 0@ Q 0Apl$=0AQ0ǥ0 00Y%X :X #X p Np|+'P 0@X p pIo}XrpWX0C#!1S p0IS0@p0 pYpX C Y#@LڠR0S0 \00B#000B"1:  B 00  0@#! p *G%F%G%G%',*-+''hu)(%P' -`L00S pp0PU0 p 0S 00   B/o"`k0@0p$0 00 @0S   $20  $0 0G%, -4RL0@T @ 0S {0@ 0q< 聟4 䑟00CS00 `ӥI`&V* V vV V X V #V S;V, (V6 )V0@4 I\V3 |V D Pp0@000  C&P0@ @0:|P0@ @01&P0 @ ;P0 @ @0@0@p P  0 0P400 0 p  $KkG%F%''- -aL0 pb0P R: R UUP U)00S%@P  0RfP@jDAPP @0SؽP @-e /0 pU00 0G% -AL0`(P P 0S(00 ,@R   RPP  Q   00000S@ R0@0CS 0Kh G% -Lh0 000G% -@LMQ$PK⌁p0 0pK@%S Ppa 0@  $ 400P0 R(@@pR( #U 0X/P"P0 8 `/%pP 00 0< 0b0$08pR00Sh0@( 0 0 0 400$KG%F% -LM hW,`K0 00& P0(00`) 000P񟗠``````ȶ`l op@p P -PW pP0 R     P1  100@S 0 00nPfP ` P0,u0 RP 000@0 0J P$00 R $eP4pK< P 0  $ 400p00400000CS00@400 0004    BR    0 P Pp pYW } 00 @40< 0b 0 P n00T30  $ 40000P p0 SdP 000肟 0 0SM x0p0S00l  4 48 $  P80  0 Q 4008 0 P 0@S8 10  P 0 00  w00010" $0@00P0- aP 41@pppPpWQP0 00S 0000@)00S @000 0 P0(00`t 0000000S T 0S 0@000(KG%G%$G%  -P`@0L P0SU wP 000@P  0 p@@@Pp 00@ U000 00G%$G% -L@P P PP` jPP0 000G% -L M pA`P00  PX+H10S I BQ  U#P,V: P  R1wPp R  4 #4 U  W 4l``   000    (KG%d 0-LP@ P ,0``@2P P 000~00S G%0 -L_M1x 0t 1 1 0@ UK|1 eh1EK01 0p1 A6P+<1E/K%@WSU4200S - 0 md i@0@bd  T  IPQd` \ T $K'$G%  $'4'qH P-LP@ x T d`n f -Pp@\`LT Q00C0W PM@@\' -`@``0P0L00000CS000SKh豿' '' -`P0L@T VPPPU@ ' t00- L R @0D T  DP@;> P 00H%\' -PL0@ S `PT c0S0 Syc0S  \' 0-PL @9P00  0' L00-@LP  R p0K0h'00S  R/' -L@PP Q0" up`U 'c T$fpU c 00O -LP`pp@W 0 0VppP0S    0@ V  T V@ 0S @\ PVT$P  80$Kk H%BTD`8yvdK 0-PPL00 @Q p@ 0  / p@  p@ p@ p@,冾P003/@0\' -LMPp 0 0S8K" '*070K0@0 60002` `Uw 2@ T@00CS 0T  P`Bb 9@0SM PH0儑000 Sq pp#$b R R R ` _Pb0 0P0CS000S  P  C 0 00CS0|00S ŽT` 8K000 P70[S< <0 60[S( ,0 (K '''\''8H% H%H%  -@ 3LM 3`Ps< 4@ 0@ "< p psP vP T @0T80 `c1 PV/垽0+S -S4K0pK d60K4pKP*]0HQ- S: @0 bYP@0  000 VQ <08 PUg pP00S \PZ0TQ0 B@0ST< 4P0p0      r 80 rp80&a  P% 5S ^pa tY0  V00 (Kh.H%l.Lv Q`'v -PQL@pS 00CSQPa10SN R 00CS0|0 p01@00<S0S>S0S  0a@00CS R 00CS0H0 - 8|`!kQ 0-@LDQT800SK0hU 0  0000'd'' 0P-L  C>R, P  %!'# -LM2P1S@ @T@@10S( YT%U U U U U 16 R! R@T@@ t16@h1F@T@@@@LpEQ< KV+p <0S!FQ6 R 8EUQQ0T T0 T0 T0~Pp` Y@T 0>W<0 80 40 00 _002$ K1 pwp <K$K''$G%'' -PL MP@M`\P#@T??T T00CS00 A 0 @@T$\P T@` tP 000}T $00CS030S K@@TP2\P@pPEU@ ppv\PVPEU@RW @P0c1ST(N@n TD@P@UT <@Pr1bS 0ST.@N Td$@P@UT D@1QS 0S D,1@@ToWqPm`0-S0S`U 0㰁00 "] PP%  hP1P  4 P P@U4 h1 `000 Y7 YP /P?UW䐟 PqB V  `P |Ua E00CS0H00S l0`(K( H%pdKx'''\rnf.s8CL%H% -@p`@PLP 0S 0V00|` T D`@00CS0$00S (PU@''' -40P@ L BR`@NV00' -lPL0 0@SH0 `< <@`Pp 5 7|pd'''4'@0P R //d' 0-<@LL0PS0LP0d' -LM Kd.P `0C/K CKY.P ,0/K $0P R '' X0-LP^'@P0 e?T00 d00-`P  PL @ {00000CS0000S0K0hr'H%' -p@PL`U PP`Up` Vew]0S 0-QL@0 Q0P0 aP1Ա01ı00 000 1-sL@0000101* RP 000 0000CS0t00S sPP `00 0 00f000C0T''' 0-@PL0S 00CS00  U 00T0K0hH%0H%0H% -L M@K;P{K --L M  K --LM0  KH% -0p-P LM 0 , @`0K2K4 QK,00CS,0 0KS00 0 P1[0@0DKp -L@'`P$ 0S! xU0S00CS0/0 "  h00CS0 0 " 0S pW PpP 00CS00p ' P'YF 'Y0 0CS00 U 0CS00 00CS00 \ 00CS00W P PU LPP 00CS00 U 00CS00 ' 00T$KkH%0MH% 0-@LwK0hsH% -P`pL p@[0S  0-0 L0R,0`P0=00=@ @hiT pppG0S=S0@0C@0 S0ץ0ťPb0P0S@ťZ@ $KkUG%'G% -L M0 8@80 00b00 0 0 K贞'̪'0 -LApT  @ R0'SO`QU  0S 0S   3/00 `P@'TP0' 0-0LS@K0haHTPVUt'DPPTK0hM'S@IP@0S d?0@ p$' -LM4B0pS 00`P!110 S Z   0Q U 80 4 4 801P0`'V`1 @Pa@DPUK:W 4Y  Q 0  1/P00=P AQ00 G00S00 0 x0 0LX000CS00 ) 0 (K贞'0'` H% @0P=P/S=P/ -P`L0S=SPRPhP'tWX0VqpAT 0U 4PVpp@0' -LM1`0@S @ K$KPPP   `@x T P  `LKh2x,q0000S    3/0`x0S0 , R  a0c000@L0H0U U0 M00CS0`00S YL 0P 0$0 P K$G%.'''' 0-p LP=PP 0\@e  妵W` =U`l0` @0STUZ=? 0W0 `$KkH)A -LFMd0 0CK1 0  $! 1 )P01 ,0C/K $!0! K' 0-h@L0`wwL L0P0`00 $0P K0h'Y`=#g l0-P`@ L U P00CS000SKh'' 0-LMP@T KP 0 @q00000 00P@ K<P ,00  K0P'k' -PpL`@T 0   v0v@ 0@00`PUKh0' 0-LU@P  0S   3/ @@0 0000 -`@0LPU p"P =P #`P 0T  R   2/ 00 0' -@0P`rUPPLp=P pP xP nP3V0p0@@U@T'`U`V!@PV 4100SW100S@W00 S00 W@p0 Z! = -P   P 0V0 @0U00 V  2r'o -LM` Kp@P@30  R@, PR000 00S 0000   u 0 u@@DT@ 00S K''' -`pL@T, P0U0 P uH0 R R   0 02/0 u00 0000u贩'G%$G% -`PLEP fP eP`PvPP xP`P0P@H0ppGP X a@U T@v' P-L KhP 5 l{ -L M⸁p000P0`-S @TQ tO@ F (K@P=!P   8(0 @0 00)0 00 P 00000 00=S   PPPt0T 00=S \0  B P0@ `00CS0,00S K'G%$G%'''' 0-@PLT z@0 0-LP@d垲NP@TtPxP@ IP@,P0 P W0'00c/ 00S0`/ p-L M`kV0 0 K#R@PbV0S0 [V0"S0 TQP\ 0@0 0 00V0S @Kp%&7 -LMM@QKP KPKA?K SRd0SP0K -LMM@QKP KPA?K&KQPd0SP0K 0-LMQOKPP KP*KQP)KQPK0 -L@PP13@ 0PC `(VA 'Ppp`PJ! 0RAs -LM0-S0S" 0S0 0x00S`0 00TS40 004,R(0P KF 0P-L@0PP 0S0P `V P 0S0)S 0S%P00S P0'0؞' 0-LX`P@0 R   0$P0C0  000؞' -"PLM@$0.P %PT0  &P 0@  &P PP0Sv Rs P T T TsGo TKP} P*}Pv@DTK$4D|T`pK  P  P  P  P  P  P $KR0*@K@T0TB 0S 0S 0P0 0@TN`pV0pn00CSc LpXQZTQNPQKKQPD`pWV9`pWV.`pP0`pP0`pV0  B00K؞'Ip` 0-LdP@0 R   d0#P0C0   [PT00؞' 0-@LPPPPE|PP l岯U`P008g?o 2Q P 億00>zr؞'| -L Mp P {`eFP 4 K:Pc[VP`P`@P .P% GP OU 00V@~P UT00@\0 Xq@P@@ <@hhU b(Kzht@dK$p -L⥯0LH% -LM$0$0 00 @;'H% -L M K@M 00S0 aPpWV FKШ7 -`L MP<VG@F0-So0-SN S; NlS sS, I0S@FPPT.2 000& @P@@T,p P h`X2)0S`@V`( OPP! BPP0Vc0S p`3PP 1 000 oPP Fp @DT PlOP@T J0%S`P.$ۮ: 0KL000S0 `PqWV ?SP0   s000 P00 ᷮ0 QP `{p`卮UUo@T F뢑%QI H%k!nfp 0-L@M0   0@@DPU =%P "  0@TKTK x8 pp4 hh0`0P\ T(, LL$ (@ K0''.!4LH%<3=#g9^ 0-L0@0S0x 0t 0l0l 0   PU D@D D0 < <0P 0oP0 ' '''ȧ'G%8H%H% H%$H%H% 0-@L$p0@f `0 \0@X0PU@C@@0, PB0SK0h4'G%4'$G%'P/ 0-@PLT 000@0 -@PDaLT0   SD   $$XXXXXLLXXdd @Kh L00  L00 @ 0\0/ -@PL`g 0P  SYHp0000 V00,  0 000 00 <   0 0 0000 0-LM@P 0$0 0$K 0 0$T 0P 0 $0K00 rK0 -LMP` @KU 00000p]P@P KP000/ P/00S 0/lnP/in 000/' 0P00/'0 0T'kH% -LM@PbTp`@` 7T0T-*"TY 'TW TM\TR aT@O FrT @K fT @G nT @D eT:@@vT @= xT! tT1 @7Rj 0` \@-0 KS#0K0  $K" K $@K!0K兪$0K 00cp@`0$PKS$0K0   K# K "0Kqp@ e`R$9 0 @K' -LM@P`qP@ \P@; 0cR  0< 05 0R@ "! "7Q $0A^@MR 0-S@5/^S0 ^R@0?S0 KD@[5/K%' -Lp K@@T@ӫ@8P`D ;j0`00@0' -Pp帀LP0@ TP  T`  P000CS00  0@00CS00  0P' H% 0- LR@ Q@<O"P0 v 0 0OU' p-L Mh 0@T 00PN P Kቩ` VQKp' p-L Mx 0PU 00 'R"R@@ N @ K:I`@ Kp' --0L,MlWl'@` 0pT70@cT!f1L0 0D0 0L0P@U \U 8K^6@00CS00 *6 08 [ %U %R@ 600CS00 `6 0PxH0PD*S`[`0p.S 0*RpLp@@ھ0Z@0 孪_@0@ 0dZP0 00 GZ BZ EZ 2bZy XZoZ gZiZ %uZ xZ sZ tTP -lIgP T& \^0\I \  \" \ \b9  \ \v3 "\0  \ \e* '\' \\% a"f nrt M pp\?0 \-@0ǕDžs0@0Ni`H XP kp\XpP k LH\ppgPp\ xGM0 0s0@ v0 t p0 0 t 0  ۖp lBX0H P0PxD0 R0 0v tc0 }]tvVm v t  gG 0bBt 0[;hq0Q 'R"R000:@ M08KF@08  H 8 v t  0+St+S &#e@0P [@ d0   0ML0D Q RD  T20K(K 'H% H%&-%8'dpF\I -LM0$PK\ %p` 0 D4@P 0 (,@PA 0 pW( PuY <YIPP0' 0ES4K P m Ð400S00H lm^YPH0?S0 -S00H0,$K lP 0-LM0@0 0 XPTPQ 0D0 G PPۻ K0h:l -LM`0 :EP0 $ 0$K 0)00( K[pcW1IP(0000S^  E@PY 0SV = P|iW lW@IP(0 0 (Q+$ IP(00 IP( K#(0$0oWHP(00 HP( K(0(00S PQHP00CS( KH0( 0 0S$KlҒ0K00M00P0D0 0C0D080;800,0/(08 S<0,00<00,8 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@( R 8 ", 8 <  < D ,-D  , /yH -0ML0$ 0d8 K 0-@L4@0000 0-@L460000 -L M(0@S000  K0,0K`t -L@[`P ij8j<j@jGPD[`, 8BP]UjUj\j`0,0蓫 0-@L480,00 0-@L48p0,00&q 8-Lx Kh> (00-SL@ K0hC8W@0<<@00,00 -LM K "wP. Kt  -LhPnt  -L[Pot  p-LM0`@K0P-S00(0(0@0 @  0| 0P 0( RT  0 0S40(kj03/Kp &' -Pp`@LQ lGP 000  ``-VPpQ XGP 0-V0 00 00- PL@0@P ,0T 80$P< D0TP$ <0<P0$( 0-(@L0PS 00P0Ъ' Q-0L$  BR Mp 0-\   S^00?0 S0^@0000 !ت'Ъ' -l@LP`U PYEHP80 0Ъ'OUps -LM`p@8P3U  , $ TP<  XP PW |PU 6 PjT 8 T8T t8 TT8T 48}T 8tT 7kT 7bT@ 7@YT  7 PT  t7 GT00?5{S 00 6T0'S.TZ 6Z%TY 6YTX 6XTW 6W PT <@‐p RS DR0 T0S TZ 6ZTY 5YT<S <STX 5XT;S ;SplT:S :SHDTW 05WT0S 0ST 4T 4T 4{P8T0pPS X S`\hTXLHaTW 44WXTU U NTU 3UETU 3U<PT;SS.< S S  S  Sp hd`3 T*9vXRS R0 T0STZ 2ZTY 2YTX 2XTW |2WTU \2UT`@0@S 0@07 0R 05 -LMP8@8 0S 00 08?x%A^ 0-P@LQ BP `0   @ P   0K0h @  x''M -L MT8PL0 Kp@DE0"S Kf'v -L MT8PL0 Kȟp@&E0"S K' 0-LMpP@ R`} ;040H0P p ,x  i K0'' -@L M0` \K PRL2L!T#DB( <(>, 0:0 $68 24 .84 <0R! $!4S !4S !4S l!4S Pt!P0S x4X!T0S `aPp `8W60S. e0  0 0VS S13   VR0"00S  0V"P  0 4Pp`uP S Ki4f %03LaBB (-Q@L ,QtHe0Q` 4QPLK 0CD4 z D0P L$ H4 PH4L$pbGqr Yp0: 0 0 P  bp@4SD$ b@42 >P@ (DtW@4x00S D P@40 P@40 lP@40@4  D b@8 >P,pDYW 0SWS 0 00 iP@4\0 b@ pD   P @4xS S:Ƒ0tb0:D4pS<4KC>K 0C D4 e>P DH D ]>P D,ް$ S> P00D0$P@4S +H0  ?> P 00D0P@4L0  /> P 00D0P@4X0 ` > P 00D0P@4P0 $ > P 00D0P@4T0 u =P  =P 0 00DP@4\0 _ =P  60D0P@46 NX = P 50D0P@46 > = P 50D0P@46x . = P \50D0P@46h  = P 00D0yP@4p0X h = P00D0iP@4t0H D4 $ papGw0S0S 40W: vaW0 na K@xq 2$D$4RH4  K@lq3DH$ Z(P4  ˰YX D 8Ja@X40S 4T4 0\4 T4 RL$ ' d4 ;  QPd4 LnPd4T$P4 a2B! L;D 0S  ᓰ0D4 0S/D4 -T4 \40S\4  7X4D  430000@4  0\$00 P X`@@4S ``0@4 P4@$2 P4r0 Se S S) SESC S S K@pP4H$pD4S T P|  K@pD4@ SJ 0< K@pD4 S> K@pD4H$Sq5 P]  K@pD4@ S+ < K@pD4 S K@wpD4H$S P?  K@lpD$1@ R ;2 K@_pD4H$S)@'Tp(K'[5U _\*/'''('  + 7; I V Z e o |     '% &  -P0LaV|pPU X@P0\$`!!0U<0 )``pU]U 09 00-0LS Kh>00pH% !-1LSP@ 1SOP KhNP1S EP P𨝨-1d`S1S1S @P 0P''JedA rdA  p-1AL M 000P :f1 S`3 1S Pt>0S p>0S0 0 1S  KtPxt0tP1S P PaP@n KpWEV'fd md pH%Z'gd  0-@ LP f/6K0h' 0 9pH%ج'md0S 0 0:/ -0-PL M NP P 0S S@@ bP@K0% 0-8@LQ  $ @Y`K0hxH% -MLM|@|0AKQp p @P4[SS CS cS sS 0009Kܬ'67 -MLM`@`0AKQT T @P 4[nS yS0 00Kܬ'#J 0-LM@AK\@PpP4[0YS JP (@PK0Yi{ 0 ' % -LMM@AK0 (@EPAK AK: 0-P,@L %0 K0h %''W -LYM M@Z.K BhEp\p5< S AK@@ P4[0YSp5<0KrdA -LM0*gj zzgzz'&z'z{zgzzz {  K5 -LM@` $QQ_ (Kl6(0TW TQ+ GQ& Q CQ GMQ SQ KQAkQ cQ gQ 8sQ tQ mQ2 Qzg{{' Q1{/{-{+{    zg{k Q0P0@S 8 0  80 0``8p 0!$ $K@ܬ' H0`  BR` pRp RiX Xp/% % -L M@PSV`P @]pW 7T@p @0 @xHPE8p000 F00W  1x40  U4070S00 40 40 p(Ko7Z ^ % -@MLMfpႅ&0BKS0!@po P! BK@9PP PU BKAPP BK@ӋPBKA\\PBK0 @@pB PBK Ag UB>K0CPCBK(@p- P BK @P BKA(48B>K0CPCBK( @p P BK h@P BKAX(4(0B>K0CPCBK, 4@kp P BK @P BKAy(4,0B>K0CPCBK0 @Qp P BK @P BKA_(400B>K0CPCBK8 t@7p P BK 0@P BKA8E(480B>K0CPCBK4 @p P BK @mP BKA+(440B>K0CPCBK< @p P BK `@SP BKAX(4<0B>K0CPCBK$L@pw P BK @9P BKA(44B>K0CPCBK$@p] P BK @P BKA(44B>K0CPCBK$@pC P BK (@P BKAP(44B>K0CPCBKP ,@p) P BK @P BKA(4P0B>K0CPCBKT @p P BK X@P BKA(4T0$K`' %rI Q5Xx'Fi )He -ML M@X@ ؃KL @@p  P8T `V 5 K @02P0S K@, A3/ P+<[S,<[`S,\[`P8a`EVrp08ġ0K L 0S 0TS0K1` @ @p P K$ @'7P`0 K @D< PD< 0R"0SK AP< +8[S%,8[`S"R,8[`P2a0C" 20< S:KH ABKx% AB.KK B  @pex5K0 AP0X0<0PK AxBK|% AB.KK B @pB P" <0x%K b A00 QPK AH 0R0x5< 0R 0K  A|K  @P 0 000S 0`pP(V R s  R 00 p0 0`PK APO(KxH%I.?Y' %ܬ'00CS0 Sp0 S 0 p/ -PL@ R1!z0 u0 pX0 ߓX0 ٓX0 lӓ` ( TS, HO0 <K8 0G4 $C< ?$ ;$7$3$/P +T '圓p0 3R`V*\ pXP pWp兓Kh)j ).7I\q+7 -LM─@Y`pR S: 8 R7 ,Z4  5  5  5 40l"@K8  4,  y5  t5 40"@lKl0K0a 0K00 0a  R1!`  0 S& S S S" 10| S S S 0L0v ,n !f8Q0 4 ]<0P+85Q* 08@z4 @E0<0P+84Q *P嫒 ɒ(K;DR`hm*j -PL`p(H@劒@8T 0@Kh (0/p/ 00-L  R( R((,,004488<<DDPPT TXPl@XTl PTd @ R0 ~  0' 0-L@q40Pqf//080WEV 0P -PL WPT P KhWEV' <00-0LS@ Cf/]/080'* RP0// -LD0 <!44喑0@ R 0 (x%_I%Q0@?o 2P0p-SL M`P @3P  3P0 3P0 3P0 0 V`3P 08 0 D@ K@2p0 (Kp譺LwX'udOU p-L MQ Kp@  0  K 0 E 0`P   < 0   5 0  h. 0  P' 0  8 Kp'td@z(L{ p-LTM@( `PDK5l Kp  ( DK5V V l Kl DK-D KPp <Z0l K(Kp'}d(@<~d(  -@1L(M 1`pP !p eP qP @p0VP4P 0P  4P 0` (4 K$dp ,(0Q 000V4RPP QTW T0 , R|0|0v,0T *00* *L  i@P$Kh.H%'|d"\x<M -MLMP @Lc2P=JK}=K,@D,0C?}=mK?,`F T*K Bp h _FW !!FK,A !K$A r:K$0C :K,0C (PpG?/0??SP 2P 0C<p (t2@PR=K,0CCp> :K,0C/* R "E }-K, B/}-O/OO=K*K,0C,0C, B0:K,0C `pH2 l:K,0C` (G@ @`FV (NP(p%:K,0C/?SsPP 0\ ` 0PxLB0ap  PTA 8w`*K B400܀;0*K4$ B0!R0(00:K$0C ?,0 QP0 屹 R,  P}$:K`$0C Kp,0$A @(K9M'wdxd dx%t1Jdy % -PLM@ R0K ,P P0K +P ,v4 K /0p0`S 30"S0 VQPV03 K 0P0S 3 0"RslAHP `P K\eKL p0 <<K0 K1I'ydOUc 0-PLM@ lP Khcp T0K KK0 80K00K$K #KK0'zd@} 0-PLMP 0@ K,9pdvK0'd@ 0-PLM@ PX}0P Hx0P 00 K"(pdK0蠏'wd -PL M@ P 0DU0P 00 ,0 K(pdeK'vd -PLM@ X K +P 0(0 K$ϿpdK'{dЀ -LMp`@圐RQ 0P @ pah@\0P; p 4Z03/$Kk(I% 'p -LM (0  'x% -0L$MPQ`pD0 @0 <0 80 40 00 WDPKG DK*D@K ap0 LP4  Op 00Z:U㤠@X 4R{Y 400 0@00TPU,jP4P(KD ,{  0-@PLPE ކ1P" 1P( 1P4q0 P0P 0P& 0K0h4K0h{~@+K0hDPU@d{"P 0ᝆ8 4s;tcidyaraloobPrbmngnts pp  x%L0P0@-@ 0@@!14!8!<@P0P'p@-8Q…a@Vp`?    `?  P   ̀  P  @PP\ @04? 0P#3p'T0 R !R "R3S/////' -L MPt0rb. @d0 .<00 S@`@L?@? (K' ?00-@@L204 20,P0200P20'> 0R// -pLR0  `,Pe - ` T%X@d 20CV20CT0 ,Ko''' p-L MP`1 K F0@S 00S00"S1Ds@Kp -L M$@,00 0 0 ;뢑'x% -LMp0|6`?!0@ fP 0 0(0 QP   R0$Kkܻ0L ׻0P  `F@,) $KI%E*' -`p00LPPp@pߵ!14X S P "  S R 0(Q&V[*U'y* -QLM0P@/K`p؀pP᫵)\ K(0 2 P \ / !SR Kp0PL02S 0S "`  $ K*&**'* 0-<@L0PS.N( /0 10P'' -L\M#K#0X0 30CP T0 X0S8 2b0 0KdK$K3P$KK+Kv #K ?`pn  ?:+dK$KK3+dK#K $K*+&KP#KP ! R"dP0P 8 0 R00 $R0 S t2000#1-R0J 0K8I+0P4(P00 S`: 9Pf 5(;%1  ?$K @ 2#|" 0*|"  0 D12 2X 2XP0P 0P֟000 0 S *02T 4< X000P 00S 0  0&<8   l9P  X9P (KV3+'I%+N+'%R5%n+q+++ -L MHRp`TK0P0  W4 00 V04 00X@DD h ${, y.U0 X 1U0134sO8@348<0#1##<1;D0s/@s Q "`b`a &)$aڑ&!&l)()a!ݑ0 00     0 4  0<     0@000(KP'+' -p-L M@  勧M00CS0{P0 Ph` Pp 00CS0Di0 p$ Y@oKp%+R -LMA|P?!`0ep K0 %0 QP%  R(Koꀐ "0P#K%0 QP PE,_& 0P (KI%+' -L M0|00  0pP 2S0 KX|PLK 0CC>>0 00R0C06 U B { Xy  Su0 PUP 0S 0S TPe 9  Z_T 00 9 "[8="[<@004 00004 0QP 0 bK H,$ P7[O  5KFP 4 ` 0R  `eVPX`V9 p0G` 0 &#;;`h)XX$ $ R,0T T0,0T0 R,`BD0P21Y0Y 0L0L0 S x s&a `\`\\0ZX 0h00l0dp(KEO_OOOOOOPPvRRaArrAa)P@P`PPPPP Q4QmQ -MMLP@00 P0`400 0QP &AK+ Aw Pp<0P#$42K3"K#(#<12K@02"K#$02K/"K#(#<."K-2K0 00 00 0QP 4 AK A; PKO)P -L ML @0 S !0!0% Rl00l0 rp00p0R P0R030# r0S P rL00<0L 0 ,bP00K*QQ -LMXp0 P5P0  0 7'0j0 0WV L 9 X0  ڦX 0P(KQ R -@L,M80 p@l@00K`P PPRz5PL 09 500 LR08S6\3̌ P\`p @P \ \ \\ \F Ÿ P\p\ \ \\\ @' 0Ÿ P p    P@@ L0!S s @0PPp0PP0PPH1L R0 r 4 8 <2 0 0P@ pP0W:% 42 0 @:#: 0 0 P0 R@* 00 P@ 0880 808 0(KR^R tV0V`2@>唑 e`F1S(100 RRR0(1h1| 1 C 3 5P(  (1`0(1=t 5 c h! |!0c0d!1PL h1!SP=|1 5S D=D-DD '  S 4:I@(P(10(1(1 0I0@0@|! |1  0Sk0 @!  ?ox!2r0p!Sl10p,x l1 0Px1 l1 pp1 h1l1 0x!QS UpWl1p1  Pp Ph1p1 1S11 ' 0C1 0!#, K01"  0! - P 0!&P 0! \!;R: Ul1pp1 0pP0 4R \ Uph1p1 0pPHK/VK0 VK<  0S 0, Kbr \0S:\ 0L![R L!K UW00 U PpqlqU XP 0 00p00d!`tu@ R., K  B 0,K !A !A 0!A !AVK0p  Q C@ W 0 3 s0Ps0x!R Ul1pp1 0pP 04`!80 L r ,(080  0W4 8 <40 V?K,g 0(00x1 0UX T1 5 W  l1h1VK! 1 NP h1! 01 0p1d!0`0t@0W h!lR8 0Y07 5 SY I40S80WEWiWWlQWWWWX`"a  `^ @P Sw P@`-P@Tj^PeV0 KASR000 PTU00`> KAPH( 0#P>.K B@4Ps0S4Ὶ`K0!@ K @⛚@P#Y K@PP^K PE E PP (P `-X% P@(P V-U Tယ(K9[A[ FO[F F@0/p/ 0-PL@ 9 $(0$( XS X  \  ` ddhhllpptt0 0-@LP 888DD8@@8HH8LLPPTTX}X\z`\`0p Qp` P0@ S 0 00-@L"!S ]00 0-@LP88880 -@P AL0@=S->Cp8->C3X0X\-\*9>_89>:>CZ8?n:>CFU8?>CC>M8}C>GH8mFD8EnF@8E~G<80XJ.X R  $$((,S>,8}S>G8mF8HHLLPPTTXX\\ -PL@  $$((,0,0 P`0V\%1R L5sP 0Аp|WY0,DmTiT`XeX\a\`^`d[dhXhplTlpQptNtxKx70Z B`?<p0p$%S30l0\%R0` S#0P5P @R TU 0/ ;P r0B@p/ p-MLM@R0 ANK4 @D8 PK0C a0ZH8 pkZ@ tfZ< S(6P 0y0 ZE F  0m1#< 8  0_1#.  ppY>K0C >K0C \CKO9>K0C@Y`P `P5P n.K B  0 P 4Y ! . ( !R'  $ 88 ;;>K 0C 00 8Z >K0C  ₑ''@400ȄЁ>K0C >K0C(  ((300hh(؀ 0KA >K0C K 0 A H30P 8 X080 Z8% @L0  >K0Cp0StԢؒ Ke00 >K 0Ca0Sd KWzm20 0 0 S* TF@" 00 0$20SЁ؀8 >K 0CP X00 8S  850@%0L  >K0C%0S( CK)10S R^5P 0 0 0 L1"]K0 PE0 $? <8@(; p<0A>K0C  Q 8!100PPTP!8( 0(00`Ph@h08 >K 0Cy7 40 (K'(((I%(_ (<_H_( -L`pP@7P0S 70S @!WVP P70S @7P0S!WVP -Lp`@ba0 0@$Kk -ML MH@Q '#0b2PE ? 00 ş 0  1#dR 04`JP0T  "R,20S#  $P2pXW01pP0 0"RP0^00PထUQ  PB~K pG 0S@10S%4[&$[&4K%$K@p03/P/ 10S 00S0S%4[&$[&4K%$K 00h 44  44p 04*070S 0 0 /P"R0(KO_((((P((h(( -@P`pLAM' 㕧@ 0BK6UTp0 UTd@3P <0  P4B.K,^'BK Z'KX(# [_zh_ -LM0 K -LXMpP`7@X tKF0,0KT0fKp0 &KD00P RpVR( tQtK$ K'(QC-P@P@SR`QP#WV\CX( -L$MP p)f QPK 0Ԓ 0B4 b$? 0 9 " Aq `24Z08 <@  K0@S (04 0S= <0 r80004  S* < 0 0 0G#KSR 5 0 x@50S 50S KA /#KcKPp P$pK550K050S K}5 vv5000B ipf40(K(((I%( -P@LKGM M A K@ X 3C:4 $5 Ru#&0GKS Ie 0S0 0  000SpTlOdU2P =K 0C 0 =K 0C5000( 0w5H0@4 0<4K44 0Sp4 48 StK4 A   N%0S | L000 0 H5 L 2P5HP $0000S! oOIK A SR @pBI>K 0CX 0 0S 㗥0  0P3 0\C8h  P4 8i%41P6 ` L000X0ؒ H    00<4K24 G>K 0C`h4 K@`400.DbY40S X.%pP2p|H2B>K 0C0 0g0pH0HBK J W  0X0  g  0Q#000 S0pP$N400C04 S= Xq  4$ 0001 0p pp3000 Y 0$0 K AQP 0 ,00S Ƥp(K# [q_ (({__0(I%[__(___``(X(4`dKlQ\`s` -LMP`@pYp1P@U x10S l10S 00 06 PP4$KkS[@PIU? SR1H w  0 PY$` e 埤0S 00S U S9$0S N0S epP$Kk\0P L0 U$Kp( ((`0(I%# [`````(0/ 0-XP@0L8n5 0 0 00 2@00 00(00S/p/P( 00S/P( 00S/L.P(P000 R0-SL$M@P2P0`BPP0Ȣ0K80R C `pS Q 0C0 0 0\`p ?#K_42\P 0 ?!' ?#K 0T0 ԄK>1P 0 ?!' ?R 0^10SX 1< P 0 ?!'K0 H  0᳣,1\%<R 0 ?!, ?  0ឣ. "R )\# PKR 0cK`Rp ?K 0\  0v00 0@00 0n(K (((`T a%aEa^a QP-L`p1 QP 0" WP3Qx ?WPJ:|1\%R ?" _B1!P00@_?5#LP?##@P ?x ?` L0P0S   0 610x_0 1#\00SD0@0x ? սѽX(a((T(( -L$M0 @CK@P@KQPCKUTt"p3 #KK#KSR:T3H3@D3\%PR ? b1!pKᐽ  ? ,.0 ,`p K?zx ?u` 0d t2K?Q`2`2``X2X24#K ?DRD $K`K/,20Sl 2@T* p40@ chp ZD3sW PL|DY,DDV,DR,X040 J,40S40c,1T0T(uH10SK 0C0L(t`S<(8K!"< N80 8( !=K0C>KP 0C  ?0Q3P0`S 30Sp W凑Q*p0 0D3-S 0 3R<20t0V14" t Z+" R por   ppW"KP8 奟K.Pp"P8p P" R p 02-Yt10S  10 0 P L8SH83/!=K0C L,F 000TH0D(0C?o@2 R0S7 H1H CK .CK0S,+Pp'D0P0S `!=K0C  P0X T!=K0C  P0LH 0 000>K!K 0CA  P0!KA 0p00p(K0((((wHb(ibbb(( -RMLM0 S000#4@Y `pb : S  PxT0(?V0\4<V 000R00SQ Y !0 h0S Y RnK `F,FRnK `F F0`0 尓B ?@ < 8 S>K 0C SK R0 A R~K 0 pG0S08%  L T  080 00HS S>K0C10 0<%@50bS.K B1$P)85SX20"0CK -CK`*P#R0S00 li8H00aYX 03/p` V`80 00SH 00`Pß0<5 0<%SS>K0C 1C0 51CdP )< 0a4 AX000H R00S) 0 CK F-CKJ*P0@S P P xG X0  0t 7#bp<5X0S<5 (K((L((((ibbb @-@Lp!WP`#R 0# D { 0-@@LPU DP P 0 QP00X(0@0@-A SR#R 0#0000 0-P@ L0彝UT0 1 UT0Q@寝0P0S 0Spa뼡P0SpW嘝J哝00S x勝0SH 0X傝0S(94K0hvbX(b((7b (!bb -LMp@`WP 1  P  0p`W 0S FD)P 0pK `RpH0`S 0 0 P0L /X00SLL, +00Khx# [  (bb(@(((( 0-P@MLl @  +0AS _____000 AK0b c -L,M45D @ 00K 0#K`U+0S7K+0`S #K 0#K KQP:4K QP! 0P ?᧷4倁pK0H0 0 @0 ?ᛷ@L SR':@00 S 0SPn`PK@0!0B 0S!702:0S H0K30 `PL+`3#0S\Q   0Ÿ0 0n*L0P0 0 S030 S S f0S 3S 0S *0 00KS0\P _?P%0 " 00C 0 RL3`Rr00C0*@2, 2p0S PD0 Pz W W  Wj0000000108P00A*K 1@Y" ,00J [0X04KFK10T P ,P(& [ud4K%4w00 T Pq gh| @P@h080SGvp<00(K(X((( cT(`(P(U Jch(((@(( -L|MR2@ K?j\%2R 0 ?!`ph 匢 ? l)0 `2吠 0XS0 S S 0 d$2 R #R @X K10 (K'K`pWpW8 tW4 Xd  K< K Rpp, vK)00<0[S K 0 0 408 u- `RpT`3 K 0R0\ 嵟? 0 " 00 0 @PL3@0@00*x0*0S eP P~)0 P(K((T(`(P(U mc(((@(h(( -L$M#K2@Pe뀂UpP`j 00U<0 00 Y  K0H0 iK$K R0K  P0`pH0U AC `90 (Z0R<0 #K V0#KcK#KR0#K R0#K80< 7#bXp$KU2 A 0 (@P#K0`Sp 0K! 0K$K0 K 0K#K00000 ](X@L000 000 $K(K((c -L4Mc@PUģUKp 0KKP D0  P0D04KpP0K0040KS K눁$4 0pc0 `$K X0$K܄K$KR 0'$K R 0$KH0L 9#`V %K2K000t20S lKif<]hU 1 Z0!0NP4K&PP K100041K0S K?1 440琡3 'P0(0A4KpPy KL1 00040KKS 0( 0!K\ X0 X0\ 0 0000PK 0`V$K" $K 0S 0K 04 0p00H000 U'PWe0lh0 #K0(K((cc -LD e-dx% p-@L M P` K9 0T 0S 0 XKpyd -MLM 6F 0VS $P 50S 0S l50S fp0Sj 0Sd9 0Sl^50SXXP50S 0S8NS0,A.B.K B#C) 8 9Ÿ$!0KA0 4 .0(=Ѐ?(`#p?``p 0 0!d0(Pd(! 090>K@0C O0Sp 3  0 R0 0 070SX P嘣 ?^K N,`4! 0L 89`)#DP>K0C  02 R0@P V0  B0S @T  㩗B0S @T |ޗ 㚗@\2dR@1a@T2@0S p3}4BC~*t2'20S L0 0A0S 1ܑ '0q,0X01P 0000S 0S tF l1 0S+0 PR@70S 02P >K 0CCP( 00>K 0C 0C(VP 0Sx(Kp( ((ddd(d(d"eFedeee(e@((e(fX( 0?/0 R0K4ASR :0K0 4A? R00 K4AQP0!K4AQP00*  R00S 90S 8K40C h d9* 0LiS RL ~!P8K<0C8@p0W4 <90408K40C K0 4AB``?DP0`p |80S `8K40C pF  Z`p8K@0C0 S70S5080S1 8K40C  R0S:R)h0S& 70S 8K40C008K40C 8K<0C 8K<0C@8K40C (070Sh0 0!_<7(^ K?4AQP:07Q;P 8K40C00R00S ^.60S !0 &h0S#x60S8K40C   0anq 0"ao#q V0 0 `FVt`F!.0 `p V0051 Y)P t p   (  R0 50S" P 0Z` 吔AX` 0 ᆔ  Vp8P0t p?41CA :0 jP    R0pWX  40S PpJ P d  0 pP$P 4@<. P J$T8K<0C 4 8K@0C0 S008K40C 00008K<0C #0008K@0C0#600S!\30S t3 PP 8K<0C@p0t>28K<0C RpRLtRPXd00H0d04<0$81# 0S }hs QP# 8K<0C V10S =P1X 8K<0C10@S X8MhH0SE  0 # K<AP0L %98K<0C d00mP8K<0C00S,  0 0(0d 0K,I"0 0 1 P 8K40C 0Zh0Sp V(K(8(((8(hb((((((h (hh(hL(i:iyibi@(iKh((ii?pit((h -LM`p|7|x7 ,0VU\5 S0 0.  ᖡ*@_\IK 00  Q ,  .  ?pP@P@ 0 KR`pE>4@C0AB ?`şT00/  0!. 1R R  0@" PX K7 \5P0 0@ H @ 0, T>  K4\%R 00 #0  00 0,#0 ? T ?P 0 p40Sh40 S S J<400K  K sPRK K`pr K K0 K*KPpf`QPK10 2!0` !(K000 K0Q0%!QP 0k 0P0 b i00iKWV Kz)KK`p V0QP 2a`pa0 ?+K 0 K 0SRK?Q P0!03SI0 0!0,0WV`3p3: `VX1 0 `001 00  ((KSR$ !"WV  0 0P KQP* e0 0   0)K 0@)K d0 (K(T((w(@((`(P(((jx% ((U -j(\j(Fjj( -LM쐟p!@ #K `V.K P@P崠U KQP 0  #K 000UT00S P 0R #K 0#K`F(K0((n0/ -pLlMX Kz0d`<0KT10 P1 L1 0,0VI8A0S  d0,PD0P 00@ P 0g R)UT@P1P 0GK0Q pR Q8 tR 4 G R K  `p(K(X(0((jx%(P( 0000c/00S/p/P(00S/0/P( 00S/\P( -ML M9P`@@VL9 9X P 9 QP!*00#0`0DSD9 $ 82PD9QP )bP80Sh 0Se (P00Z(I0~KS069K0 pG< ,h59K0Sd80S69[5)[59K6)K5i[0``S` , P r 7 .괐 gVgP ᴐhfvW _#Tt0 0C0SyA@P#R0g90哞KS069K0 I< ,59Ko0S60S69[5)[59K6)K59[000D9 #0#000p D90Pw0cpw#00C0 000S H9 \pPH90SZ 0SW %00/P5pKaP 0XH9 9P l50 2T D9S 050 #  0"0 4b0 0D) 0P 4 #P  00C0Y cP.\V0P@$ .P 0$PPP3P 0# f0ß `SP`Ł3 0n`V PQQ `㔓DßP3<0S40000P 3 #R0D9SO 0S30Sc'` 0tP`  L9D 0SH9 0D9  PD9%0pD9 0CSmꄚ||#R0i` (200V :P1[ \aS!0# #R0  CK0 K @>K0C!CK X10S p7L P`. #R0 š!ɡ0S  0R %KA 1 00 00P t0 00C0D 0 V0 0(K((X((j k(k(kP(lQ4kfkkkkkl%l6l (Ll(jEllj_lllll -MLMt0ASE@H@hA P  7 7 P 7 00%QP$  |7xP㞋l TnPXjP     70S  0000Ff]K6  PErX 0D5K6 5 0R~K! pG% 5 E G5%S60S w 0%0c%@C 0 @88{0$&05@5 (0S S &_(P<0S( AQ?  B; ! CK50|S000( C.K X5 R L5 L65(@5 _50(S  P 4 q Z0S( f, a X( KV0,  R1 #( Qవࣵ R04 04 04 0;,0 S1 #(` R S),)-*-3 Rp尃@0`p0Y"{P AD @P X K <"K/K!?K" @2 tb Rpr pkR8 tfK4  !KFPk 02 oKq 000X000C0V(K(l(x((mx% (p((m_\[(nD\0( -L4Md!p#Kἐ4 @PK?\%d4 R 0 ? )< ? 0 40S40 S S 3 R #R  @p 0@0 2D0 @0SK (PpK00/0 ࠑ><0 #K1 R0R(3< 00S(t 30 R ԃKYX "H0 IH0S^2T <00<0l) Kx2 R`? 0<0 0 ?|<0P0K P0  00#K0< "  RH0S 0 104 $ b? P0L L 80RT $0A0$0 @D L3@0  #K 0#K@00C@0 [TW" 0 80R0ˈ00 L 0 LL3D 0   ?` Գ0 4@*Gx0L00S P P @7 P(K((T(`(P(U -n(((h((0/ -p LlMX K20 0,0WB0S `d0,P0P 屉000@10 _h2 00XUT`,2,"GK0 SpR S8  RotR4  S4  XdR   < K @RMȰdp`V 0(P T10S@  0@ DP 10S3  0.K*0Q% UT 0 0  S0 0  000S  |KU 0d @PnpL4 (K((Pnx%((P((xnn(`nnn -MLMPOPP`a0xK0,pG ?0t0?0STX0S,$5SN|? R ,0S 0 $5\\? *H?`G}/B08K}?C.f; 0K}LTHRK}LX0S8K(K,0C>C{/B08K{?C@ FKuA= C 88Ku?CЀ Xa08Kw?C<8KKw?CuL ЀX0&8K>C0K/0 uLЀ8K!u?C.Ѐ X0 X 0(8Ku?C K 0uL 0HK ,@D(K>D/B0(K0/B08Ku?C0(Kw/B0(Ku/B,0 R'y0S {d8Ku?C0, 8Ku?C0  00\%9R8K>C 0Ÿ8Ku?C0K!8Ku?C0y@# 8K>C0(K0.B08Kw?C0 0Ÿ8K>C08Ku?C0 8Ku?C0#08Ky?C 8Ky?C  ?መ U00xS80 S S 80S `8 R #R 8Kw?C\0S (`0 070S 88 0S0S? 7(K8p0y/B0\%7R 8K>C 0KuL1# 0(Kw/B 00 K(K.B uN!"ß 0d ରh0 00KyA 6\%R8K>C 0Ÿ8Ku?C0 8Ku?C0咃 8Kw?C0 0Ÿ8K>C0 8Ku?C0,8Ku?C0#0vh ?50嘅S 8Kw?C 0h 60S 5 0S 8K}?C0lBPGP54P?$5(Kp5y/B0044\%R 8K>C 0KuL1# 0(Kw/B 00 K(K.B uN!"ß 0d h0 00KyA"3$8Ku?C0 (K.B K2!8Ku?C0yL 8K>C0(K0.BK0A= C K 0A KAЀX0 0KA 43X=S((0(K08Kw?C0y/B 08K?C0 Xpbp(K,0w/B 0CR01 =S,@010t0$5S8p00$00(0 SW0(0,0SWpp00pSR0X ,p00x x0Rx x0 4 2RT8Kz?C T 1R\8KA>A!0B308K?C K 0A P[0008Kz?C0S? d᱾D2 RT0T00! ! l2PRPX0ԀY!dĠ ᨠ8K?C Ꮎ0(K/B08K?C ᱠ8K?C01 ᪠y000$5S.`0W3S  10CB>A>Al0B!30P$ #$Q`W@BAA0cQ0B0\4 0m80(Ky/Bp($5S'l00h  pp\p0S $S00p WS $S0$0(Ky/BK0yAD!(K0/BK0A (K 0/BK0A! L 0 8Ku?C0  p᝽P; 50S  0K08K?C0wA 0008K?C00008Ky?C0 $8K?CP6  v46*$6060S 0 0\60S 8K>C RP6 RT TRT8Kz?CT AP" 8K?C4]P7 8K>C P7 TwRT TRT8Kz?C Tus0 070Sp7 R\y0' S\0?00S\0?0001 &p8K?C0S" Q\QKA (Kw/B 2!(Ky/B078K?C 8Ky?C0X  pȘ8K!>C0W0( S`0?00S`0?0001 !p Q\QKA (Kw/B x 2!(Ky/B08K?C 8Ky?C0X   R\8K CK{A˅K{ALK{A 8K}?CZP$;u 8K{?C(K, B0B  R0@0LK00t;*qd;p;0S I0 0P꼫b; R 0S  Y  Pn0 -00 B Q$ŕB\`0 P30B0Q@%L  0 `P  <匌`< 堐* <d<0S 0 00(K -p`@LT*4UP$POU @ qq -AL0 5 qP 3S53r`1 0- 0S 0S 1& 1U Px10a0  Pa*D1810S 0 0PU03&0 PR 0S h* P0@ 5*< 5000S i0 0@TPU$Kk( (DJ%qqq(h((P(qq0/4(0/4(0/4( --,@LM   ;~x% -@Lq0 R 劀P0S 0`V`  YThtWH0 @R *0S 0@塝 a~4(!h(J K --LM  K --LM  K --LM  K --LM  S~ -PLM^K Mq H@HPlP^BK! A>kpP`,0KT@UKB^K PE I lPT5: S HSR00 0f`P KAlP4: S%`& S00S BK  @⇜P ` PP``V BK @5P,<x(K4(S>K0h趸 0\\L5SPPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\5\S//( -LMP4@80 T@T@t%  ?#K:,T,0#K @Pl0\~P ? 9:K c00 P ؀0 YX0\^P|c0S p30Shd30S XP3P#0SH D#S< P(,=(S0S C0rS B*40S 2@̂\hp h/o2" W ڬ [@HR00 41# K0 4000 d0? K:Q0800SNY,00C A ?pB 0S0S 렁q0h |10S 1P h10S\ P&(1@41hpppIT* 0R a}@Apd 0S * 00S L0|0 0 0@0@ (K([ (h(t(-r`( (@rT(_r(~rrrP(r(T(r(`((r:sPs(|(s -@x?MLM@0d_0KX?A`pRiP0X E (|m 0S g?P48 1 |s7: S *Pg>^0Sd 00(00S n| > p>t h> `?  <8  D8  @ ,(  :@<8 58,(QT@@R  P =R,( 8  KP.48 MR4r>K 0C0>K0C Kp8* .00&P<>0S! @Hg08P0S<0S |@T 3gP  Sa<0S@Te>K 0C40>K0C  pp 5[S\ , ZKT @P ZK @P Z.K B pZ  ܇X  8840S  Y  pW S KV. @<8 '<8 40`  (5 R 0S<0 T;( RIS?K`C ?+'0p5 QÃ0, ,Qp5 0Bp5@0p5 T0I t SK  A0 G ?` p UP= `pT`5,h V&00 S$1#0,(p50t%!"ß 5(%m:4`pP `5,(R 9)0909 09{,: pIp)0P\pQ=S0Y0P 5p ) 0SW80 S @S* 5< 588p988 x90S H9k p09 90S 0|z 9 0 Sp W 70S888(Q,i 0c ȟ=C0, 8t00`K A`N`(8 .`(.>K`p 0C`wg0S+70S'=S$0S 0'(pPX  0切<<00P%X30*`7U l70S 0 00S:70S60=S20S xp@P( Ԇ0000 p 0L%000P%X30,|v * t60S 0 00 <0S  P5E5 %0 5*5 50S 0 000S0,PT5xE0*0`5 l50S i0 00<cQuP4D 0*<0r4 40S J0 0pD0Sd0L%r/ Qڨ0Q)X 0 0S #0S @t*E04 <40S P0# 0 00S00L%r, 0QQ&P$0 0S "0S pC*`3U l30S RP0# 0 00H00q( 2 000cH00S X"0S B*2' 20S $P0d" 0 00L40q(  2 400cL00S "0S B*110S LP0! 0 0H2 Rp@81EN4 @\ P Q\ |(((s(t(s5KhT( (ssh((0(`(s(s.twDtotttt uT;uuuuuvuZu vTBvjvv|svv (vw2wXw{wbwwww&xIxlxdKx(xxy*y((Oyoy((yyH((h(((yzKh`((P((z(=zX(((l((x(d(dz(z(((;t ((t(LBALzz{9{x kV{#{0{{ (i?pL((({Q R  <8 <8X H! pGpW^R# x0 @R !0S DA*T1(H10S %P0! 0 0AQ,5S0KS> A QP* ( 2.K0 BS>0S w!0S 4r*D2820S P0" 0 00S0(5 xS<S+ 0(0 S<0x0(50S hB!0S s*s3 30S KP0\# 0 0H= CSR* V30H  ? A0S 8!0S s*?330S P0,$ 0 0L= SR* "40L  ? 0S  0S t* 4O40S \LP0$ 0 0 85 H   ? @L  ? h50S;l50S70,5S30S #P %0 000.K BЀH ,5S> <0(5? @L u ? *650S 04& 0 00SPh60SL0L5sH0S P &0000L50P5?T5V>X50 -@0@0 B Q$ő00B1\`0 P30B0Q@%  0L DG00*cX7L70S ;0' 0 07 PR 70SG*F770S 0h 608 +P@NPpL@ @XJ0 @hT@E. B8d  ࣠LS 4@P0BP Y  PP8vt80S   80EAd y ( @0<90S  0p0088@PO@!.1/@Pd@)P < ,@)P 2 ) Q @_ UT(@8* @@*D*P*PUPl*pp|  @:P @}:@M0 5 : p:0S 6[S gK @P : K;PoQ  <,[ 8 @ 0P@@048 0;P T;0S * P 0  0 =0  0 04 8 P  $ < R  0S 00 0 0 00  h BP0 4?s0 S < R 0S 0 0 000  0 P0 4?s0S#P <= R h 0S 0  0a0000  0 P 04?s0X,:PP/PQ! > R 4L0S 0x(000  0P000 40 0P" \> R 0S 0@00d0  0 0P 0 40#40 \? d?Q+l? ,? O0S ? rt Q 5<* Q 0s03p0S p !0Bs00WP Rt@PU0`PVd0\P 00@ @0, 0 R  (K(({((| 0-0LS q: S  S  S  S S  S  S $0PtP((-| 1-0LS` lh @ sT L10S@10S0s/(10ST10S s5Pps400CS0p@0 @ T 00CS0 P 0  x0@YT0 0 SNT _sYT (@|KhT((_|8(h|%M %p( -pH0L0@S` Cs 0&|Pq (r|Kh -@L M@1@<1@810 UP p1` @p p@GP 0P  @p p@PP P (0 1P0.PUp000  TU QW M @ZPP 0 `0@(K(((|((( -L,M#K14 00_5#LDK@ p0@0 $K  < 8 <W #K@di 8Pr`<#K8 PE?$K 0 18 <;0 P08 0`080 V*PUR 0041# ? + 0$KT#K ?$KPrG#K ?0r@ dr(K (||(|f -LMP`p4@?#.&#K00000 #K  ;X 0 !  0yrPX#K ?  ;P  ?8er0P (Kor(K ((U|f -L M 0pS@J PU 1߬ U   `0 ``0 0T0؀p0@T)0 @gLS0T@SP   80EAd T d@0q0S  z0`00p(K (}}h((P(( -LM0@0d ,x P0`00 QPp P0D D000P 0`PK(t((x(t( -LM`pP0@T d  SR @0 @T\ 0  00P00@@000$K((@} -`p@L\MX tK:tKeKT@ KШ 00-L@S  X 0H0S XT00S H@`P000000p (W}c}k} -D`D@0L P(00S KhO((P( 0 /( -0L SR`p* 0\wX00@_ 0 @0 အ01S0X(}((LJ% -LdM`SR00WV00S@ ` \Q 0S  BR ,EX K0  0Y0*X40-00S 0 00S00S d0P0`ᱩ 0o 0^Z$KkZZ(((t(h(|(( (&~ ~(( ((P((((D~((NN[~(x(t(~ -LMP:300 8Z4ʴ3 @R_3CKjCK?Q0% R pW00A10CB>A>A0BT3@ T 0SPP10CB>A>AQ0BU3@   @@\%2PR%  0 ?$b@  ?000 h2<` 0`bS0 S S 00 <0(2 R #R  0001 0S10CB>A>A0B310S`0S10CB>A>A0B 3Z0?T 0 0080LZ240 00C0 NR 0 N40` P0\"0C00$0A0j$0 @ @R P0 @40P 0j 00@*幹x00S ᒿP0 P<0 P(K( ((T((`(P(U -n(h(( -p|0L``QU 0X PR @P8# 10A(~<0 0 1Q01/ Q0  /(h00@- 5< ÒP0\ 9>@UT :. BSR0000(^F -QLMPp` "K> P; P60P2 Ѐ0S 0S  BK @P 0@ @P0 0S 0S T0 jBK @P@ @@P 0 $K(((Q/0/ -L M@8尐 笠0 4 8T0P@Paq8U4W Pdt`pP(K[^] `0-LS @o01S00 003s0B!00!s00~ 0`-LQ   | o0 !B1  2 P" ~ 0`-LQX!K @0C3@XVTLT$P 0#  K -PLM~KM pG`@(^ *WPt=^ : S*/0P+  rR( K0d @L#@wjK@؉(N UKKAP lWPNP@ SN P00V `KA  n PWPt=: S ^KPE>`";jC `^ @P SwU P@`-UP@Tj8WPeV0 KASR000 UPTU00`> KAͨPH( 0#P>.K B@WPM0S4U`K0!@iK @uU@P#Y K@✆PPV^K PE EVPVP (P :X% P@(P 0U VTZU(K9[A[ FO[F F@00S/p/P(00S/0/P( -L M`p14 000 100@_ 0ʄ 0ÄP 0@00` T0㳄P00@BAA@ Q B1Sd`p`000 R#X000R P00``p00S d \PT0 %4 0%(K(((&(< (x k( 00S/P( -L$MP@ `D0 `@K#K0I K00 ?P00P 00K0@#K000P000S 70K0 0p?pD0p0#K 00# 0S0PT_Pc:> C0(0(^F (KhR/Y -L M p (@PP` 0 P0 @00`@U &!D`0`p P(K -@LM P` Y 0&0`r0 ?s0YTp`pP` !0be ?$K :^FF^: -@LP`     -`P@L ((UX0 3?X0 @-aA0SRQPSR QP"P00@-P40@00 P UT00 -L M 8X`0 0 P\0 @@ pPppdXᛎ   "PAg ኎   P "@P 0T0@P@(KƂ,^1  0-3ASL l0l llķa^@@ P dP S@P0l@PT0@P@Ƃ<^d  -@PL40Ua00P 80SX0X X0C800S   0P80S0 偷%O^ ;  ,00-SL@0\00  PM ,0,0080S $0$ $$_0K0h(R;c^  ,00-SL@ ,0, ,,ITP K0hkv^  -LlMh Xp`P (88S0P P84PE2PE1PESPE50  00 0{c X0#03?aᨋ^^@E` +PPOX5Q PacOPGT 0XR P((00,0,0$%K! 0HL(0#$K#$K0@p ` $$K0 4$%0IKdK`Pp 0ᖾd40  %K $K $KPc,0800RXSS` ,4,$,,娶`V:0 0!0V#%K 0`F34`c`0 ,0KacL0 #KKQP #K,L0` `PP,`3QT 0Q 0CQ0p ?'K0U 0R3d0 0$KD d0S5'K+ԄK#K%K 0P YX2"%K!%K!4000!R 80080L  Z$K 0Pp0 p2K0UT0XZ$K 0P 80S1մ!մX0C800S   0Pp 0܃KSPp #KT$PPP mTP0S P4TPU ![PP T!⸺0PPP1b 4 K#KKQP0 OPU :^Ph0@ 2P(K(LBAW^(^ NBAW<^ %^ No -LM0@,0S0 債`p40W00QU ! #K40K L`P  v`PP p (Kl^"  -p0PLU,0S`@d0d d u~Q L0@ HH? 0P@eTl^< =  -LMPp0S,0S`@0  F~Q 0t || 0P`@epT ! "K,0K P $Kl^M O  p-L MH0P0` 8@ 000 Ha `Kp(( p-L MH0P0` 8@ 000 -a `Kp(t(ք -0LPQ P plP9_(@L`0P T   T0,! `@T(|(Kh(& 0-0@LP0,0S )000|( -LM,P ,\  > K|( 0-L@Pih00S`0X0dS 00@006.4 Q= SR00(P(( 0-LM20S S+,2 R0 ELn `Q# :P^> 5B< 50d3*1h2u\20S   42@ GaQ Q7.B@p#x3% aP A 5*< 50d30a31F10S ڱ0 00@  Ŝ  0TP D /P 1 d3S5 S'aQ Q-S+ P 0@d3a3*廫000S ᓱ \0@ d8Pd H0K0(((SKhnh((P(|(Dž߅ 0-P LM-K,K,K0 K@`p0 0 30S #8p lP tP bP K? K7  0K KK p@3 PV 0P 0V,K` -K`0 QPK -K.K,Kܐ/K؀/0P P Y0 |Y P PI LῙP Di0  ᯙP0 PP U:P0U .KR0 K$$0㫺.K /K* `P 0 .K /K `P5S K 0S  0 R0X" $ 8up5 ;  0S  0 R0X" $ 8Up 0x KJ  \ 0K D(K(H%<Zu!ؓPJ% -p@`P 0LP U  # #P # # $Kk 0-P@`LkM1 1 1 1 $6p LP AP0cP iPiKgKK pP40T D @4: S 0kK mK@  K Kp 1Ss%KmK %KkK $ĕC>C !0K$@P ᤁ堑aP  P 0 \ 0V1 L 0/Sz 0(#(fKP01 aV  $ pP2p'MI`P!'veKJp I?K SnR n?!  n/+I$1P !d @I  DM"=4I"`1S1@ 0PS" `1!pVT 0S60S3  X R" p$`G0p 0$ p T <9 p*Y XY00W00S ` m0e/K$8eK ᜺PmK QP kKSRl dT (K?H%lJ%zd@Gei9zM&cC -P@p`L,M,KP*," 5p PP APfP pP ` epP00S000 10W \``0Kd P V00``NV P2 0 0 _ 0 p p0`P ,㦼 ?o #K0 00 ` p 0 p`#KP0 QP p U`p``(K諕H%J%ǕܕU -Pp`L !4p@ fT rT`00W $Kk  oXPp! X $$ 4ep@p `&W``V@ $$ !Rp@$pH%J%3Ol  -Lⱖo( -@PL`pP 4yd `\T  HH\ 8qU  ( Kh\ Kh&!x%= -LM R0`@%P (KӷP0( 0S 0SS0S  `q'` BS0S $KP"K Kl. (P 00#s01"$#/A-@@T ^@PpU8*`>6 X ?7 ^`QS%  Q ^*!S]?%] P\S!ልPᨍ !à? ?P0 0A-@0P 00 .,(K*– p -LTC^d E 0$4! 0\0; ?up+(Ept@4: S$4 S B. Ep $4S E0'B. Ep E0OS<$4 $ E0 K>`C$$0-0 009`E؀E$T0  P0`p 0$4S `P 0 0p 0p 0 00p  V0pp C$Kd@&=d@Tj -L M4@  KDEp 4p4 {CKd@Ř 0-LPP@p P@ T |4PS 404 0*W| - @P0TLP p` X`p@0 p@@薙$$  Q R "( / 0T 02 /$4 0T1 / $4 0T1 / -LM`P@p P&t`V̴P0PP0 0000X`V* 1 00P0\H0PW`U 1 040$WP(KHęΙx% C-$$L0AP p-LM R`Pd@X|$KzP <"KR 0 jKpl.% -L|MP_o!R0`@R(0S 00S"R0oU ZP vP00 UN 0SIpWF (0SWBP0 QP:P0 QP2pG,00SP m0 K$8 K0P CP 9/p  9/p 40 P(K5 -LM@"K0S p$0K "0 x"K 00 00T0 0$KEY - 0L M 0P|'p`Z 0  40 0 味P 400 0S P y`8_'@ 0 (Kl.vƚ -`@(PL0 0@MVT -逐L` pPp@* 0  00 <0P8 s s@TB -LM`PQ@#K  00P P0U  0E,< P<   !KcK`pKp #KԃKc 0p   (K: p-L M0`SPL@ KZo 00SP Kpl. -L iR sR aR +Bop`Z 0-LP@*P $0\P00l. -@LT`P,0qP~l. bR0-0L LR aR -sR tR iR'(0Sڔ^!0000p`0B  @P ,00;0覛l. -@ LM\$Kp`/hP0 $0K0,U$0[S $KU TKШ袑ћ -QLM@` QB^pA^ Pp $P t0 00 ` 0P $ (K*&ٛ -L,M@#KP @P 0 0 p`0  V0#K$<08(<#SSR !`᪱Qp `p`p#K 00b V`Rp0SXz Rp`WV8q `V 0phpj $0PPb 000 P0` 0xPjQ4! P0800080\0 04 !#K"4  0"#K R0#K R0#{ p2 Ĕ$ $&7##,0 RP P T0P0Y*c p  Z(#K p 4 0 00`0#K#P| 4$$  o 4  !4 "4 $40(K.^y֜* 0-LM0@0S 1C^ E$SE$$0* 01P* @xq !S"d#\80T K KDSP<SK0H%J%(9K`w!Ξ0$ 8 -`LLMPpdK8 h ,1封少00 !+p N fR lRDhKCh0SOd wP T S@P @k? A =Ph a0 !jS 0@ T T p )p0@h  @hHoP@hH0T dKp h0S d VX dKHJh+(Kl.%xLMH%J% -L`p(@PP0 `@00 0 0$0 0-@PL0$0S K0h -L,M PDT `#K 0X@4  RK D@#K`X #K SR00WV00S0 S US 4 0  00P 00$0S SU    S!!!U111 ~WP  nPPK 0Y 00X$0 #K 0@S0PT#KP #K 0cKWV 0@S0PP KP`p` 0 X00>P `` 0`pK#K؀ X0 0`0P0@SP5( 1(K萟0 -L0M@T"K0%K 0l0 K 0d !"K(00(0  0Y0  0Q ! 000Xf Pa R#K0\"K0 "KcKR0W"K R0T0K 0,0 K 0$4##K P0"K#K `0 #K V0R0,#K V0pR0`$ 0T0 00  0`!p`0K0 000#K `0 $K -L MԀP@ `pEJATk0S|` 0 0`00pS`Pc 0 ௬ 8! V 0 0 C X 0``Vp 0`f000SP;^ ቬ0   0Ⴌ`!p V"T` Q  R0P TP@5  R0  0 ,R)T Q V0P xP  V0 0 0000SP` (KA\0ߠ P/0S//P/0S/ĐC-܁\ @`pR\    0V0RT -@(MLP@`pvP8 `( <K PP0  4K0՛ -LmT@pP DDD0DP<<' @4P0@ToNHx%/ R-L R R R R/蘢 R0-0L@P R +:R R0R R 0R R 000000S8 10 @,O$0  00( -LM 0PPl0!S R ^p(` P *0S 0 R0`p4S 0$$$0 `Kq8V4*4S ڠ0S1 @2O0  :/p 8 H00($P 0 0 KR 0" 0 R0"@`(KWEV +(6 0-@P`L4M,pK0'< 8 "'p fP APpP sP0<0 080 fp20U tcP0PKkP 0 4#Pp 0H0 $KR0 QPD 4 PH0ro0Vᰀ0L0 0P0 4S 0VS100  R!@N1  VR R- R R <0S@1810P 0P80S P18 H0 0"P0L P(0  R0%EpW`p p H0o_P@ S$K pPP@(KUH%J%[p(u, -QLM@ Q A^PĀ` A^P尀` pp  P dcP;pP <X0 (pP K&*٣" -L@`;pP; V VBn 4Аp An ` 4崐p 4P" $$ 嘦0 P ! " $pP 4  0 "P&*٣A^ -LM@`p";&pP rU 20V $KkU`pPt   $R 4S{4SPN R ЂYX j CS P 4S 4  V0p1P 0S PP`J  0S  07p 0 0 0  0"Ph`$,  ?o  0P[0 00 0j(p`LR@``$KLH%K%~ȤǕܕU- p-L p iP lP aPT $KGT (K p XvT D00U 8"K(  0Kp(H%K%0M " b  b    0 RЍ/ -L\M P` < #K#[ <vP9 U P4 lP/ U P* bP% U  P XP U P NP  P DX P " PP `RP PU%P $80KK P P P P  P  P  P Ps 0 P,1  $ 02#UX*`Pe , P` #0KKH PT "0KK< PH | PA P< s P4 k P0 P+ m0G/K$81[S  P ,1P0,1 GK  P P P n P@ d b9K?K  0KK SRPX0 uP& L@@P D ġP$ 4  EPP ! t1U s%  DP Q Y(Kxl.hH%K%k>[JwUͭܭ!mvcՎ$'1ÕM % -LM@`p[+p FP iPP:0V rC>`C$|P XsPnP Xl 00D1T:P0P0 < 8P,v$$0P  PP P (0PWoP $ p Qt^P KPP 6 01 P0-K0 0 0/K-K R0.K R0.K>P :0P0 P K~P P, 'P nK`sPP  |`Ph P} XT` Ppu P.KR00K0V 0S  y$?PP 0F0 QP K0Y0$$v.$4P$0#<#)0 QP0P` D$$Y.$4P`0V`P! P 1&ᦛP  P0#80  `Pr P pP r|P hP PP xP qPy jPr cPk \P pc q?SP[ r1S K 0R0 ೴-[r? á/[ ñs?s? L9PA |82P: us  %?  0`y0 QP$$-$4PopP0Kt$4@ K{`PR K$Pt:K?P P / 4P ^tP KXP KP K|P 0K$ 8P 0S* 0.($t0 `0 QPv$ ,-Pp$0#`<#0 QP^$ -W$ ᢡ0\"\ 800!-K"0 8".K#0K  0$0P00 T0X$$0`夙0 QP $$,$4P-K! 0".K`$0$#`<#備0 QP $$,$4P`᫿!(Kxl.QH%K%U~Fkkm1'(Uɮvc/UGÕ>[JwͭܭUgՎ$*ޯ -LRM`pt K0K ! .K! -K! .K @P 1 1 1 1 0 0 0 t0NK0 l00 d0 0 \0  0 T0A 0 L0@ 0 P Ҡ Π.KKi@i!i -@LM $K⹠ $K⃙ 0K 0-@LM PK㧠 KV 0K 0S{p@ @Ug K4-p(Mg0K00'i p-ML M1P`1V0``S` B.KH0x1P h!hBK♘BK\@PG 0`0?o@ TB 04 dP= @0 0B.K00`0P BKtBK@to|@0 0B.K00`t0P d dBKXBKdg@0  KL \KD]@@4X@Kp((U p-L MDPP f K?P f ` @T EP  00S]V  ?@ rKp>$0 R ! -LM@D Ppp`# P#of  ݗuP @ nP / KvP /0[ShQ @ ,pxodTpP pLM0P / K UPh08 00<0 /[0 80 0<0 @. KDp! "[ R R RY    Y eX (ud0PW LeW 0eHQ L 40R !<0S @ h',P@ `!,p_01S l 80S @@@ `,pd p0S 3/p\ \J 8 X+p\ <A(KH$;F2:DSsp -L`@PfPU pP G P@PT  -LM KP KE -LMPp K@P00|p`P K⊞ KT K4+p *[0  KKi 0-L@p K0h0 -LP`8pP0lP@?00  dJ -LP`pP0LP@:?00  d* -LM K$lPh00 K)= -@LBM MBK  @ B.K Bp/ $R, 70AK0?  @VANK@D0S >>ڙ@70$0AK? D @UANK@D0S ('>Ù@Ki/ 04 8 c<0K[V#0 KKhN:pC p-@`PL$M 8K58 K,bKRK#p@@Kpi -L M K8@P(0( $ [Kw -L M K8@P(0( $ [Kew 0-LMP "&@P| P^KPE+V%P<}8[S8[S1iSd%K0 -L M KP@2P@0@ @@嚍![Ipp$q`KwA -L M KP@P@0@ M<y![ Op P`K'wǰ -LMM@K @x0XK,PE7E0(K B8lP7E`P "`(K7U B00'S`@ 0Kp`c( 0R p@PT@'V 8K0C@ 0(K B0:(K0: B0: 0|:0x:0t:0 l:9(@K !0!@ 4 ` ?@0CS 0    @$@ 9P( 0CP@@ 9P  0kQ9G0C֕% x9P@@̕N @@  0l^00R E990Ip0c0C0P0 S0@B0A/0 Pl8(K0p` B 8K0CH8!0(K@"0 B08K0C0S.0xS; S :SK 0Ss *S[ 2S S] 0S  K0 p@8K p0C8 R 'S|`t8pp`p0dV0X' 0L8H0S 0 ,(8@*`pX>P80S P0  B8 }8p`0S t8`Vx0$(l ,R\$a80S 0<Y8f(T80 ` dp 6(K BW0 T8K0C ?8pG5q1p 0I(K B05Z  $( Px% t%Pp% llşPh% K@0088K0CJ0(K B `aBV1q18k R9 #S2 S. S* (S% # S! S !S "S 'S %S  )S| x5:Sp Sh d  (K0 B 0K cA @ t7(K B 0P0c(K B00'S)ʷV43 ̀\0Sw S70S 07q7 0 ptwpw 0"KAZ  (K B0[8K0C q78K0C0J0"K !w0Ap0 1`Ftwpwv0 `(K B0@ 2Z  $( P" t"P" l ŸP" K@0<78K0C`J0(K B 1p(K B w`aBv`VӅ 1؇!$"70S\  7W70SQ 7`p㠁   0"  0l!l p6W`c0S1  8,(KiANFJ{ $0(6(O(z8?pvP:G8yTDcLYIvmP?PDаh 5 0-LM KTP@p@@ 9[,\K@K0iI] p-L M`Pp@$ K@rP0 $@Pl\ PD P LP$ 8\pKpwдx1C2] -@L,M( <K< K0p $0 K6i( S-L,R( M6 Ku 0p-LM(0 $0 0 ( K`"p (@PPy\|( K$@ P "pl @(0$ R$0 $0bTT 505@ 5 4xi p p-L M@`PP  Kp @\~3 -L MpFP00 x`៯PPt 0 `pT\@8 KD(@ $` P Dp(\ᳳKei -L$ -LM K@|P|0| || Ktp *KR[  r0*K )K8 K p`K[wߴ.ii -LM KT@KPD0D @ވ0 K40 p Kwib -LM KT@)PD0D DD弈0 K80 p$vKwip 0-L@8 P,0, ,,囈( p`0{?2 0-LM KP@p` ``[Xn PH08 DDv1[<80 p`K0 D{?;F2 0-LM KP@ph h4[1[T$[L< P<0( 4D$c p`K0DY:? -L$M@ 0KH00 K( 0 6 p[Ki p-L$M`P@P < K` p -LMP@i`P ZmOpPLPPO0P0 3t0@PU 03/PmLOL P@0P0@ @@@@,31LM%x%t////0 L0L0/M%0 T0T0/M%0 \0\0/M%0 D0D0/M%0 d00d0/M% 0-L@t*OP 000D S 0A0CS000(Pᜎ0>S 0@0M% -L"p0( 0`0S R0/M% -LK 0C C?p8&@m T@PT` ' Xa>K 0CCP]>K 0C0CD6 a>K 0C 0C$V0 < H6 "P PU D崑 DG  R]>K 0Cv86S06Sa @dP 006 (60S6Z R[ R\ 0S]<60<6 5pW[Zp4v  4 _ ppV%8X  bKGb.Kx  mpP5P0S  K @yG,5P-K$ BUKKp I5%QXᢎP  {  w s 1Pn<6S 01|GdH&P4$X H6BK 0 @8$MB.K B(W1UK @)GU.K B pUKADQ A1UK @GU.K Bp DQ 01_K I0 Ip0#ta d3X,:BK H# @HBK I0S (1 ᪌:00_>K 0CBK! @"HBK I0S 0 ᒌZ.  2/ Ԫ0P@6  R@6b.K6  pX P0@!0S&46SQ 46 03/ r p"% & # ~' w' 0p#n% & \\c$ H@\$ <$U A00PpW 03/p0`pWl 0 3/pH00S '0$.RE(([i(](ii %Widu~iM%.;UmN{B -L(MpP.`P P@( DK֏D Kp0S hV LP400@ @V0 (qVK((6i( -@LzP0 傃`@0@#~P LP  CpPP  M@N @@ .(T p-@L M=PP00@mK`P H@ KBPṭu KpZ( p-@L MRPP0 |@>K`P T@ KBPክu( KpE ( -@L!P0 |`0@#^Qp KpP tBp8 N@@ ̽(ex%m -@L M KHP808 88孂0 028>0Kwս( 0-LMPP @0K0@@@ 㤎 Kh@ pT_ULmP<hP,cPK0(5iEZ -L M@ A`. AP D.KA P ,.(@! .Kp8yv -L,MP@PX" 'p2pP4"4 U( LKB LKbDL KCpy ,P@# l@PTL K(@ 1p <Am.<<00 R d.0|). .40' `X.XQXaXqP < H1 \ P^04   Q0 :.Q4. -m;P P p`D,0V00UW@.p.|F -` P U Ki( K(p6i( uB8y  0-@LP  K0h蛍 -P@pL`0U" 0S 8ħP$P F40S040 0S 0S(0p(P8`$P 0S$0(P̫ P-LP`@}}P VT  N`P%`"농 00 -LMPpP@` 0K #  K)Pl0K0Pd 00  p 0 `P0K -L M@PP ( 0K⼇0 `PpQP00Z 70"S20!V0"R0'"0~0P 00 , lp 0 @0(K -LM0 00 0pS 00DQ Q 0~P70xP20 KPPP K┌Uv U UU U:IP ,K⬀ x嫆`p4@V`T /b@P00@ Ko00 00 0K0P 0 0K KP0 R% 00!0 0 P00K0T0K嬠K "10#Z 00 T` K0`S 0SVo"00ቪUZ _`@0K0 K0KYP0"CQ BQQ?:KKK K K0 C0PK@T 0CS},0K0 r xC00K Kx:T0CSo,0K0xC 0aD\W@DAD\7@Dt@0@Dt@ T[Sq0 SSR0xRMZK PPPE ` |P 4bP U3 0 <p, 0ST!  JPP` 0 PRD@T   P\U\ d9R0p 0 00ө`㬠K(K)=v!u}C] -PL,M@`K@H  L0 pKX. P W'0 HL0P 00p0 HL0 P7 0S3 =K0C  k945 0-K1 B05 p  45#70S0 0S0000B.K00 Bd0P(4[S B.K B@&@H$K$hi(Q p-LM`@=pP0+S"M KH Kh< 0KR #  KDBp 01S }0/S   [Kp i (0-0LS Khg&( -`@pLT PqP @ 0SP x% -P@L` 7pP  d~PX0 000V8L $p`%+:i -L,M (K@p L8 KP  8(K}800S 4 KdP401K00 ( K4p [LKN9iV -LM(@K p [(0[QS S  %Kbi -L$M (K@upl l,L4 K`P00 40( K41KhpLKN9iV 0 /T%/ -0-@L M000 0PK0%00 P0 P00 (@ $@ @ @ 0 PK0 --LM  #** K -L@ *r   -0LS`( --LM  )) K -LMh00S@ 00 0 0 0K #  K$ KBp@$@K`( p-LtMPP2P 0S 0@P 040 000 000K0 04KeBp h@PL KdKdP `@ \@ X@ T@ P@ .P4 KdK*PSPP vP@w tKt@ p@ l@ h@ 1 |0 x@ Q|KJVruu N lP LKO Nt1ta@@ |Kkp0S DW@U | 00C?oR20S I0S @T LKO 4KO0 |0SS  Q  R S0t0 p0 l0 h0 tKd LKO 4KO@Kp`("Xe!r.<T%OiS9`!031Kp -LiAP0@ ,$  $I"x%SE 0-LM0K lvAPP `T@P DyJPP0KbAP020K0T%1Rh( P@- Pp0@ |`@s,P#.\@0 p.ƌ S$0000#8P@-p4  ::T|00.T<0#s0.6\ 0000#8P@-4s<0L$^0<\ 0000#8P-4s|00#^0s0\ 0000#8P-46:# ^046\ 0000#8P-4?79# ^04?7\ 0000#8P- 4<# ^04\ 0000#8P@-46:# ^46\0P@~0 d000# \HD ,T8s0^(00 00#Qe8 -(0ML 00R!P KCT% -L Mp(KAP(@UKP` NP@ P` K 0-LM@PT0  (KG9Ṡ8K0 -0LnS@0oS@` `8Pp\wP 0nS0oSPPPP&አv -LM?0 " x% -@K~MMLⴐ─p 0 8K"P,b,oXU( 2V 0 0S 20S P0  08 /"08 0P `0E! P`0 "0S l1PpPx"'&P`` "4Q0S (P`t0p ,!0S1 0P!& %!%!0S;00 NK @D @00 -PP ,8[S =PP p!l=d0P`8!(K2BHp(u8yEZp!hzBdK*j -SMLK 0CCi_pㅞK@>74SKS(H   xP QP 0$$ 44SP= @Pt< K@zP2 0JSʊ ,7p0S -SKM@D0C.K B0@0D00>K 0C(h p'~0S SH ~"80,00(D=밊Xi 0-L@PFTP8^+uP0K0h -L); Jx% -L M0@00 0000`pP 嘠00 "p oP0 l1P\7D10@cTQ A0(Ko;H%h.l.h -LMNKA>KM@D0C.K B0@0D00>K 0C(h p}0S SH }'"80,00(CwXi 0-L@PSP8+EuP0yK0ht -L)yx%| -0@pLP`0 p oP0 +1PC100@cTa  L+ uYSP TC@+tP,%$$Kk l.h|H% p-@LM>KA^KM 0C PE (>K`@0 ( p ZC { -L: 7mx% -`@PLM ` r0 s|` x" pN lP) MP3 9P|0% GPI0UP! gPC0t0 sP mP oP 5tP( uP1p|00|0|000|0 0Px0 dm0PTB[0``010 Q  *x   %  x P!p0 (00P%0#0P Kp BX0p00S0t0Y0;;0x0VKK9$00|00|000(Kl.H% 0-LNK^KM@DPE>K0C.K@P90,0>Kxp0 dvB< $,ANK?@D 8 7<@0<K0B% 0-@LM PK 0 b/o"S ? 0 :BK0) 0-L@PK0h0 0-L@PK0h0IF -@L M K0T 000?  BK; 0-L@PQP8+gsP0囜K0h薜 -LM840 0,0,0(0(0$00 0x%> -L@ P\` {`P7PP0APlKhZP ( -@LMH `p( zH s||'yp 2@FPhThTnTnTnTnTnTnTnTnTnTnTnTnTnTnTn iiTnTnTnTn|iTnTngTnTnTndlTn|lTn$m0nTnTn nTnTnTnTnTnTnTnTnhhipiTnTnTnTniTnTniTnTniplThlm0mTnTnmm<60S 0>A $6 60S 5 0<_U ,K,0000? 08:N%00000F00CU ,K,0P 00R0S TA0@9-0;* U ,K,0P 00R0S 0(80@008(0K d.PP@(0       +  @  B 0$ R|$$  $ Rs# , @ (     )          -3(0  -0$00(0 -0 00(0 \-0$80(0 8-0<:0(0 -08:0(0 -0@90(0 -0,00(0 z-00000(0 -09m09j R ,K ,0P 00R0S ,&(2Q ,K,0P 00R0S 0$0C00@0 0wlQ ,K,0P 00R0S 0,0)Q ,K,0P 00R0S 80 0P ,K,0P 00R0S 000070700400`cVQ +@q $KhU%U%~x!(np!(l.|!(Trt!(Ԋ U%"9PgH% -LJKRM$@D[KQ=KM`D(PE$0CQ-K00C`P0 BHp㌁Q=Kp00Cp$xp y0KS 04  RQ K< p0@040 o?p 0$nK?`F  4HP 0 Q=K$0C,PC.KP0 BDP KD4 A 4`$04<$ 04@04X040 40$4 0(40,4044 Kp!(p`%W 0-L@PNP8+~pP0岙K0h譙 - LR R> -LM0@`Pp 0 000 PP0P0 0 0K0 0P g5K -LMp/`P0@$0 0$KKQKrP0 A K0/ p-L M`P@(x00   P0` PPPP x0 x Kp!((0P0'0P0&0P0%0P02P0/ -@LCMP% $ 40 00 0 00K000$0K 0 0P wu4wH00KhoK蠆 -LM`p@ PpC 0pp00 D00 [w$$ # < Di00<804 40b0_,\0(00x0 @E0@ 0bdp P @HPDPe $tqwH00(K!(rq -L$MpD `@  0@PK#KR,T0Qw<00DD@0 3/X0p#K P0R 0U4 0@ PV  +@P#K#K@ 03/pwP ~ 0KK R0 TK0K (K蠆#0/ -LM_K`p/vr P@1L# ( KmoD0@@ 0@?K0@P0 xpvPHBT  Ki4K K襆 ( -`L4M[ Pn@2pP :JpP`a@ @LKQv 0L KD0 l\0KᯯP Ǯ L嫗K0,K 0ppT0 \0,0*XP W:0S7\0X0 p   zp@   eP X00X0 `0S@X0t@qD0D0X0W 0 000E`` 000<0(K!(Fp`s ( -Lr3 [x% --0LM K 0"0K0@@sP 0<Kd@ zg AK K1> --P@LM( u0pἊ"0@0"@ 0@ @ @ " Dp g@ŸP񟗆L|,~,~,~,~,~d||||,~,~,~|,~}0 0 +0@0 K>p,2, R -K 0 )P0<)` mP`Kho0S Q     zmP`KOo0S Q  T;  <;  M K K>p0 ;-K!y0p0 s00cX %+JmKp  00KS0pS0``S@p` @(KB?h.H%Ql.Wrw7^ 0-LMNKA^K>KMPE0C@D.K B0P 0D(00>K 0C@(p ;@8# <   $P$(0l` FP (0D80K0蔊o{ 0-@LM PK 0 b/o"S ? 0 4;K0) 0-L@PK0h0 0-L@PK0h0IF -@L M K0T 000?  :K; 0-L@PJP8+alP0啕K0h萕0/p/ 0-PL@n $(0$( XS X  \  ` ddhhllpptt0 0-@LP (%"DD@@HHLLPPTTX}X\z`\`0p Qp` clP0@ S 0 00-@L"!S ]00 0-@LPٝ֝ӝН0 -@P AL0@=S->Cᾝ->C3X0X\-\*9>᭝9>:>C᨝?n:>CFᣝ?>CC>ᛝ}C>GᖝmFᒝEnF᎝E~G0XJ.X R  $$((,S>,i}S>GdmF`HHLLPPTTXX\\ -PL@  $$((,0,0 P`0V\%1R L5sP 0Аp|WY0,^mTiT`XeX\a\`^`d[dhXhplTlpQptNtxKxϜ0Z B`?<p0p$%S30l0\%R0` S#0P5P @R TU 0/ ;P r0B@p/ p-MLM@R0 ANK4 @D8 PC?T00T,UlJ0 0~JzKpG0*!|0 R P\ U 001dJ0*lK!(!(&(%(!(!(&(, -LM⼣`@ d S9 C00S  k0 l3R d0  B 8#Q\ ?0!.0S  J@ d 90  @RP2@ 00C0,0 ?YX: 0e p|2\%R080  ? F* _1!"#K00000 8 ? 7*00@_?5#LP ?#K00## 0#K8 ? *x ?*` e90d @_K]9pQ0 0K[0\!\8qQx @? )0CS $$TpAWT``:V sg땒l)0DS hhpWȀ`V,SguP 00 K(Kom&(%(!(U M%(dT&(T -L,M,vH @$ d D 80 60S  m 0Sm Ri @KK ?P0GK0 S``` T0 o`8K4 T0Z ( ؙ4`Ao"44Q44q@44q QK080KpS`0Z  Ԛ40000130B003B1 031 0$5SCK00/0 @P!.CK@lQT0 @T@@ 0D@`p00C0 A@RPH3@A00C0D0  0?00 @P@00020SPKd 8 ?Di2 RT0T00  B 0P SXԐZ0Kd 7 ?'i%K0 K0Ki _1!"$K@00@0 K#Ki_ DK#@P#Ki# ?h00C000H xQRtAp10SF  HA4H0AH80A· ` 00 08 L`L$0$800`a40040cK`080P/0 S`00!. 1R0 X 0`( pP d x70 <8<娶(K&(%(!(U Mx%%(U% -`pP0LS  @   e@00SK0?00S0?0U%!( |0-@`TLKPL lP00S00000s00B0a0!(U% -LXKM,PEKMLEp,}l6 R 60<Syp 8K>C `60{8K>C 0?E0S,,(& C0 d |60(K.B 4  0u L4K0@0 0#p R (K.B K r L 0R0(K.B 2(Ks0O/B00(KM/BXK0,PE(K0Q/B0Yd3`0S9 p3t0 0008K>C0 0KRA 08K=C8KQ?Cp` [d8KR?C0S 8KR?C0KRA 08KN?CXg8KR?C0S(KO/B `` 8K=CaO,[k$2 $2\Q?/ 00000 0? P 1 ` pL? $+ @l1 0d 00 000000 0?!0 0!`pL04;040 00d 50 KMA ?`pxT0 r018KM?C0(K0M/B0Y(KU%!(AV% Y%&(!(!(T --GML M  K @4 =m0S= =pW9=@0- @0P 0 = 'P@ 0 p= 'x~ 0 E,= 'p@@=T@ 9㖆]P@ ㎆<P C00!#4t x0P?>C*04p8@G  ?dD ?d `?DD` t EKN 00P哂 h 0CpPS1!f p 0 @ ] E RT 7將0S xAC`pP7 @Ax0T@T P^3080 0d`pPEK0 A= C 0`l4 lp R?80 GK Ad4 ?  $ P0WVG>K 0C  pd`Ppx?!*0SR 0#`p0$E-00Tt4 0Ӗ t$10!4 *01>1E>K 0CE>K0CP4EK/0 AE>K0CT4P$1>1t4 0EKAT E>K 0C` 20/ !.1 000$EK bAh4 P0B0 z#PT &X4E.K? B=K0Cx4l d4, ?KA`^#T4S*P010#T4 0T$WVT401T4 T4GKC 0 A EK AЀ cd4C  ?cd4FKB V0A G>K 0C ἐ)# t4B 1 BT0`0Y3  B11 h4S c! bEKB A``? cFKA T 0" 0t$B!BQT ` S"B!!h PT@` AS2 0B0QAh$b@p`PxQwB0T4  a؀Nl P0C XT4 ? NT4$%,00-00pBpQ00B1Rq0QU00B!1@ŔL pp000010S|0T40E>CT44  0 0 0,0s$Pp0'!(!(!(!(!(%(&(&(!(U%U%@!(!(s!L!(TT2!(!(]%( &(&(&( &(U%!(!(!(&(U%!(!(^F04 g@T0H$X 0` P04 R0x 0@5PTV.L0TT0 S:h00XT0S<00S0SX00S0T\00T0T00 TPP0L4HU0NJ1@l4 40 CPT4 AEK A- B ,0h4 E>K 0CЀh4Xa X?GKA d ` /1p8Pd4E AGK X? A E>K+ 0CBd4  Zj  0?`pA>`Ch4 P;0?΄ dG>K0C  R?̈́ HL0Ą4^ H4 000|4( 0Ȁ`2R R 5#< 5230S-E>K 0C51E>K0Cz皸 'ɚT4) 0000E>K 0Cd 0+S l4@ z zzz'z0'08A+S,y4B8r00 S *! bP \P##0࡟ 0 00 d18#p娑0 R00ï& 匁e0Sq R< q `P0 Ƞpw : zG\$ T4 @\$p RT4 00S3 0 L=K 0CCK @A >{!(!( t!(!(#S%ht@ %O!(U%U &( &( &(&(%(!(&(&(%(T!(&(!(Tp "`Q p@C>K 0C+CK A VP CK+ @ze0 \@C>K 0C+cV.;^00S 000=S,[e0S\0S0ӌ4  1\Q,00C `pc0d /!% 1CnK `Fpp 6PP00l4 0S 0Sl40Cl4 0Sl484 0t4 0,?t 0 FKA 0DT4 d4d$h4 0,0RUd4@\4 `4|4 d4 K!#@ 4IK04  ALR`̱\2 $Pdh T)Rd4h$00  C$00e@h4S40A?\@ P? `R0p(.0c d` 4p0h4 040e0$%R` S2p0D40S =K 0C (0t0x0 0Sx0x Ũ001=S,0h$0CR!L40010T0010X0 0\0 00B\ 1`0$%R  B Q1 Ch @% Rh0h00 h $501l0 `R! B Q1d0d 0Rڜ%50  h$R%Q\ ?0  0  B &P\ ?0  00C 0kjp4Pe 04 4SaP&0p&P` ` x60$5S6 l01600060S9`d>0'ST0T000SPUX0PP5RPPS4 d  ᨐ $ >0$ 4 41  4>0000p8080C % P0b1448bQ0 R` ?0T  1! BB.A.A B" @$00$00``Tf08 \d `R`  70$5S8V 00l !10CB>A>A0B30(9000T90S8pd/>0x)ST0T00! !0)SPUX0PRPPPXdB 0ᨐ 4 > 4 $ 5 $! 0 =0000`80@T$5SM\:l0h P0 @+ d14  4 0 T R` ?0T  1! BB.A.A B" @$00$0`0 `VP@p`T S $uS0qpq0S $S0;@@;00;0T;0S ;4 +K000 d4 0 <04 b00l0@ TJP\ V[`<0S  <0P0 U,P`x0 `pLU 0\5S[l`VP|PE<,0\Q|$\_%"APh  _| \,@_d ,넍-0 *@=\%R =0Sj=08`i=`0xQ=` 4Sڈ4@0fWp^ @l0 @ T: (\P@KL|\ !\@ K@@ @hK N |\!\@ PKL08 04 $ <@$=K0C d U,4 `t4S`?0ST4t$0T4 T4SQ.T48CT$?RO@0/\Q|$\'"aph  | \,`d ,$T40T4 l4S20S0h$,00b0St4 20S tO<t r0T4 F>K0C FK 0A NT4S b(20S ]K PE P10S AC 10S30304040p40spgVW*'QV.Y`|V.GVa0S `=S,a01?n F?\0 0 qS 04 o`E>d C+04 `00S0S 004 Y 000 d4 0x0048K(KSty!(!(jQ!(&(U%&(!(!(%( &(&( &(&( -LMpRP` '@P Xd'qOK&.KH (PpP#   pp`0S 8v0< (08 0,0 000040 004 04$0D0(0`Lp0 q` |Ḭ pl dh Xd L`VB  8 `p<  Zp ' G`K:p) pP8aGS!4""::r #6)01XxX 0rx%*0|% 0* **0B0 SXp(KWd@edAnzd@ -@LCM MPB.Kp@; B|p` E>K @0C3@TLT$P 0#  K 0-L@Pf6P8~+XP04K0h/R/! -L M p @PP` 0P0 @00`@U &!D`0`p P(K -@LM P`_ Y 0&0`r0 ?s0YTp`pP` !0be ?$K :^FF^: -@LP`     -`P@L ((UX0 3?X0 @-aA0SRQPSR QP"P0 -L$M#KP `W_0 00K [0 0S Q 0 -SS GS BS "KS MS kS bS gS mS sS@V@@ @@ @@ @@V000%  R)`p_0"S  <)YX 0 t#KV0#K` T 0 R0 0 `$Y%(K -L,@ (:对嬹x%F P- Q\00R0S Q\00R0S -`0LL`(FV@P d0 P 6V0 @ \0<@p*) 00- @   LW 0 -0@vL t'^P``@DZ *000000` cB_B㐄 ᴐp*)8*( 0P-L  C  $ co`   p-L MP@H`ᐅ)00@GV P@ $ KpP*)))   -L M`\pQHGP%@40D#X p` $ K\*)P*)))   -LMP1@0 PSMK0C+P $0K!04 ^ 3?0\ $0K 04BZ+B>K0C$K\*)))p*)P*)`*),*(  -L$M p6`<0 wPP@X"X#W V9 V0#KK( 0t,6倒 R`"#0< 0-400 1> FR`!! ,60&03,6 00C000C00(&WV8:`0!<# V0p#K` K0+,60 0KK!$&?cK`p&e'0&`pK$&? 0 ᰐL0Y)S%  U0: S$ $`0 0d&(Ko{Rp*) 6 Z   [% -\QL,p0S+ FT(:v`P$ 0 0 !0S@S d1 Q R @z1 S x x$#21,60&0z,& 00C0$0,&101 00C 0p*)   -@PLAM K?D@@Px?@0D 1  d`? 0B P"H?pR01<5: T*; (" T8 T0 ?PU> Ro 0@0 !a? 0D0 @ 6F> `ఀ6 Tp$X>`j P0 0`," X&a iF X~0D X0! S 00180b S-505=01 X0 D( 1 X1UC 1 ! (P1!   a R 10i1 1vXrX0 !MBjX1!1 0016 \X<(1dUX 0#,U,033H0#0 LP0@`\P`PdPL ##D `$`(\00`00d0e 0T0;0KK50S K ;PU 'WP  pS004000 6sPw X0f&1U!7P2: rvp0 0'iv 0Kp PL0S `0 0 ! 2 P`1 `# KW,1K @0C3@TLT$P 0#  K 0-@0-L  0k0b:{Tu! A 8 KK0eA00P/    0",P /0)-@=B'0/p/ -L /x% -Pp0`@L M 00 V000ᦞP W- 0L0   P  Pp0 0`0S H0W000  (Ko N(K`0*t. -@L QP@5 30H4Ẕ4PK% 0 $ P00?0 0H$PL0 0p0 0$8p P|x0H0 3PS4L0@  p-PpTPPUPpẔB08P䂟PQu  "$ 0 0 <Up V W0 HBtC x2 "lR009:P ZNP" R'm 0N~^q{ Z @ Xg{ G;Z>Ѐ 0h;@ :k{{*X;h2# X;|QS13e86< RX;2h{8  0 X  QX 0 10X;'  J>{  h XXQ 0 00X;L0 L0 0K(K 𿚙`0*0)0Mp3*3*ipx%Xa%X3*ɚ;;*6e1* -L$Mp@L`P 0S/  !0S)  @0K@ R0x [ 3Q1>0,XX L0h = K`0* -P-Lp@`@OL0$ 0 "T L 00S {{(+S\?oL 27 @,K$Kk,K$K@@`0*x% <0< @80T-L@@&0 F<*Vsx% -LPT@ P5 D1 8- ,) %x% b 0-PL0@ S S 0 RS00! \R 0S@0 pp@y'R"R@ P0@R0 Q$@00x%K!n! 0-L@^ P l00S\ 0@ !0R3 @00SP P99000<*xs+<* -P@0 L `?< 0S P 0C^SB0c1 0S 0 0C!0R3^0 ?P 0*0 00 Rx````p`x`XXr @0 =0 #0%0fP/0 00<*<*xs+z!x%N -@P`L P 0 SR 0S T0B0Q3 0,@   <<*<*xs+<*H0  BR Rp R p/%x% -L@PPMP  <HP,0/S 0Q /Q00/P 0R/SBp0S& P` 0/RR`0eS0.SP` eRLLHP 0ES s/Rx`@臫2lQ 0-LJKSM,@D M<484@0(4$?[K4?,PE4?E4 ? 4 4R=K0C@R=K0CR-KP B40E0NP R=K0C0<4S0.3.0 0R-K B <4R-K B 84R=K 0C 0`.3R=K0C084S3S:D `,>O,^ (a^d@ 00 n=3 S K@@ 0T S S00 0=NK#R=K0C0D0Sx=R=K0C0CR=K0C0CIH=O 0S?D3/SR=K0C0CR=K 0C K0 @0@^ PP 0C0KCĿKKR=K0C0KCR-K BL :K00C$ut  iR=K0C044S2  RKA<$84 u0  u$  R=K0C0R-K8DR=K0C0 B 44$$0dR=K0C0CR-K B0D S84R-K B <4R=K 0CV 0<[hS aS ?S DS dS\ eSw cS9sS pSQ qSg lSwS xSe vSkKJ KGPR=K0C0C@P0 QP : :0S:RK0A 0A>R=K0C0CIKJh KFPvR=K0C0C0 [ R=K0CP0 C i CR=K0C0CKJ KFPX K0@ P 0R=K0C0 CL  K0@. KkJ KF@P;b l90S 9 CKUJ@ KFP%,9,)<0(9(80$9409009,09(09$0 9 0909090808 08080808WK'J KgFPR=K0C0C^ @PH P80S(0 0C!0R3; x80S0S4  K0@ `P@(R-K K B0@R=K0C0CI@ K0@IR=K0C0dL4PR=K0C0Pa :K00C R=K0C0PIR=K0C0L}D P@g h@PtM R=K0C0CG `P *K0 BLC^KK+0AḽlှIR=K 0C@p60S &0 0C!0R3 P360S 0S  KP  KP ,0K 0$C 0 S; 0D09NR=K 0C0R=K 0C mR=K 0Cp W 5 pR=K 0CRMK`@D0G#R-K$ B0R=K0CR=K0CR=K$0C0 S QP1 01X10R-K S B  R=K0C 0R-K S B  R=K0C R=K0C0SR=K0C0S4PUP  P P (R-K( B00QI0P0R-K B00@'R=K,0C0pR-K0 B0R=K,0C0SN0G)3 R  $   R=K0C0S j   R=K0C0 S \  R=K00C0R=K$0C0 S p R=K(0C0 S R=K40C ?R=K40C R=K0C0SV R=K 0C0PCT PE  kKH KDPYR=K0C04SS\嵧R=K0C0H CKKqH8 KlH $KDP<DKcH KDPP3A0S' "KSH KDP#xKHH KDPnK>H K~DPP@|0S `lP]Th000W@.K<RK✼*(K8DD >*<*<*x%!|s+!!\$!!sU<*|a%$F!Cr!&c<*bj","~"E"""""#;#d######$<$"xs+<*X$k$lQ$7r$IiN$$$$$$$% -@0L0iS03S !^PO<*<*'% p00-l@L2   L} @0x 0s n0C*E%J%R%Z%c%C* -LMp0B@|0`0@P@P T00S D0D P@` 0( 7Kxa%xs+<*l%'= %q% -LpMp@1`0B4! !0R3@P 10S; 6WV00iS00S+ 00S ` dK<U@K 0KwO P HP000 PP 0& U@000$Kxa%xs+<*|% %<*<*|a%% d00-@\0 B0@1 S"@L l P 00000S y 0xa%xs+ 1- LRP pp@PP`pL%0S 08 4a4q0 0P0C!R! 1S1 E @U@P`pP0 WV:"0 01S20S V x P]0S  0 @$0@T<* %%<*%s+xs+s+C*% -LM0B4%` pQ0U3PP0  PP0Z0000  {@PP  R R  @  B/o T" R 00S C d$ R P L |P   R  W PU0-(***,*)h+h-h-H-<,H-*H-<,00030S 00 S Hp 0 W@d000430S .P0 W0000 % 000S 0p 0p 0@00X20S P0 00 BS  1 00 0WP 0000Sm @h0 W     RY @ T0 0 `HI RT 0S 4<g@p 0g@c 0 @$ 0p V@S0P 0 t d v0 dDn H(Kxs+%<*% %&&x%B&T&q&C*&&&& l1-0LS XXHP`pHH1 WV'*"P`pP0S 1 01S2 @ T 0S 0S  g@0` PU @T 0S0S l0S ~D (G@$P<* % '<*s+xs+#'C*A' 0-0LS pP @x`T 0S$`$00_P@U,0 @T  ]$@<* %Y'C*C*z' -L M10aRS10S 嫣S |奣 e@PXX SRH*01@ QPP*npP 0 000 0 TpP00 $000000Y 0(K<*<*<* %''s+s+''x%'(,( -LM20S 10b0 O1KṔK@PK}KK#KSRK\ QP*@@ + KQP:0W UT0 RpWUT*P ^ e000<@P#KUT00UT00S P\ =m000800W Y(K<* %D(s+s+<*%'x% -LM@P(Q0S 嘢0S 呢0  000@T`p WV&*`PP@`p0@TBK@⧷Y  BK@000$K<* %l(](s+ 0-0LS E`p|P WV*!@T 0  RF000S ,@`p<* %w(s+( -LP`pP@P PP`_oRP P  0@.0 0C?oR20S (x%(( /0-0L@P$0P UT00C* -0P000/s000 SL@Xp ڤ? ;c0?+50?o 20o0?C*s+ -0 ML@0 0>0c0K p-L M@P`P @TZ TT0/  K0$K?>T@ + Kp(x% 0-DLpP 0`@P0P000a%  -LCM2pPU QYu1@ R 03?00?010S 0S R0000 k&kkfV0000R#*0S HH,0 0S $(#0 000R*Q 0S  2P0PS ,pP@MoK0DU0TS B/E0S0T ?s0 41 峵Ap-K@(K<*<*x+x+ %)")<) -L]Mp3`0S ``ˠ\s\S0X#00LH#00RS0C 0(#00 z9p"(  G?S"> V$ 0"00^00RS x2"00h20Q|pl"pTHPP`@" 041 0.1K0MK,(R-1K孵 002P00S : S wP~E  V hPSvP㰯=apPn eK /0P1V0e?Kq " cKeKe?K " ""#e?K #!@08l1 04 -? ;c0? 040?0c(K<* %d)ps+s+)a%<*C*)))e%))s+*"*x%i%3*R*|X9s+ 0-(@L 000: Sh0s+ -QL@T+ P00S1 崟/0 S00 @ R cQ00S x% Z dAP `QZ :0S 0s+<*x%m*** -AMLM`@PpP0 001/a0 001/PX 0`!`CKCK@PQ @P ,APx@ T xAPi@ x`,0KT# I 0 S0+ C.KCK0CK0C0 00 f<@P`(K*C**x%lQ*!+ -LMB^K M PE.0T 04 /R004  @`p E=P 0S P  -?`@P 0V ;P`p(KC* 0-L0 @P /P 000 0-@LK0ha -L`M$20S 卞r00RS2"0010GA4#S PPC9 +eW0ᘑ`000X |K0 EK<0@xSiSP 0@4'KSR (10S P'K i0S!`|0K|0K(, 0400S (00 0400,0C(000@ `;%$K<* %>+<*ps+)s+e%a%e+L+x%+{+<*<*+<*d+ -MLM@pP@ 0|!|=PP hha`e3BP DXHK0CPp/UU`  P >P @TU` @ K /0-LP\f@P000/00@P 0S 0, -`/dPdpL 0U @bJ-VV DPD`W*S*- -PL=pP04@Sla[`P\v@0@0d0 Vd`P4 $v-S*s+(- -Qp6LS` F( $06@00}PP+L)[@P<>0&(0C0T$  (@Q&WVP %<@ %/e< 0P0 @ PP`0`0@ 0 P , {S*s+C-e-~-- 0-L@~<04D00S* 0-SL@ @0S 0S 7 0S 10 {PP(T ` R 9 PU 0T008 0&F$ ----.S* -L@`PP0U  0P0 @/eP <1=0P 0 00. -LlM2P0 S /20St@P J@X TLI0``00p00WV 0 0X  0 0 // 0`p`p WV+Y" ( K+0儠 00 0 0(p0 0KS0h0 0S0l0  0S0d0 $0S0`0 0.`p`pV 0 1S0K0 0.`0T \0 #K00 $K0\K $K0 0X 40 0.0@ ?dX 4H (K<* %'.<*+x%B.s+S*s+ps+s+o.{. -LM2`0S uVr 0b[P 0 00-000 P y?h d\x K(P j? 8 ((i L@0@D/[PP`  P Q? P 0 KvP1RQ rQ K1 QP P0xPtX d1T -K -KP L10S, ,K( 1@c@(A @DP0S#0( P0(CT((0P< <8P 84P 40P 0,P ,$K<* %.s+S*.+x%./ /,/b,T/<*s+v//s+ps+<*//@_3T궆꤆ 0-P Ls+/x%p/0/ -LMx 0 RQ  Q 80R ,0P Kx+Is+/x% -LMH0  Q0 0P (( KhڮY*s+0x% -L M0Q# 0@T0$R ||2 4ASAK  Z L0 KHPD>, Ka%<*Y*x%I0i%ms0 -LM0P0S 0 003/00S@x@ ?p50 QPP0`PP>P 0,,j2K<*w+]*<*Y*s+0x% x00-t$LRPd@ 0SP PPL0L P0000t$0R0 t4Y*s+000s+8^* p-L M0@0PS 0 00x3/t00Sh0 ppP0@P`=U` 0,, Kp<*w+]*<*Y*s+1x% 0-P0@LP P @00t h0-`0L PP@H0x`P [hWPx  NPs+i%Y*x%81 -@1QL0|51q0aS :`pP 0 D0PBP@& a:P P>= 0pxP 0=X 0LT4040Kh:s+Y*<*|s+%xL_1g@_* -LM`A,`K! f]L Hi D#K04! Q $A$\81Q?" 0PO/KZ, ,#K4 @ H#K0  ( 48Pp00"0Ax)t t%h嚗00@ T2(Kr+1 %s1po+1~11x%<*11r+1r+111 0P/0 4S Ci%Y* -MPL M0E9t44S P  50SP8X ``5988 N|` t5K0 @0|5PHe p L50S )<<88;2  \ 000)!KJ>KA 0C 4 QP I>K 0C C4 QP !-K>K 0C Bc | d00pTU Q\400RS L40S`, `P)9S)$4$0 4 $0404l ޖj,BK  @00 ,4[ S BK @`PlȖVT–BK @`9S6 B.Kt0 B;BK` @` V ˖̢0V 9fi r "嗖-,BK  @⩋00 0s0SD8 BK @8P,4[ S BK A ⶫ 97D8[5 $lrR ` Lpw 4"4pV 9嘁<98890S 4)t,8S 10S3,4 U4W9UBK @mPE=K 0C CRYPER0PbS P!UL1L0 PUJBK @N0S? ,8S F$t4S @0t$]4W UBK @/PE(KY*2<*s+<*3 %x%33ps+s+34L4|s+<*s+s2_"2Q22/2233230BE3[33^i%@_*3X4}44po+8^* -sLM0 |5 CS` 3|x50 x |%+0&909909R; PP 4S x t x2 4@S Q00P0S 20S {09$R ?oU20ST05T R dZP@+ (" R  ?T@DEIiTGM1 R R R ?P  10S"P" H1@xE : 4S @  0 0 ?2pP 5:  ZT00S 4S 902; %lx+%0+x0|5%909909(KY*s+i%<* %4<*4x%4s+5)5B5P5<*<%j55<*Pc* p-MLM7@0S&6PP &P P P6 PR60S 塔00P x60S  c004488<<HHLLcccxx|]|c9^E}cEzc:^EvcEA^K PEeP{ 4PF Pt4 `R40S 00   ~ {  uu r lifcc ` ] Z W T +80$#$9? A $4 0? 1#04K0222020?"#3H0?%#?&3,0Z120R0AS4pppHqpp0 0%?")x30000" X2R 9? |#:? @  ?  ? A0 ?%8 ?&0 %0L0<040100S" " ! Rd PaUS! :N D  t!0 L0!QP( dQ=0CS8r rHr`r,r,8 0 0 $ 0*9-0CS  A R0 R R00Q^0l=090- PKp<*lTx+<* %5kx+5<*i%Vx%55Y*6)6@6V6y66 -2RLMP0000 00a @ 1R 0AS^PutDus,uA;K,0CCX  CAKA;K,H@0C03/0 4(K,L 4S AK,N NP0  NAKA;K,H@0C03/0 4 AK,L LP0 LA;KD0C03/A K,@ @+R0R @0@0T00S@PA;K,0C CR0K,@ 4S0S 00S 0 9P A;K,0C  CA;K@0C03/d0Sx3 P@ H0t$ 0UA K,@P(Kpo+T17F7Y*8^*\g*i%<*s+b7 %  0 |Xs+ 0-@L0SS0po+ -LM0DƟ@0"(K<080 #*K0P  K *KK&K@ t d Pp* R`y  Rv  R  R R0  R  R 0 [50S  ttOh% R @P 0 <. % R   60000S40S%  i 40S  #P*K0 |KjKg ii\40S `0 D^# R  4 $Y# R w :0 ?P5^ 0|**K0 |K"K JJP30SB P \L`0 620S  $3YU20S 6P5" 0@*K0 |KK `20S 0 `hcyu10S  10S 10 Y-|1Pp >5 0lS0S 1003/0S00S <tX0K  d0 2/)Y 0 g0 000k*K0ᴐ |KpKp pp00S `0 L0p|p5 (Ks+7x%<*7 %|a%77Y*XY7Dx+Y*<*h8<*18ܭU8f888<*w+]*Z\\8 2 -LM10 ( 0, , S( ! 1 1R1t4SP\!,t4hQ0t4Np@00000S `P 01HP,0S,0`;C,0 0V00, R0S ,00Pq|P0S05,0 (,000P00(@,0( @0(0 x( !0 0  QP $0HPH3 0t$ Kpo+s+T17F7Y*8^*88s+8 -LMc0S CS 4S  $R0 K0S 4(#0$$i, 3s 0|54S620S2xR00|5 4%S P3 l;; ; 0\\2@00@%S ) 8&0P$r|5"0C|590C990C9000PV 儎4S 1!1Q09090 `0 S 10b90Sx10tSth1Cd1`1\1KT)P{3< 40+C? R0 0B 0S{P 00S )dbM0S \.y@00S 000K<* %8Y*i%@_*<x%<*s+<*9O9*9o9po+<*99kTI<*s+s+r+ps+999<*3:,:xs+s+x+ --LM   a Kx% 0-LMx0@0PS uP 30 @@^ 800S 0 $$K0hRK0<*[:x%<*: % |00-@LTP 0ξP2z 0884000S   +@0<*:x%<*: % -@PT`L UT *sP 0S 0@Ps+ 0-@PLUT YP 0S 0@TP0 00-@Lᝢ  0  xh0 dPۢ0 P8բ0 < Ϣ0@ (ɢ 0\g+E%::::::]g+ -L`/P 0P@ @ 0C 0Q3 @P xs+:x% -P`L "p00CS0Up@0 @ TyTnTyDo00CS0? P0 0 S 00  |s+Mx% --L M L :D00S 8P@(P  Kx%<* ; -RLMp`P0@T")P1h0 R0@T3P1W0 lh\@ P00S DU@ p 044@K<*+;\;x%;<*;&;; % 0-@L   P   P  P  l$P p L`0Q\ \ , L8K0hMx%;;;;;;<(q,<<<O< 0-LM@PPPPP0 P 0 K0Z<j<q<\k+ -MLM0@  d0 00_AK@x,QAK@K{< 0-0LS@ \?|0P0Sl P 0@000| 0@@K0h4400S0 $$K0h*<<*<x%<*< % -L M/PP p/@@0S /Sp`P 0 00J`000 K 0-0LS@  0S 0 000p0@0S gP z0 0@@K0h400S0 $$K0h<<<*<x%<*= % 0-0LS@ 0 000l0@0S P G0 0<<K0h000S0  K0h=<*<x%<*,= % 0-0LS@ 0 000vl0@0S uP 0 0<<K0ho000S0  K0he<=<*T=x%<*|= % -LM0`.SpP4A0/SS Š!0 @U 0岊  嬊  .  (  "  p  xX  d 㧊00@ @$K<*2===v======1 -L= -L MP`@p0d0Sp %K宺P%0[ S000 K``MJ\o+>=> p-LBMCNKM @DP`<4[E CRAK @V A.K B*H/P:<4[FS `0 AS *P0P S00@,!KpOU\o+R> -LP@`*<0 9p*W }Kh\o+ p-LMn RP@x  0SP   PY0N`P 1@PP 001 E0SP _S-S XOP 0 0001000:PLU4 1`0PK5 S:$0 $0;0%$0 S``0 0PK0%`0   `0 `0x pP$0;C$0 Kp\o+\ ?>>%>>do+s+ 0-LBM@P0, EK 0EK  4K0>\o+ 0-$@L R0&000\o+>Γ -L M0h `<K <KPPP@Dp T  daP@K>2\o+ p-L$M0`PH <K<K)4@ <K1 -Kp>\o+ -LXM0$ \KP \K K> -QLBM0 CK CK K>0/ 0-PLU@ U  D 05 0K0h%*BB8B %P 7P P U/ //SB`BFB -LpP}0@`V 0000!S p h @- 0T`0 0 d DoP|,{,BwB 0-L4P0000+ P %P $P P  P* P*0P:P1:P*2 4S p0S 004l0_ Z@ @@0SCoR#Q00b0000{,H0`  BR` pRp RX Xp/% % 0-PPLK0hۇ0CU30 P<,@ P0@S 0 RP0>K0h % -LDM@Qp < Ktp P T20H`K1 RR00uq0PS00C00p Rpd0KAT1 W(0S% U U dKQ, dK%.0  dKC, dK %`0L .@#880 (yp W %B>x,pL|,s -LTM3@0S Q hKh^ X314QHHU@R00CS444,ܢ"1  '  d0ASltPL D@<8 ,    0SKhfu4Km$1g0CSC(($XX/[20[0[3 [1[4[2'[20[(([3 [$)[4[ *[+[,[-[.[ /[0[1[,1jS!K "KQ Q Kh^p( xKhK{,B>!BBB?C@!C3C0C=CJCXC_ ]CeC5IlCyCCC[HDD=D@FD -LDM@rb,PKX @%@并H0K0 0 @0D0 "0@0 @@P0K DK<@ 8@ 4 0@ P\p 8PPPp #EpP@@P0K DKPPPP0S t0S HPPc @㨡T4*0S  L00(|10X 0# 0S y ST10S00\0 p*07S *,00S 0@H%0PKQ ]x0 `0 x`0P@L ILH*t(K{,P|,OD eD{,DDL|,~,D{,DDh P-L K0 E@%Ex% -L MP3 `R#P0p00 P P@ P P P  @ @ @@@0 0m'PW W W"0000 00Z< "Z> ) P0`F0L~p W aL^WLAL^7L\  R ꐫdTp0  0 0 U0d0a[]Y0K/ 0P0W0 S d10 Srp p  f0</00*rP W00S`(P& paP P W ;sP0 00   T 4 (KP|,Dk%{,PE~,B 0-P(@LP &P@0i% -0LS R  R R Kh Kh&0  1Ix,  -00ML 0$0 0 0T K[IF9IEIP P P >qIkIaIzI -L80K,MD \S@3@#* 0@ "K@I 0-PLM    K⼢@PQ R .PP 0&P,  K0y,x, 0-LM0PQX@ 0@H4OTd@Oo@5_UT ! "U  R sP Q, +T%<@ _"T%(r @ tTT% qr  @T @G qr uP @P( ;K0x,IIIIQ p@-p0.`Q" \@LP!` bQR00 0px,@z, p-L M0@ `R  P .rP ,B  0!0S,x7 PU U Kph0Kph0$  KpPk%y,x,I -L M@T TKhKh&0 KIx,"! Q 0-L@P  TDK0h (K0h0 K0hpi -L\Mt0 0@h0 "0p d0 \ p@@l0K hK`@ X T@ 3PlP A`P8@@l0K hK PlPPP`&qVZ @ttTQ*0p  JY y YEx   @y0P x Dy,x  P10PK1 0!S00C00  QPP p0 Hg 0Lpat01x xg`00CS`0\ QX0 X 0@(KooE(KODIIPk%%xI % -LM003 K -LM0  ( K -pL MP@aU64 0 -\P0 4 P P p@@Q@@PEQEd0S@p(KI 0-@ LM 0K K0 K -L" C Jx% -LGJ -AMLMa1p0W 0 0@P0qaBK0|!|@]BKp@h0P(4 0 PB$a0Q XNEQJQ -L(MK H0 $0@0080000 0(0( $$0]%QQQQQoQx%OQ -0-LM(`@ PXGP0 R D0D0>  #$ 000K0`k%!,h,Q, 0-PPL@ $0S S S*S+S-S0S00S0$O llK0h0SH00S $?0 0U0$00S0l,p,,Q<, -@LM` (0Kp K( p \>PP pp(0K p|00Sp0 hX`(0\2(0 @(0V*@ <K` @0  Ki^B R,`k%8y>RB8 0 R ( 000/  7,,`k%,KR -JML M1p0S&%=.P@PKK0 @# 04 c?4 40K>K0CK.K`C BKKP`01 BA4Up 10S;`;}KpG 4 #A74 $ K0A1$KK$  $B.K@0 B@,D ;p#ql l4SLT L00S@00SA.K B( K計,rR,,RR,,< -pp1L0SP@T10SH! R T0! RT  1$KkS T0 T}`0ST 4$KkS0  0eW0S |aQ 0S`Y PTTD$KkN $Kk ,,, %`k%8y!,CR@ -LM@1`0pSPq10S! R Ug ! RU  1 Ki%S Up1p U\X1XU  Kih`0S$ S S/ 0KwX0  0   1KhX1[     ,KV"KX t hhU\ Ki Ki K,,, %`k%8y!, QR!R DS -L$Mp 2@ `RP T< ' P 1$PK e@" 8K ˕80KT 0S]0Sw"0S@,PK P@P<0K4 KpoCU 10S=1 @R 00S#KSR 004 K00 00 0 0U 0S x00SK1 QP 0, K000 0 0u K謈,R,,, -LMb0PS@ T㠠 p4 ,Kd)" 0p Kppbp0ᱭ 0᪭Y 0Su ᝭p  ᖭ!0S @`K `@`0K K0poUV \10SOP1@ R<1 R 00 K00lpK 園0K 0 dK<00 K00V# 0S00S 0 K00DK0 0 0 u0K00H 0dK0 K00(K謈,SS,,,3S -P1L0`S@l1 pR\10S P10SD10S88KhQ,10S! R U RU  0Kh7S U0 %U0SU KhyTPDP@p0fTXU D Kh,,,l,p,,=S, %`k%8y!CgS -MLM2p0@S jYK,PET`D ?PH"HKJK,@D   $忑`V,  [{p0 V  )K8 B  9K80C"R0 P S !031d发`:00@0E poAT 10S;1 `R10S 00* !P 00 00>T 0S00S K0*,A  K,@@0 00c>(K謈,fNpv{SS,,,  -L,M@0K #  $ KpZ+(0S  00S00S 0 $Kh00SX z[Z[{e[ j[KZ[fke[KK[K+SKS,,,!S -LM`` KhW00 0 0$ K0"0K0P01k0 @9PPb$0K|@#@ @@ +pP 0R  D%0W4000 @0  10Sq 0T@p0 K>@000!KKU$00S00S 0"00S|@`E0T T \v Pr@ -$Kk=$KSSl,k%,,,!BS -L@M`PV20S 0$ K 0"0<K0t P( <00<0 0<0 (0D0 Dp&9@Ph@p p< pr(  p@0K pVX<`D0v(  0b@ S  v`p㔑<( (^("L 0 "L 0 !L 0!!L 0! L 0"W 0G00 8K⁾8K00S 0( q<0(`s p< r00W0S$Kk<t00Sh00SX庾"!!!! 4 ᯾$Kl,SSk%,,,!S  0-LMP0K #   Kp+ 0S  00S00S 0 Kh0 @RX0 Po0SK*?P g!K bK0S,,,`k%8yT  0-L(M@0K #  $ Kpy.00S   0$(0 0, 0S00S 0 $Kd00S X0,KPu 0@S0 $K0S,,,`k%c"J<&T -LM!p PR 0t! RW h! RSS1 T10S) @40K@@ Pp# 4Z 7`P ,0K# @@ ?p 4 00R ; 0f(Ko;00SX  00CS$$$ $H@80(Kl,p,,,,,1TXTTTT  -L$M@0K #  ( Kp$,0S  |00Sp00S 0 (K L00S<f0 00$0 (0]KS,,,!T -L,M0 8p00PS/0  YP` Ki褍`e @HK$0K`HK,$F嘍$啍TP K`k%,, -LXM@PpbQ1 0S ᧮P @0d K!d0K 000 0|t0K0P'K0&KS R S @0d K 0d0KRP@`$K谈,tN6UFU -\JML M@ktlp t e0 `fooWb` c$ c/V g 4 $ P lT) U 1UIK0+;JK0@P0S [ KZ0IK @0+; A0 @0 KZ @0+;JK0@xKx+p; TRT X;0S (H w+8 r HR,;,1$ jX 0 0 b0 4 ]@ Z 0jTpp Pj ,1,-jPp0pS , $,x xjpP ,X ,\H HjP  ,( ,0 j\  , , i\  , , i[  , , i[  ,h ,X XiZ  ,8 ,T( (iZ  , ,(hY  ,,hY ,,hXU BK0(  @Z,`BK, AL@(x嬻HQ h姻(`夻 aXL8$0S  RV 080XSQ XQ3`p;mK `F 4 ;4QJ4 1B.K4 01 B0F  p`$tW 0,$R(0($RV5`P  BK41X0@sz9X`@7 0?o2R0SX00Cs 60ShHX0@sdXU`0S``VN XPP 0S-Ͽ 6R 0u 0 09p 80S: R7T=00D@ 0P0=S .8 R0 0P>0Sxd ` K00 SK0 币 c?K,ᬁ 封 ǁK>P 0p`1 V =0P01 0 0@A%P  Ta  ,0P 1 01 P&Z l=z`- \ X=0Sm7T  mKs1pT  0S0SPZpP,Ty P P01  |P01  `P PP01  4P    PTG ! !mK %s1 T  0S{0Sv  P$T) ! n!mK 'w?KT X oQ\Qw?K0!QP10 KdP=T &A 1 R< aBQ'(``````08`````@H`l``P` Xp ꀐ    ! 01   aXT W 0HS񟗢,x mK 1`Tp l 0S0S0!QP >K0 1` Sa 0% u mK ~1`Tp 0S0SWV 01Kq?K0C0 1` SQ01 NaV@  8VD*D / ; mK Ɋ1coKT 0Sy0S `  +K1S0 LX WW p X 1Sd;  01   0H06X& SX0S AT 0H?oT20S0H?oT20S0H?oT20SXX**1sXp0  0p01 _P.0 0%800%9018@ ;0KP  1nOKU01 1S&1 0 ! c/! 4SK @5k/KH4p8 1  1Z ! , K1   !`01 00K0 K0SK(p^ 40So40SkHX4$"a P` 0=S #8 R 0X 0P30Sp 0 GK@ 01 c?jK1 pl4i/KGKGp>x30 S``@K ", K0A1 GK  P0 ጀ a p[ dh30S\30S 000CS<#<#1"DD <3  0P 0=S P"8 R  = D@P 2por,b0S =002_oK1 01 c?1 40q?K0o?K0-K|2 K p X0S 0 0,10 0H 0(Ko210000!1smh(K -LP@ Ӵ ϴ x˴ lǴ `ô Tῴ HỴ <ᷴ 0᳴{x%Q^^^^^^ _+_R_ x00-@LTP`T P  p@0務@h (0<,`__ -LMM @AK@P (AK@P4Kp p-LIM M PAK` @qPQ0KKAKA @◠P4 54 4@0S0S AK @0ST 0 0S AK A㆟PKpp__<, -LMM @AK@(PL <0 R AK A`PKp<, -@LM M.K@; B pP KI I H'-K B:pE i9V`p 09V /@P5 I i ~P p`9W:"BK`1! @Y-K t1BK  @HP B.K BL BK @P }B.K( B<V19S8'-K BP1`'MKp@D8V**0S$a009BK0 0 @⼲0Y-0K BK  @ P LB.K B\ BK @KP AB.K8 B`@J(K|doCJ8y<,_`edA5` 0-LM@K0$`0 |pP  ,pP0 HP Kh0(ƒP 0KD^ -p3MLMNK@DPP (Pn 0(8K  ``PP Y P PP I P2  ⾋ `P: 2P xP ,PP0 0U,00P`40S ~3vX K 2 " P@K@BPP k3K@1!@P3KAP噗\`ZZE_oRT10S H< F0s <X@PPjX P W 0 &O0 opMP C <0 \p(8[S K@P  3p4V2 0/WY o<`?`<,I`JS`d`t`` p```x%``a --LlM @0 倝PPʌ2[B+0Px0 l  x oPP!U  82T T T;d0 5Ut0 6d0 5Ut0 1d0 4Tt0 0SdK`KB4Pt0 0d0 4Tt0 00  ` 0 00R0S|0 0l0  x0@` 0l0 @T: l0BnS01l0 <4P0444$ 004l0(4(0`0N`px0X~:0S 0 Su|0 @PS`pm Z 竸J0S?(K相&d ? `0 ll d0@e?K(K ?@(Kx  {{'00{ : 02$00\K4pJ  ?"4 ;$TK p  @e?P"4 ;$LKp \0K0 `0l@Ұ {{'0{,0L KTKɰB~0S7 0ǟS?k&Kt PA @ 4TKp h004$;\Kp \ KTK塰d@h0_ 0  0 t0 4/0Sq 0S?&KF P?@4 @$;\Kp| h004$;TKpr g?40$;LKpg L0KT K\K[Y@Bb ]bhb-bܔ4bl;bv#bbbbbbbbbcc+cBcocd@h0_ 0 ? 0 t0 g0?` 0 t00t 0^V\ڐz 竸0^S?ǟ'K相. P`p0XA4`@$;\Kp 4TKp$;p g?4LKp$; p {{'\0K0{`0 l {{'d@ g?Ġ_ 0{7  00 p0 0( `04 l4帯x-@K(K Y@ccc -L ˭cx% -L MQ0 0Sp P@2`@`F┆$PV)YK0h040 P40W@@Y0h040 ~ P40WPPKND^E`F@DPE(Kd,^ 0-MLMQ@4KAP6 KK A@P8: S0  S; .KK B@P& NK@DA^KPE 8Ů00X S08 >K0CC0S n0fpxd.KK B@a@PKAD0.KK B@TPK0dd,Z)dpd 0-P@LQ  P @0 |6 t0 0 R 0S P>%D:%P0 00( 0$ 00l%,e-xee-T,, -L5400S (0 0 pp 屺,,dKp, @T0-L@h5@00S(,0 $0R  (唺,,,-L, -MQLM`@p@(q(Q0 ɮAKB>K+ A?P@0 $@0差&0$[000nS ?S aS"@0 @pS qS@t0 @| l0h i 叮0 D刮Ke,e%,e%,eEH,ef$00S 00S/H,, h0- LR P00S 0K 0C0!CC9=P A>K 0C!CC0=P 4S$4~@PP 0 0$4T00aS` 0 `0V``T 0 0 00R 0 AK @ u$4 U000S0(m)Kpgg-g,gg,t, -1ML MX P\ . L4~P>K0C8$CC<P @ 4 @2` 7P40S@[ Sc\< 0S00 \ 7@PK0S 0S \<P x3x#0K0l3 0@ T3TP3PT@300?o2(Q30S  3@ \<P0002@b0S 2PUG20S @X<T`1 T2 K\<P @2\0K042 0@ 22P\<QR100?o2'Q10S  1` \<nP0001`, K- \ >K PQP<S\<X+@@\ qU< Q9 0S6 0S \<BP 0BK0 000@d 00PR000?o2p'Q00S  l0 \<P000D0K%b-g, p,,,t,-,,ggH,,,g -KMPLM4 0 4 0@04@S , 2p S 4SK K! A@;PK K! A@;P 4S4>PP T 1 1 0 00Q0 BK @Z`0 41 pW(1(d<KK HH\ZpP 0S (0P 4E70 QP #R0p4 Y000S04X )@0p'(K-gg-t,,,,gKK0,h0 0 00 N0, hQ0 0 00 C0, h -KML M P #, 2 P=K0C"CC:P @`2@\204 4LHP <2 0SD ,2,c  0 0PK^KPE`E 4 0S  1 1 5@P[10S |10S 7Pl1 U4P \1\!0BK0P1 0@4pS ᅕP&   00 0 00T   /o" B(|0t@Q00S 0p4P000p0p/0@ K-#h,0,0h,,g p,,,,7ht,-,KK hH,h, -PLAM@ [+ pP0 ٨ 0 A^K PE `E [|0` 0p0p``0+9P 4[S P0 AEKL,\h-3h0, h0 P/3 P0-L0@+0 0 哨000-,whhh P-L@P 0U/o" &  S00P`%P0U0\PU*(0$0 $W00,3h 0- L 0h,- P-L* ,0 $00S0 Khb-,,h 0- L 0hP,- P-L` Q!0?o20 P *@ὣP ḣP0 D7P0ʤ0 0 t0 l@p0p`Q\ l 0S D0P ݧ@Rb0S0 0-,3,,hi'iRpT, 0- L6 0=i,- 0- L* 0Ji(,- 0-,@,0 L 00S 0 0T,`i-, 0- L 0miH,-P00 P0-SL M` q )0AAP0Q?oѣ2P )P $P :0开,000Q R Rxa00 P00\80H00Q( < @00 K-,p,3,t,,i~ii 0- L 0i,- 0- L 0i,-P00P0 S-LpP )P`@ṢP 0  ᱢP ?6P 0x0l 0?o20X@` 0S4S4  4٦0S000-,3,j,jP00 P0-SLM   4) 0 'P KK7P 0Ph00}Sd00S X0Xa0LP 80 00 0, 0 K-8jtj,,Ijsj,,d, 0P0-L P000 P K0h(;@P0&pXe4L 0SD0 <`00(`K0h$-,{j,,jjP00 P0-SLM   ( L0P@ KKx7P 0(GP 0 K-gj, p-LM P$ ( L1 OPK 0C dP8H K (p \8S 0S @HT 0Sx8P@ 0S= ;`P9 fP aP \P]@R t00048 C*@@ GP @@8\8 (5@8*@ :@;P 00/*8 @HT0S 8HT 0S /T 4(R K@^K@PE PP 0P0@@P48T0C?o20S 04`V 480C0Up pW )sppT` `V s```pᴣ3 Q h( mh( BK H+@8P8 0<(L8 RH8 H3L(  KAl( h8 T *h8l( 0S<(3R @PSX(\@)P Y Y KA_ KA j 0"0'U00Sp/ 48SP/ひPP0 048S 0S + H0KAL8 0T P 0S 0S10}SQUTO 0SL W K+ @"K+L @K+ @NK @D+X 0T PH L( K 0C (.pR (l |(h x(tEV>K! 0CTd `E ! P 0S 剑P(xP 0S T Tt>0S(dy#m( D>0S5  /P^( [(>5S 50St5S(  0M 0 SK A AK A =0S ]K PEˁP' t5SDh=h-h * 5S MK @D*āP=K 0C=L 0 *00 P0 V<0S< R* +M%E|< = O9%R %RS\  SP  K-0P 50S =K 尡စ0P> 0S; ' P4=K 0C @C]Kp@k`P& 0S :%0P!Y :  @6 O@60S 50S P `oP@@U }@F 6St5S(  6S ,: 0` U%P E%YP , Wp:0, K " B1P5 T5 X5 0[>Kp L50X5S 0S PET 0S 0P  .UK@D*0P5 ('P  K:UKKN00w8 S噘(,0  @RT0@UUH  p 0NNKԈ @D0p@0C.K&Pd80S h CK 50S P N>K 0CC.KP S@PN.K BCK$y70 S00?o2%P~@PP +F 6S|%Y|G P<d\) *[P<W70SeFT8(&4ѓ6@T =K10'5Ó@x%(VK A x%v(K0Vo(l( 0 \GN a( |圓@t60ShU P XP( D6D&QG(060&0A(u6弅S`e5TVPX T50S |6 k@ '(V 50S <6 [@ (T ((p pFx40S 5LM5=K0K 0C 0C 0K0[>K 0C0-K=K 0C B(5P P P #5 RP45  50|S   pU 5S\45 Pw`5SOS>K 0C SR (P0S>K 0CC0 QP2 SR Ÿ@T020S0 4IM+2@00  00 p`S>K 0C SRhŸ QP%(@8ɒ 5Sp35  / + 2$ R2"2R P K1B%220c>K0C6s 06 Y>K 0C0C86 =K 0C0C4<6 FT 8R%(P Z 0K0 A;x0&@RL 0"0C?o2? "0 0b>w6 R06  ;R Pj d-6 R R 06 P, wuu,,u v0,,H,,_vLfv,L,vvqqvl,qvvvww)wIBwTwwpm , hwuwwwwwwx,$x1xuuwhhBxBVxxkxxx*jx %|QkxxQM l xCdmx|,y;yNy`yyt,y\y,yT,,|,y ,z,,T HP `0S R? 08}[K L L6S L?T L[K A A00SG6S`[>K 0CCP ]C R C52'P&Ps  [K 0 L L RL%p0xx ,  ,&  ,D6 0|pD6H6  H6R #RX0pY _10Sq cKAR0 # 2c.K0 B02H@iT0S <h}Y>K0CZ>K0C P50SZX=9 =X = c ޭ600T0SQ @@6S6S0S%{'P~LhTP`T l30S?&`P uU30S3P03 ?P03 3#r%4R!]K PE SR RNK @D| !5e 3/e |pl4@a| ᭐4 R040 6 |%T$6s 6s$  6s 6s  5S  &6s c{5S 5S 53/5%0R 5S 05  K1VK @.[K @[K5S  05 6S 06 5S  05 5S  05 (K p-L MP @P  P F`P  P 0 d#U 0S S0P KpTP 0S  ,0PP Kphssss%zq -`LAMMAK(LA-K0 BAKJK,L0,@DA-K` B4@P ራP_  ,D4u,0` R `5000@O PPL PI P:K,0C4b"pJK,@DA=K(0CA-K$ BPP&80S A K@0@P 4D04P0P400S A K@0PD A Kl@P 00*S0 AK AP0,0-SAK A0P0 P0,00000 /R0 *R0 ,DP0,000000Sx3 0lA-KA K4 B\@0gP A=K40C0A K0P, @A K@Py 0 00StA K@wA=K00C0lA K@EP 0!pbA K@;P A K@5P SA K@,Ply0 000CA KH@P A K4@PP6A K@P/P 00!%VKVVP V B1V 0V<p1 0AW 0S|q7t!0S`h2D1VP10S @1 <塎0 0A K0,@0 k S 0 厎S 0 X = :P PXXP P0 W , P(K%Cz,Sz0,bzzzz&gzzz{){/{1A{f{t,{,,{{{{ 0-LM, ( l 0 $0 P T10S 0S$00 0 A  aQ @T.$0, S*$0( :֩P# 0( S00$0@p @T P 0|S  00 0S$00 0 $00$0 400S K 0s :\,,<  t,X,,,x -`L$M@@KP d000 04@ (0 ,0  pD 0P/S:S4 X@| L  D G HD:" 8>DP/4@ @P:pP\@0@M /0, 0G , 0P0PDK>@PUPp04K00 j|0@@DcT@@ 4K0@ 0@0CcSPATD) ,P %  K\r]rs-PP00/ 0-L (0@  000@0,t,  p0-L \00S P0 0Hppw8 00000$ 0 0ۘ,,,dKh,d,,t,  -\0LhM@ d @pK80 0pK0ssw 巘,|,p,00CS0 Sp0 S0 p/ @-0LhM@[0 0 00 0rS sSd ld dpK]d XpKPP0 0pK0ssw,u(ʲ,,t,,D|;|l|,p,J| -LLM@` T?&K%K  0?&KHRp t T LKx6&Kp%Kp%KR0IK0 P %KpXwP"0S 0#SNL  0 %K R0%K t,wpP0S 0#S4gX0S 4K R0 #T%KK 0%K0NT <Krx$KKPD 400SZP=9 =P = c 0PS h0 R KR0L@# xP w(K ,, 0-LM@PP 0Kss0$0 U 0Kss0000@?$K|P T[@U 0KA0T00K0 0-Lv t0@ Kd00S X0 0Pppv@ 000400S $qX@0,,,dKt,,d, 0-LK@#`00S T0 0Lpp]v< 000000S  I0@0,,dKl,,d, -@6BMLM@6@ @58D 44 0D K-|-t, \,m -@FML M` tD   GK0p4 3G.K0l4 F>K 0C 0ChD >"0P SP!0 83  03 x4,Q3#xD 4 E~KT 0 P0Pp2C.KP "CK 0圢S x40S 0C.KC xuPP CK\4n 0S00?o 2Pt@  C0@x0 0 P4 14 xD Bupp4 n1pKP$ 0S004 0 0C>K uhѶ`a`̶0PAPSp < P xP t 0 0S 4 0ֈHP@F>K 0C0C @4 t4@,t4 s  tp  $0x (Kx,T,l,|-,,,I,BwTw|L,-*}>}w 0-JMLM4 J>K0C⼇GPU`K~K  7S twPtqm^l70 0 0TK>K{t0S;@7@W0S/ 4g0S+((7 Q4 $ i$4R P 0S6&D0S* 600CS6BZ. 00F0S PK 6PU s00SD6\J>K0C0F>K 0C00F>K 0C00F>K 0C  CP? 5B 04 C>K00C>K00C>K0C.KҴP04[/$[R.4[S-$[R50%S4s0?0U0 ]Pd,5PU r0000=404HPlX 0S40Sg0 T40S Z0s `x4 4$STT샟0S00p {r sPlVk 30S 0 |sp P|sPH30 0,0 0(ps  $ J.K B spLLlV肟0SJ.K2`0S  0IK [2C.K P|2|b0S0C.K0 0=Y8b P 0S020"00SsZ00jZlV  2 0S c04 00 K>K sY`tAq00n1gA`0S04 00 K>KraZ,1(10PC UPPSPU 0L0 4 4p$0d4[E30S 3>; 3 30T8P bxˏPGl d3 0 ,L P@ 8P   000 2 ( PPB000YU h 0\0( 00ԃhP `~@PyTQ <2,@y82P0 S $R0S S @T 1Qo0S ( P D@T ( lP 0S3 0X10S D1o410S 1 fP00S00S 0 Yh8ec00S H0   K0h,ggT,,-,C,1,g-d,d, 0, ,p, ,,,h, -LM \(   KH(H  4((($( ( RS 8Q 00-S0S 7 7 770S00 00 0 70 哎PPxGP 0S& IL[ DX < P,70 6= 00|S G 0 @ 0Sg 6 l6P60 异 0S 6K0 0p0nP0: S 6 X劂5KP2P 6@00 .P )P&50S 0CS0 p000000 0^PMgl5x bP h50 0S  PWP @5 0SH5 R5%`5R P 4D0s  4@T 40S 3 R0@3@30S& 0CS0D$p00q0$4@008(4PfgPe|0 S^03\$S 00CS00墰pp W!cT K R0 #+K ?+K00@ T  0   0 0p,+KP0(2 00@ 2#|}f00@ dvf0S 03/00 @@ p1 R0##@t1@ 0S1@ QPAl@0S ޯ00 41 0 R00s0s 8APl000S0S0S 03/嫯80  0  K,,] ,,T,,,,ĀT,,p,, x%LQk-|M|π0,ggfv h ,p,\d*x,,x,P, -LBM1 0 ! \, @1 _1 NK@P<<,0 4,4<@@P@$<$0 1 <01 to 0S;0S#; 0RS 0S 10-S 1S ; !址;!嗀0S  ! 00 P+ R0004 0 0P(KP 0S 0 S lPE/@0S 0 S  Qe : `P6 10|S1T001TX  TL olT/00P0:0S 0 SnkP 90S 0 S 90S P Q 90SuPN9t90S   9\)490sS9墋P0S 1S 9  P 10S !PZ 1S0S&\zP8 1 8 8 &10|S < @ 1S( 7 7 8  1S7d0 1Kp1kp 0: S0 '0 '07 Rʌ7'7 R P ,T7dG L7PU 60S 6 R0P`6P60S8 0CS0S 6  pP051&p11q1|6P00 8(xP 0 S58dP0SdeaE 0 00 0G[P`pd!00CS0 Эp P `p V0!0`00 0[PK R0 #.KL ?.KU  0 !00CS0*喭@ T 10@ T% t!00CS0"倭p@ T000 U$0S TC!0@  0 !0@.KP03 |10@ 2#s 0 S2Tac10@ <Yc0S 03/01  0S42 R T8B A~8QH 010SA H2R: t 0 QP K1 KPj-K,K0K0 sip%|1K@Qw  0 ~X庉P X1 1 R0 J 10S 0s0sq m\APh000S1S1S 03/]40! 00! 0K,, ,,T,h,,,,Ā-p,, -x,1,T,0, Lp %Qk||ML,xhd2x,,|,BfvyW P,/07,?oQ20 S0-LhP \0 0 b@P<fb (0 K0hA 0T0,- -L M@00 O}KyQ 00CS0 Sp0 S}0 p/P@-  Pp0^ @p`WW V `\P0Ql% -L$M`@dTp PTwNT<8K.010!P(1Q 1`|AP 0S 0S @y H'0@0 pP@0 |@DTP x W  K,K! 03/0 004|(Kr,,!l%Plp0@-0 P$R!R!P P!0  !!P00 R 0 RR06 01 R   R  10 R R   R"R \R R  @@T "TP  0P0D0 R R 0 0 000,,-8,8s% h h0- ` `0`@ X0L P0 P p`V000,,\,,@,-- 0-PPL8@ P wP @000`l% 0-X@L0SHP40 0R  0t,zx, 0-X@L4SHP4͡4 0R  0t,q|, -LMⰑ0AS 60 S {0*ll P 410S  >$ qX0S a00BpP U 0S 00S5 00K  00 03/00S 0S  \0R TL $K,,,%΄@,-%m:m,fm,, <  0-@PL(3 P ,0) --LKMS_KT AgdŸ P D10SZP=9 =:xk{ A28ЀX0` p p A{ Q}`pY!X|10`pd1h! OK 0P!z{D@ Xڐ   11Y! OK  0d y@Y OKd 0 y@<O?KP < dP1 t y0@`P  S  R &%+GŠ` p0.A,ZQm|td ,,0,w,dK,S0O/KP d1T  01 0R| R0 0 0d!ऀ/?  0 5;/0?  00"%+C5  ~yT1@S] 1`V0XU(1ЀX0P81 0X0IXࣤ A៤ Ak{H7{ TzKNpPxO?K`!dLyW@ OKd0!Cy@<7O?K<p_d 0"2y`@!D V`0Q R0R0O?Kd\"y@O?Kh"dyT1 S20ppOKd8K(K 0-@@L0sd(00ppH0`o0(0 R 0000@ P|00}S0s00X 0S4P<=- ` K脿,,,,ъ-%- -L  @TC*@  R410S1 1 0S00C R% mV.R" T)*@ 00S0000C R T*@ T*`@T*% 0W @`#@@@@00(K,d,,x,@,/ -p`L P@P0  T  T  `00(0@ R   `FPx`00CS0 `孝 PpTL000`000 0 ST00ތ% -PLMp0`P@%) n 00`$0K*a`#pPd0( `nUjL00D P 0 $K,,1%7A@,- -ML MP8 @ 0nK`F.K0@`|3 B  $P K\#\@ LD3pW+ 0 Q 0Sp UZp@0P00C.K00 B2P CK"@CKPA&S  Ypp.K0 BddS@ Xp@K A0 S0NK @D0D0tX S2Z  ?  Xp<0$SBK II0 8S0AS @Z K AR@S Z Id P,QZ=  R ( (/0DD8 Xp8^0S0S  Xp@@$.K0 BRPD<00 0 @Dx8 >K@ 0Cl lYp |8S /|8, 00(KI-RXe,w 0-@PLK0hvYDX 0-L@P0 }Ǎ -L⊹Ps 0-L@᝹p0 g P-LTKPX8^ 0-LlMPQ@0K|0 0 0  T  40S P 00  P 00  |0K KK Ps 3 ztK P0 Spc ll`l@$0KT@#P tKDP83x 4l 3 30S @@d` _ R NP ` P@@0S 7@P@Kf  \P@ T#|0S $@P@KI|  |0SF@@|@P UT|Q P#1|1@T" `h1hq g`1PTt!PP *@@081001 @i0!0!0@P 00 PU { P 00 |PU l }|P  KX,q,-,%KA,kkkkk@,,,,|,,-@,,d, 0-LM P s Q0S 1 1k 1 cPʜ!KK'0 CR @R pS `S 0R D1P 0S,ԑ0P8 0S 10S 0 0k@ @<0 @0@40 @.0 @(0 @" 0 00S 0IK0,,,-a,,-p,,-T,,%X,,/н, , 2,,-<,x, -L4M0@0S, @K@0K ោP@0S8@K00@@KK,g --LhM @|K |0S 00pQx0 0t S` @Kr`KMW&K ?&K@0r 0Kq0S- 0*0pK 07W'KKPh X0K0SH0 UZP=9K =H0 %KR0<00P K0 @ KUp0S |0 0xKUPs 00 n0S j0#St0@P@|~0`t0 x0x K,/(/ -LM$0S  0K #V K 0-LrUPP 0@P0P$0~U00 p-@LM`0 @ PP  `$@_U0+0 0KVKp 0-@PL UU!0 -LlM$cP0S@p|KVK0K @T  W@1 ` 0pd0d 0000嘢W  Up0#S 0S ppP0,00(00S 0S*P @ & @@@k`0 0 L0K0 K0v"10 000 ,0K a 0  0 00S.lKVK&KQPtd\R\ 0@奆0 0i`<00#Pd t0K0bST0 P=9K =T0 M0 0 R\0K0 0nTP>0S :0(0p`@^`(K,, -L MP`Up@ P;0C (0S PI,0S Q 0PPcUPG 00 0P PP1 0 00 0%KP (0S,0S 0S÷0 %[0X FPP 000(0 %0[ S K -p`LM P@P,0S T00T000(0H0@ R   `FP 0KP 0[ ST,000(0T00Kތ/ -Lt(-80!R/P$0<1s0S/ph10/(-lv%6 p-LCM30$1 0 1 30S3@TrC߸pktP ظոL@#1S8!,R< 03/ 3 CPQ CP @@2TA $! @RR@( $10S $$10S $10,S$10$1 $10S$1 $!   103/P 10 1  1St oRgh@P Rgm1 " $1GK $! 1Pa GoK P $a $1P P$10$1  0 Sᮖ\A$1@ P$10$1 0 Sព 1$$10S $10,S $10 S$10$1 $1`0S$1 $!   1 03/P y( 10 1 801 03/ d d0PKp---1 (-Plv%-s%I,- -L!Z0-5wۗ\0- -L 0 H6 - -Lt 0ysT-0-H0`  BR` pRp R'hX Xp/% % -LM,PK@e` c l1s0S px0080  AR800S  0gpW  B (K0-lv%-0- -L Mh}z Up@& P KNsT TifKa^X0/LAhP ᕣ00!,!1뻏lv%x%\Əҏ p-L M0@ Q1`s0S P0S ; Q HQ@0 KQ0[nS fKp-lv%4-dK-ݏ -LTMP dKT P H00S@0\A d@KRPhfK`-lv%Ï @@0-LQT Pf| vdH-  H0-|ALT 0S  0 VQtlv%0- 0-LM<0/LAP0P00 K0lv% @-@0S S S0 0\ \ \R \ @0 RR -LMP@Ƞa 0N80K! 0G@T|`te@T:1, K QT4 R0 R Qs00 e(Ko/s%p -LAM MB^K PE`8 <$ 0T FB  l2l h2 P\2 XP 0 E14K 0E@4  @P 22$[0S000 S"6qPJ`pBNK @DD⠡0S1 P10S  24[0 24KRP0DBK A@T2 *<P24[S S 0$ S0 01<1s0S ;e 04圠0dZ 8PPZ  0 0D  8DPT 0<1s0S J P0t!p ːd0 0,P㙵8WP(K0-T-T--$--l-0-x6 lv% $3t-4- 0-LM,EK"P8GKQPR@PY- ,EKPP 'P%P P P ]0EK<  UK0qTP P PEEK(,bK0JZp}x6 lv% -L$Mp|3@<  pPlcOdp'X#H LH3 DOT@D P Y3l1s0S3  0KO3㶱IBpK8p 00CS0ᜓ0 p00 0 R0SVP1s0S p0P80 1 Ps0S0  P S ,1s0S S 0[00 S<1s0S p+d1s0S l1s0S 0㐑0x 0KHO0SLP  L10S  000Qލ80 S 11s0S <0S<0@CYI`pߒHy <1s0SP 1s0S$K  V0x Vp0h0 <NX わ(KD< -T-06 l--$-lv%0- --34-t-Ð -LBMj,GK`PPST1 LN/,0!R$1 N@P  `p H`pKoTP0OGKAGKpca0<1s0S H P0lnh0 D}NX KJ-Tl--$-p0-אlv%4-t- -LBM,GKlpPPV`1 XTN㾳K0CCNPOG$aAK$4!@a NPPp1LAh1T@0M.MwM*M(MA>KP0C0!ᣞNu(GMM6M+L@ MBK'nU 4[S S 4 00 TG$$  T$$lbt X 10D0 S B/o" R0C K0lv%.<L1-x% 2,0- -LAM6P Plkl lLh@PHXha ,EKHP N00< EKK-L`-^}lv% 0-LMP {P#'0@S0 P%l@%.d diLPPT-a AKH 5@`AK4 @lK0-t4 -0-|^ 0-LP llAPP0XXaP@HK0ha<@ LQl1s0S0 0K0hp0-LLlv%0- p-MLMP P(0@S0P P%%|`IaPPd@d`\0AKl1s0SH H 5 @_`A.K B4Kp-4 -0-Llv%ԑܑ -L^x%? -PL$Mp8 ` ~P@%5``4` @ < 00 4$8h6p0 RS ^eS FS2 0S9SES" aSQ cST PS9nS hSl lSQ fSy PpS? ksS[ tSp0($0$$ $04P3 PP]  PY GPV 㘆3@=PR 8PI |3PF xP3@ 00<3 X3 040 <00S< 3/ |P<0r _ m22g 2 cT T 00C6&`2`VX20SR/OPMPKPI@G@E@Cd"b pW W4 QD804 4 ռP40!201pp 1 741.00 0!:_wPg pd 8=T T8 t( 0uX1 U! R   R  ! " l AkP  ׈1HQ,J0@ˈPHFD0 000S+KP +J00@Kαl0l@0@ KS80980 L KSH0KW p --t --0-p t -LMU@pWZP@P P 0/S \l5 h%  X(K ^PP`@H7De0S 45  ,5@(5 5 5 R- +5 0/S@KP x x x|y\!0S(^`Qld0S l(p_p=0DdT (h_p;0d0S00: ([؃ R  0S 3Q 30S ㋄: ([3p3 R T3Qp 0S orp$3: \(@[P H3H (: [P (3,l!(: [P 3 (: [P 2 (: [P 2!(: [P 2,!(: [P 2K0C S 5 0 4:AK A:E1s0S/ P0S+ RA~KpG AK @  0@^S|PYW0C\ \00 P0S 0 Z g -lv%0-$--<- 0-PL@LP P P P @00lv% 10-LnEo -L@PP" p00CS.@m m m m m m m m `V ᮶PPuP0 P00XKh 0S P 0 !0S00 R 0000SbH0`  BR` pRp RSZX Xp/% % -lAL0P0C!S`0000CS?o n o 4o o o o Po 0 "S 0S!$(Y0 0P`0  YpY0 0PT`0 pPᨴ04Y0"S 0 Khq-op#M @-0S/ S, \S ^S$^@N00Ns@T00N~@T10N~\1 0P ^00 0Q w -L@˵PpA0S P L@&K(0&KX@ T `0S(x?P\%  ` ʟdP ` SPXppd pd?p00PP&K 0&K8ZX@ T0 dK6P( $ 0/dKP "(<0(8s00(4s00x0 0&<0&8s00&4s00 v0SP  p ?P py&K 0&Kt0S&K  (K趛x%`u2 -LMK@0: S 89 K K -LMP1@ R` h3000 00㔫p`QP ,K >QP!QP(` 6`p 0`S 00b  V0RP0b pf`0 }?@d0d ,KS$ K0@0 S$K @. 8 C4, KS(eS Kx%ĝ ' % p-LM00S K@P00$K| PK@` p>p P @TP0dsL S <4  K  Kp(-Ǔ->^0 R R /00@-\ R@ SaPNU APNU @S AL^ T000  `0`P@P-L@@ m0S 000S 8FQQ-8-pQ- -LPq9_E 0-L@f"0 000/X- p-LM@P" 0S`P U P P P: D590P0,,K",K",KKpX-U 0-L@P K0hk 00SK0h蝽0X- 0-L@PP000S0K0hҽX- -L` P@P000 P 0S00& 0-L@yP P0P000S0K0h X-0 0S0 yQ-j X- -0LS@0S`0Sp@`8P< p[, pU0 SX-Q- p-L4MTBP0S  @2P 8bz HK֤0S  HK00HKj!PA nP8 2P1 KP1 P1BP/ P : ;P* KP 4 5 P, x1P$ KP ) *P K P # $ P K P   P 1P             0 5 [0 3 [0 04 [ <0G?0<0 D0x00D0 0(0K0'0K*0K-0KHK <H K}PKpX-Q-R-T.Q-Q-Q- 0-LM K>P@1[Q[S0 PjP (P0p@S X0 UP TVP @P0SP 0 K0ht@Q- Q-z 0-ALMLPPP ) P P6KP P/KP P P%K P (P 0L00M0|KpKlKdK\KTKL`P0ML0K0X- "% -MLM40P((EK@0OP0 0iP00T8b4t]4䄟XUR4dP 4 0$S0$0$0$0$0$0$0 Ì4 ň4(8 >K0CPCP h4d P3tLtdP3xxd440S (40S| 0|44|4Sh3|d4ST3dP 0S0`00 S P 0S0 `0lP 0S00H34@P43 R  d倂 3I. P``40402P 4J.0402P40402P mP24P 24t_P 0S TVPa0S (h去(hP( !9P(a0S 1 (h Bo(h1( 匑 qtP0`弔`PH 0PS U40S 1 $Ke X-(3Q-Q-+Q-Q-.9^Q-&[Q-Q-Q-tQ-Q-Q-Q-Q-lR--R. u0R-@-1QIFϏQ-2-4-&E--xf7Q-#M.t$#- 0-`@L4S0P00SD0D xs800S 0 j040X-pR-Q-j R- 0 ]X-j 0  0UQ-j X- 0 MX-j 0 FX-j 00-0LS0 0|7x00S\0\ X0t-T00S@4P 0T 4@ 0$0R-Q-j X-pR-TR-/ (0- L兺 KhX-j 00S/ 0 X-Q-j 00S\4(R-0  0Q-j X- 0 X-j 0-@L4 x ֵ4 X0X ε4 808 Ƶ4 0 徵040X-j 00@`/x% 0-LP`@ \ 夵 D 垵 , 嘵  咵T0X-j P00-0LS 3800DTK0hK0h@R-X- 0-L@ 04 00K0hX- -L `o 0 UX-j R-`LP@p50 QPT*KPp PTPPEUTtlP8/p VP PPU*T  $Kk*" $KkS4;Of}D  0 0A.0 00S/$- p0-LP @ 0s  44P0x% -P`@0pB> C/?0 P@ 0&ᄠL⃉ÖT 0Q !UT 8 4p@P$-x%`00S T R $ <0/=C///$-Q-  -LMؔ@T C\ N!QP04 S05": N,K0?`R0prX ! KQP0$0@RB*T !SR$ 0S 4 30S $SP 4 0 40!0000 00 P0 0,K!0@ 0  p p,$(4&)60 0 K Ke,KPPPR0PPU KB> CQP 4? P 0僤0 QP<3mh2 K0B>C\2 q   0TP 40 00*b{1ppM P3p10S 1W0?0S  71B @ ? @0W000,K Ap10S% Tp7,K!P13ㄙD10S81K8P 1+KSR 1,KSR  0 )@00S0 X      "  04 S05:6p(K$-\R-x% $Q-x%Q-pdR-P-Q-R-R-R-800S ($,ē04//$- 0-X@L0S0p 000$R C.@B@P@B 0$0$- -@L0S𫝸|0Q 70 0\0 p` -؀BYX 0 2(Pp 0 x%$-D-R- -L@XP, 2T0000P 00S4 B>`CUT ?0"0ˆ ^ !QPC>C0X P@0DT0<`0B> CR0tp 0 $-R- 0-LP0P0 0S AT 0 RAC@A000$- |00-@LT04 MD0 QP0@ K0hz1p 0 0$-R-0@-0S 0$R BC΃LP $ `P?  p"^ AWVPL 0$@$-P00  ?P/  /x% 0-LM 0PS4 $@=C* T@ 0MDB @C @004=@C @P@C404@@ 0v0 QPK0h-1K0$- 0-LM 00_ K00-B>CB/$- -PL`p@P!3 0 AC A0 400 At P 4040$rd$KkqP-$- 0-PLU`4 @ P  0  0B@ Du4 i5T 0400@0Khy$-P- 0P/$- -@PL`P 00S D 0S 0C^S0S *Sn0S 0Sn eP@@0*S L0kR  dR  sR  uR  @@,-x%- B R 0?0^2:!P* C 0-L P @L0S& 9S0S*.S bS cS 00C<,0d0S:D$0 c^ 0R4:00-(0- -@PL`% PPPQ wP@lPQ nP0S PV$/Lx%z%@ |0-LMlgPIXa0P 0S |@3[FP: R@PN@P J@P0 0 @ᏇPኇP ᅇPဇP P  @P0`v\X XTP PK0hꢑUamt}%0-0-4- 0p/,- p0S- LQhd  SXCS @#0, C !=H,-8-p 0S 0S 0S 0S P////// 0- L0S@ P0PR0`3s0R 00 R R dP00 0- L@@P в $ X 00 ?00&?r #?00 0?)?00? 00 ?0,9??60 ?/,?0 0?09?&0?00|1p@-0PSQ00p Q!3?*=#= 0DQ!&*-- 4Q!*.$q!L ?!@@!!``P?@?? ,, ?0<< 00 p,- 0-P@LP QT5@2TT@DQ0`R:6@ S@ T0CQ @)@@,-H2P: /x%06P: /x%P% Q p0/,- P0-L@$$bDPQ00 @0    !0s0KF1P0! T0@T0  T03:T03:T03:t00` S,,A c,0S ?$C,1@,A0X-,-0X;P: 2/%h%04 \\ 0 S// -L MR( `P@TUp1{TUp, UP U00WP ZUTl (KP UT0  U PT 00 Kx- -LM@`p( Pp0 l Kx- 0-p@LMP(8XR KK 0 CS q8 0b8 808K0x-P PY?/"-I p-L M @P 0S bP|[P Kpho\m `P 0S ӡ PX@,0, 00EKp@xgM 0-L@tPL PdP 0R Q@0 R bF@0Vc p-L M@P`ᑡ L0 00 dKp p-L M`S@8P R" K$K$0 80 S$08+8 08@8 R K$K$0 0S$08+8SKpx-Q- -LMA8S00 900S( K,K0K,0S,(0 RPp (` $ (00b?U$0S K$K 0PX0d 800, 880b8(0 CS( mKx-Q- p-LMP@` 80(0 (00b?U(00S K(KQ 0P$K K 0 J$0S 0(0 (0 R(00d 8HQKpx-Q- 0-LM@8 R+ KK0 )8 P 00R0CR80S0 8808+@P80S KK0S +08K0x-Q- -t@LXUA8 cPUP <0 $`8S0S x-% - 0L80S x- 0-H@L0S P X: 8P 0 00x-% -@L`PGl0 R0 Ȕ S%'0C"*0\0404: 0 [x-% p-L M@"PK`@% @P   d@P Kp $0 ( (( ( 80 /x-% 0(( ( 0 /x-% -L M@p`0S-  (K(@ P(0T**0S0( (( (P:P +P(0( (( K,-x- p-P@L M`K@&孟P@ 00S  bPKpx-0P$/x- -0LSP`@P P  @0 00P@@00 0-$@L$P0 $8 0x- -LMP7PG0PS(`, Q0$g08(X 8 0S0S  0S08 Q00(('P p0 80 h 8x|W080F?oP20S $8S @S PPT P0? PW Pp48qSP$ Pi48LPF Pg P_48 8qaP  P0\ AnPi PKP3 ePO F48 )4880 80 S@488S:0S S}0S S2 x8S-04880S' 48#48LPp0p48D488S0S S 8S0S S 0S S 8S484880 S80 S80 08$Y48 3` R( a UH`Y `媚P`3X`<44H80S 48 cUSD8P 088`4 E80hV2h80 dV5 0 R 2t 08 <0 0 J00 @ V$S0Z V  4D0 YPD0@00 0 R  8 R <R R 0  `V' @K0C R R R00Kp@⒞Pd@ K\@⋞PP@ 8["ST >K0CmUpK0Lv%% 0-LM ,0Q0S- PP* A@eT# Kpp-P0: Spp,X XAP HA@ < ,A0pK0%vI%% 0-@L0 700000  0  |0  l0 \0  L0 @8800K0h"-I -P@0L@`@px0@/00ir 0S mW @iV V,(aKh"-x PTD -`@P(0LrAJKh"- -Lp @`0[  T ^ P0;0 P /0pP     4 > P ( 'U $KkQ $Kk "- -L,* Kh& -La@0PSS SH S S S %SZ #S. $S1 /S! 7S Kh!Khu.0P S+S@ (AP <0S0J0 o#000  0Kh 00S Kh10!S P  \00S LPHKh00PU$Khz&"-T-Q- -L'P P@x0QP  Kh P0Q@ @0Qp`P@ p`Q-R-TR-Q- -L@ e;DTp  0` Pတ0S T V0 00(00S T82R-Q-R-0PP/"- -0LM K0!% Kd% -@L(0S 0(03P y'P 0S S S ,PKh3P`,PQ?o2(0g"- 0-@LL0@, , ( 0"- 0-LPᵚ@@T:T0 -0L,MePN~0>؞00?00"0 !0S />0S5},0SK&T>D#P  P >P >0S P p>P 譟0S]80S e $1=8)-P $X 0S:l$N$<=0SeU@`ᬍ=0SP0 eU0쬟S S S S /S 7S S 00F.V SdP<P000SNP @0_V !V V@ "  +V -V0 S00S000{ ثRF V V  6 0SP0 0V9 H<0V5 <<0V0bP, g@ 4Ka BR  @K P "P A40@0 @0P 0Sa0@S @BP @00QA,K!   V_ P+ V[ D+ VW  RT|"P,K!| $0D@0S aFQ0T*5!P 0 /fP,V V V V#!V V: *V @V 90S07S< 90S07S;07S0 V V=P 0#0CS*tP'0S P iP H`KG0KHK0,K0!PDP UUF 0EcSM p < P D $ x l <  P 8 D 0 0 P D 8 ` < <  L < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < 0 TePj!R6 !R0660S  a!R6 !R046y =!R06ñn460S!R05 :!R05ñX !R05ñM50S!!R0T5!R045ñ: 1!R0:5-050S P!R 40S  ePn!R   Y +)!R04ñ!R00 !0<0!eR00d !0<0<P0}:!R0d3ñ3 ',K!l30SD0S97 @ 3 P 000!R02ñ200<0!R0h2ñIsP000P000<0!R0 0!l/PXl(VPSa2 P@ ?KH20S2! N$20S)P;1 忘P  10S >"!0 3p1${T/PL!R00ñAP P P m !R 000,K0!1/P!R0<0ñ*P $0,K!R@ 0x00|0!"-xQ-Q-R-Q-8R- R-J$<@-dR-xR-p ~hxr#-hQ-$R-P-TD&!Q-Q-R-Q-Q-P5"-R-Q- R-R-|R-!R080ñ.P !R0l0ñ.P| P%.0 QP 0 @!R00ñP u aq41P P dP e c00000 0g0 a10S<! X0I ^1`0P? 10P; 10P7 P P4 20( F82`0P' <20P# H20P P P *)20S #! %%0`P 20P 20P P P.`0P%" $` `]0 P0$3 R43 բ/ ?!!L\0 p3ñ0 cP03 R3 բ/ ?!#000 3 0S 0 rR30S080y< 0#00S/,- 0-L@*0 S!00 -LMSP@`PፕPp0` 4@ 0UJ40 0K80 ?0 4 T # 3P R 4 BT4 /* R, Q R %0 R0  0  0 U0 P0 < RP< ቖ4KZ80f d4 Wp1W  0#1  W RpG Y@d @(Kp@-PP6 HPV-@^^$0S0 gS$ 0dS T ^g\\0\  \A0fSd000p0   / -L M`p 0 P@ܐ3 00 R( R R @ PP4 P 4 R PPE R   Z $* @  R ` (K@ Q-LP Kh#-B Q-LP Kh|#-b 0 F#- 0 @#- 0-LM`@P K5P %P  0S K 'PK0#- -LML2@T @dP#ṶXP0`paPP 0@i0 QP៶#e ##W V ᏶W0S0 MR +R GR  SR 0SSD_A SER= SnR:0SdS70Y P,`KP&00 0 0eS cS&P0> vS xS P0C00 PP  0 P(0  0 @(KQ- #- 0-PLM@P ;PU 5P@ MPK@!K0 0-P@Lqq 0 $$ K0h,% -LMP1p04P S6 00P2 00P0`K/ 04KP0P@] 0@Sd@ 0DSd@ T04 d@dT U PEj4P uKQ-Q-Q- p-LM,KK0 QPtP ,K`@9`V  况000 00  KpP-#-R-Q- -L M@p 0 `0PP᠐堠0F T *XV R  040 40P@ U  PPRPQP RP@(K%% 0-@QPL ᰒ P*0Q S1#00Q 0QA0 AR SSQS0C// $00-LP@ G0P-P/@ -Lp  Kh{ 0-LM@PI@!P"10SK@!aP DP2 OP AP "oP qP dP&ia0 !0P 00v0 QP !00<000SK@! ᚴK0H-x%T -LMs@0S 0PS \0`S  PH 3PTt0, K0"K`3P0S[RP200 R IP00 J xAP00 B P  KD6Y t . *(Up 8!P M,K!10S UPP ,K`!| YP 1!U 81P01  @5,- 1 X A1P 0S K f"P+K ,K 0P P ʳpW000S p"0Wt00S,K`!,6ᰳ(KP-L-x#-~ptR-Q-Q-pQ-D-Q-R-T-<-R- P-L 0 KhP- 80-LLP l Kh#-x -@`\pLX&,`VPJUP0@ R- 0 P- 0 P- 0 P- 0 P- 0-P@L@P rPK0h0 -@L0`PPVU  P P -@LM@`4KP4K@P 0p,K,KP TUP PU 8p0S6$KP- 0-L 0@0S K0hP- 0-,@L0SP000 #-# 0-@L%P0P 0sS@00 -Lpdd@P00CS0cp P`0 ` V 0d HS ~mo  @P`00 -Lu 0P<š -L@֏\0 0`RP@0S R0S@0@0ṏPp0S W P@0@000%% -LMP`ᙏp@1!EQ @P` P`8 40 0 C0OP408  W@X V$s@X`@ p h0 0 PX e3OP  @0@0DX(K%%K -LM@`P 0S PPKhHE4@1@pH0H 0P0'3ᡱ 1E@ᛱKeL -LMp`P% 0S" PP3@P h0d 0p02PPm@hTKc" -P@p`@00L0S #S %SW* VR  R %S #SP s뽎@@?`@ᘀ嘐0S #S %SW* UR  R %S #S P Nᔎ@0@0P-L- -LM`]P2@ 0@Ἂ0 QP G_K,pK`Q'P 1V $0S 0S   1VPXP@TKR- -LMd1@0SYcpV `1RPF L`PDa 81R`+P(P%PP) 00 00 0P002ᐰ@`V   `zV PD0Snlig$KQ-x[R%d%{ 0-0LS`э@VP0T 1{@`;pP<@97Q- -L M1`0pS 10Sb|3P 0 @`|R0 -R H P ]P$@ ჍPဍP0 y1 (` V T P uuP-KP 6DT00P0S 000`0-[D`P/@D0S (K`R-Q-x -L M0p0`S-R DPP% Pڔ Ki&!@@@@0 p1@ቯT  KiC KQ- 0-LMKPP@@JIDOoBmK0 0-LM 0P @R P یa@PKP@@T@0: S *F@5 4K0tR-%ɐ% -LMK@PK0 00K/ 0-L@ᕌP P0@/R0000SJ=(R- l0-0LS p`QP QP@P wUTQ- -LPvQP0 R/ R- -L M@P`p T 20S |20SUd200CU @P20S 8200CUi?WVpP@l0Z00 JYY`p&0 QP`pX PQP Z3o4uPX1AnPT410S(10S 0 WV 00S 00S00S 0  0 0T c 0 (Ko WV D0P u@(0@T@, }Q-XR-TR-%@-C-D-R- R-H00S <0P/000S $0@///$#-4R-TR-Q-' -L`p@P@T 0@V@@PUJ0YspU T PT  00S,KoS Q-@R- -LMPP P @OP< @0 SR,U00S ""KAP"KP 0@`p 0 @QP 0 $Kkg $KQ-Q- -L Mp`0 QP@PV KiI0 @ 0Q K0PP/%0PP/% -L P Kh 0-@PL0 p0T0 P  00S  B 0( 00C0 K0h P-%(#-0/(#- -pP`L@T P@T#0@0 "000 0\0UP0(0@0@000S   0 000%(#-P// / /00//0// / / -LM@P0 UT D30S83 43 0S000 0P20SP`p2Ģ0Rp Pv`VpX00b 0 0P00 ]00Xß0S:00 )00RMp@ P P0t T,Y@P5ڬ10S11P- @T_* T P0R0PX!YL! R0p Pp1@P 00 00@P_ @PM00S 0 P00P *3|00SX P P0 0p (Ko(KlR-0#-Q-DR-R-R- R-8R-P00SP0 0S_@?P Ro0000SP ,-0#- 0-Lt@P 0S\00XP 0S<00  ;000#-VP/ 804   $ ( , 0  R 4 /0#-DR- -LMQ`0pSp1pA0S 0 T1 V ࠣ࠳   ,1 V00@  0 00 00S4 K$4K⬅PPP 40K 0 0 lR00040  4 ` p 04P cS`0p\ 0KPR-DR-0#-x%x%b P-L0E0#- P0-L@ P0E000#- -LMLcp4P0@ e 00eR0S0<0 <0W d 0 T"0 R  R @T P P 8 P4 00 8KP @p" D20S+ 0Y4 0 0P4 " 080 b80P4 0PP4  _P 10S CPqo᪢0 00 U0 0QY 40 0ҷ 40480 P 8P  Y 84P 4 Y8<0 gZa p0 @Y TPP@PPP0 P0g00pp(K<00gS  p P0#-R-,-0 0#- -BLM0`$000K 00PP U < R   `@Pr0S,0 000  00R$* 0S P `P) PP&0 000   00 S0b 0SP0S0S  00 00  ``P0SX0K `Pp0p0PP$ p0 0CR0 H0 5P QAPZ pP0P` p`(K0#-R-R-Q- -L M`p]Pἃt0t@ @@ =@L00P@E` 2PP K0#-x%Q- -`p@HPL8@0T  0P 0@d@0#- -PLM`pK|4@T p 04 S \  R0   0T` T ,`K00& Pp 4 R0R000S000 0a 0 0 0P0`0 p00 0PS @T&D3000 0 00 0 X@ _X@@h$0S@@t@b_X@t@_P@t@ P $@ 0cP@ XCX20SSSE  804  b0SCDRD `C Pa 0CDR0S*QHPPb  HH10PZ`! =PSPEUMP1 RXx:P 810S S0S` 1 0x.0S& 00S" }P ~@P@@  @00PHP ` P `@@@@(KR-0#-,-(%Q-R-x% -@Bp0LP`p %> CP0 0~ X1Y(0QS% 0`H00)0P@0(hꨡQ 0 (QQ0pQ@08 070S 0S %^(`0Ca0S@0 Q0@ 88P%n F 8fH@0(0 %>@0@00P(0 p0X Q \00?\ 0  aoY 0S @00#-R-,- R-Q- 0-,@L(0S%>0(0000#- -AL`p0P 0P0V0S %> C`!0Sc7HQ0S <1 0R$mAP 0 0nPQ 00S V 00S0S   0  0 0t00SW  0  0 0 0  0#- R-R-Q-Q-Q-0 0@ /0#-d0, R X00S P0~0/@0P0 / 0 /0#-HR- 0,  /0#- -`0p QPL@PypP 刀u U_000CT7P SP0P^@P 0W0 0V@0#-R- -PL M`0p=PPP䀟@0@D P 0 p T 0 P0   000CB0PQC@@b0@D 0WVA@d@(K0#-R-0 0@-P00S0 @ R0!0%- 0 R f PR-R- -L@L 0S𨝸0dS `$P ` PU𨝨 0 0%- -` \0c Q( *8 800%-%-E->- -pL`V @TAUT`@P\ `P &R0^ ЁP P  0\&6 0 %-E- -L M1@ 0sRPA P0؁`lV R0` UTe n V$p #K  T0#K R0P0+P D؁`0 QP CV0 0 0`p &.0  eT0(X'KSP؁0p `〠T00 0QPK KX 0 = (KPR-%-R- P-0LP^ U !R 0PYX  U ! X0P R0P @a@ PV 000  0 00r  0@P`pPa@删 PX00 <0 00r  0@P`Vp 0%-R- -L` @Ppp0Vs0V ` @P0 UT@ P UTPQ-00CS0 Sp0 S $0 p/ -LM0@-S@    0  pBT'P@P" R RPP w~`t~`P 0 j"U0SPؠQAY P7 oS 400 (KoPdKe"R- -L`p@PD@54PP,! @DKO! r SRp4 riq 0 +p 0P `php p Zz*PdKR- -LMp`0 QP"K "KQP@P@P .W T 0͡ 0 0 QP 0l$K a @R-L08 A0@S 0'@0  >-% 'P0-L5 $P #.P ^P0, P0,  B%t $X@ X004P0P00@ UT0$O00>-7Q-P-C-9C-0@-50@P0S,@0>- -Lo 0-LMPP $@K  000K0P- -LMm$@K K0 QP 0 0$KC-P->- -LtP0N.Pp`O.@BUT@P@BT ă$@`0P KhP >-P-$R- -LGP 00 0R P-F0@-0@P \@0S0>- 0-LM0P@T#P P P0Ptp00Sh@H0Y <00S$0K0((0!~K0Q-_D-x% 0 H- 00-0LS [[0%Q-@B$R- -PL$M0 % P PB00 .R0$ K0K00 0$0S)/$ K0K$0S 00 0 R0K0|0!$@Kp |P0K0K0@D@!0@ 0RK%$R- 00-0LS Z0%Q-@BR- -PL$M0 % P PB00 .R0$ K0K00 `0$0S)/$ K0Kd$0S 00 0 R0K0|0!$@Kp{P0K0K0@D@!0@ 0RK#%D\R-r -L M@P@P K@!K P-L P 000S Khs`P Kh0 QP@P 0 KhC-Q-$R- -PLM P P<0 $00 K00!: K`% P-L (0 n00S KhfD-D- 0-PLMP, P P00hS =S MS sS wS mSP@x@P h@PPX@PP@L@Pm00K 0$10!K0R-% %$%hR-pP P/0ZLR-P/c 0-@PL 0T0K0h X0X +P)L'H%D#@!<840<-d%u*h -PLM@, P PR@Ha0 0 Br \## D!S1@0P,S T0@0D@D!10b 0,T* _K0 `Rp0T T|&Xz!hV@PzPKz,0< HK,dR EKt#-(%,%v! p -PLM P P" R0 0  0S Q`S0L @ 0 80 K040K 000K00K0K0!  K%%(LP /P/ 0 /VtQ-0P 00/R-Q- -LMP@Up`K !$ybPpQ 000\Q0S 0S@ $Q00V 7:P 00KgR- -LM0 S0*, , *   KC- 0-L5@ 0C-P/0S/P 0  //I 04/C- -LM04 K! n KC-g p-L MP@`0-S0 00C  S0 ` T00V K`!HK 0A ^ 0@T00R`Kp -PL$MH c4P 00S S 03/j40 HK@040P8s@ H0 R H @+T"  T $T T49T0T-*-T ,nT*2@Tn@z@$ -R0H0 @0  +R0PPH0 080G0 <KPH <0+Sh<z@H0 @8 Y +aDX@8 KaHX @K@0@ H0 @ =R P    B ,K!| 0H0 T804 S\\4KM0<0 00 CR:` 0` ` ` ` ` ` h` 0U?o 20+ U &X 0R0R00H00S H0 SH  0 <KtPH H00S4@ HK0S <3/<P6 ǚ4(KC-T-D- -L@PMp0 `@P* U0@ xK! U  oK! R RU0  R U  0ES0 P0S U03/U@`v 0O M00 CRb b b 4c b b b a U6 U U 0 0?o2U( U U W 0Q0Q00W  0R0R00U U U( K0KK(0S0 0 V00 SS0K00! 00S\000U 0  ,0 V K@OkR- -LMpP@000C S ࠓ U00!T K@!|`0@l00Cs Q` 0 T 0@DT FV@TU0`0K$00S0/P/D-0R- l0-LP 0S L0 H@0S 0S  0  03/$@0D-0%@0 R R  BP $0//0% -PLM@0Da8 < 4 0P P4 pW/  @0 . P@0! AAQ-P %RQ P0 RD @ v@ @Pb_o0DR0   Yp$`0 R 40S  4 8 < R T@< @(K0% -L M $ ( mKP 0K     %0 $0 ( 00S Pd0` 101P01S08 P0z0S z0#S K D-R-Q- -L?K D- -LMK K -LMPzH`Av@>v@p`0 6KOU 0-L-@PkE A'eE Ak{{6 QpEKK0Y@? -x@L`pdU@ HEJ A{ [{&k {{6 QOE .A?' P0-LPLPU`@40 PaU 0@ %E-<-R- \00- LRP 8@80 R:0 P0 0R-%I-R- p-L Mp0@@ d0 \0P@ K~`P  0V0@uKpR-R-R- 0-L@@P 0 0-P/`"LMp"`Vp&0K&@K 0Au0  d0 :u`p0X0-00D@D$K 0-`pLM_ _E 0K @K z60d GTPPV-00D@DK -LM0P@P# %P p@[p0nS sS dS<K `f@P G< K<K<Ku@0 K -LU  R0(03200# P00S Kh2 -0L000P@`Tp 0@T 00S0@0PS p00S Kh\:T0@00@2800T ,0 KhR-<-pQ-@R-Q-%Q-Q-R- 0-@PLe 0 0%R- 0- LRP`@ t00S I 0PS @00S $00S 0 Յ<-pQ-Q-R- -LM0p0PS@ dt000 @jPl0 /o"G PP Ɩ@GPP MHT Ḗ$K,R-@- 0-@LP :H000o/ -LM` @pP t 0S( ^ SPPW@U @ 0 00040K=P4000,0@@  $Kp p p@0@(0@0@00/Q-I-<0@-@00P0 R` `A1@CQ-I-4040@-0 C1R0C@C B@0Q-I-0@- @P 0000CR@ 0Q-I-P00@- @P0 800 S@PC000I-Q-@00@-01P@@PUT00I- 0AQ-T0@-L0` p0 BS@UT0 0@ 0 Q-I- 0p-LM $0 0P@"K 0R`V ,Kᷕ 0"K0P0@"KSR$ @KpQ-I-$0P 0PPC@/Q- 0:Q Q .Q ?Q0 \QS/0S// -Lpr@0@ P`Q@1,@%@e  0000I-Q-Q-I -LM$ KM$K K -LMKmK K 0-L@LP0Ts00CT@0 QP0K0hQ- 0-0LdS@ PS bSlS pS0PjS BS bS0 mS tS0 00 0 0c00P0$R- l0-L `@`0\P;0P40@,$0R-D-x%> -L$MV0S@ 0S :S p%S .S ?S \S D0K0C0K0DKD0K0@C0K4o`Vl 0,K0!wdV@H5 PVZ DV1 LV/ BVl]bV aVfP_mV+ fV :lV XpV2 nV) RsVB xVD M.>5DoD 5gs<440S: 0 QP!3 P  QP' P4!0 QP P00 P00  P 4P@`V 0,K0!B`F@H6V~ 0 } p} } 0 0 0 0 0 } 0 0 0 d~ 0 0 0 ~ 0 0 0 0 0 0 0 0 0 0 0 0 0 | | | 0 |} 0 0 } 0 0 } ~ 0 0 ~ 0 0 ~ | 0 0 0   0 QP D KDK2tdP02 RʉS0 QP 0aPXP082 vP B?p#2b1f1ZK P L @1<,0W  0SRP,P0LP+I0 P'|%8p` 000P 00S6 0`p0,  0SR&0P zSA P Q0R0 P\0P u@q0PS Y Si 0(KI- R-P-xPR-Q-Q-Q- 2I-0G% l00-0LS\0@OoBH0H0@ @00a400cA, 0 0D-hR-R-%Q-Q-Q-Q-(0( 0a00c0AQ-Q-Q-%0@-@^ T0\ !R 0^  A T 0!@!T00@Ò0\ p-L M@QP`@ P0P 0T0 $p`PK@%p@ 0T qP  80R ,  P00Kp Q-,R- 0- Lo -L$MpK RQN 8`@ P` K0@g10PgA U"jo^Q K 8 K U8 7 K  @TV @0 000 0000 0dmP(K Q-(% 0     / Q- -0L0`S @V PU0 000S`| 0 QPp w ,`  BV PR- Q-Q-Q- -LM0 ЀYX?  @ 0CK0S(Ko00S P@Ġ  BT"@0 QP0`p80  5#KV0 r  X0 R PN8@U (Kol(Kx%x%Q-R-Q- 0-@@LP,K0h 0?o2 0K0hb Q- 0-@LP PY00 Q-(%@% -L@P800S `UT 0(% -LDM%K0@P40 00 Kᘓ30KP T0000T 0 0R0S) 0< KS0C 0080K $K0K $K 0$K $K0K $K R0$Kp`Dp@`0K QP0S@20S D0@dT@d T$KK.P DK0SD2@T @0S@ S @T@@20S,0K@ 3X0 \0 㶿P @X0 <0@ $P 0 00000K040K080P 㓿$Kp `!0,P6 0 00000K040K0 80P' T 00040 080HXʤ00S  00040 080N L0Sp`E Cq@@(K Q-R-PR-R-R-4Q-@%(Q-lR-@-\^p`@UT `P~T@^"`p^ AP@SR @T@\00D00S 0S,0 0S DR-x%x%(%lR- Q- L00- LR@4  0 P ڏ0 0K0h! Q-,R-(Q- 0-@LP~T 0S D0@P 0,0   0 0 Q-4Q-R- -L Kh-4Q- -LF 0@  |`|Pph0X0W 0T 0?00G (0 (00SR-H R-Q-Q-xQ-R- -L` P @j 0U0P j  0-@@LP  0  0 0   0X%XQ- -AML M,B 4 7`4،V} 0Q 0PjpB>K 0CBK  @⟾Pa ,4[!S BK A fP,0K04S S S x4 0S 40  RQ44 48 e4 08S B>K 0CC.KC0Q ? 44 4$  ^Q044 444RP \P044 44044  S$R 0C44 44  0J0@00005= (0R    (KX%LXQ- -`Q`P`LCMVPpCFU`#3S 9 PP 0S PEU񟗐ꄛ l t | tSpSlShSPi`i i ``0 `Y PUX r KK׽PD `V 2UV I SKKriP ,0K@1P Sa@  Pp`2KK 0Q$ @ `Q @/ 0@00`Q000 0Q%1U  P 0000SX!0S000JHF@ `Q@ Q @ 0@Q,1[ S 0S 0S @P< ??00 0 000S(KXQ-`X%%eLtR-% 00-@L;jP04jP /jP p*jP `%jP ?PT00000X%x 0-L@P!P P P$ 0K0hz -L$M`!0D SP a0 KP@K$00A0 KS#K0 #K 0#K0 YXJ +00S K 0D0`0H0 6h00 @0 H0prdP P @0S @00S S;(KXQ-R-PR- p@-PT0T`^ Q @T PNURpXQ-X% p@-PT0T`^ Q @T PLNURpXQ-X%0/XQ-0/XQ-00S /XQ- -LXP 0 R-/ -L MH@ Kp P0[S00KP[KR- -L0\\\1!0  \ @Q 1!0 Q2[P<[\T ^^00]Q0 Q ]QJ0G P]Q [Q 0p.GqQ5 p`W]X0 ^"\P`[^0 \0 n^@0 \^ R0\  A00 0 m-m-M 00-P@ L R R @@pP 8 8 0q@e@* K0hV%m-m-o p-L M|0QP`P @P L0PD0`60 01$0 R Kpd-m-m-m- 0-M0LM00P/S $S& +S00% /9S"\S+K A@P0 0 #0IS8[@S0 K@00000KS0 0Az0 0 B1K0m-m- -LM@ TB 0rS aS bS 7tS {S3/000+`V Fp`% 0S2p0QU 0W 000 gP00   P0S0808 `0 ,0᠈@(Km-R-m-m- 0-Le-KeM BM0?e-K BZK0,PEe-K0E, B0e-K>K B0 @Pe=K0C0S ?/0 r0@S  @T #S ;S@T ? Te=K0C0pe=K0C0000 0@&P: @P  8?@0S 00@0,S00!@  >@0S 00@@P  >0@S  00@p>0Q=-0 K0-^ \ t=t-0 x90^PD=D-0 L-0 RW l < $ İ  | x @ @ R @ !   @ @ R @0e-K B  e-K B00Se=K0CpA   e-K B R<,0 $e-Ke K B@ pe K@ @ @ R @0;S }S S ;+0 @ @ R @ \R 4;4+0 Hn@ @ R @@T :*0 Y `芟e=K0C P!  e=K0C0\ \\\ \0`Q@ 0d S`005@ @ R @0S9)0 f90S00q)pj  R @0S lGW  R @0S0(G @ @ R @&0S @`|8|(0 0S2` AT 0V 0eP8(0 `@I 1 @ `@\TT@@7'0 $RK 8AVPx7x'0 n (U`R   K8@ `0( 0Ye-K$ B00S ' 0  e=K0Ce-K7 B0e=K0C0e-K( B00@\ Qb \Q Z-ZZIT e=K00C  %$e=K00CP  0L^q Q6&0 t(@\5.\Z&Z @)e=K$0C0S0S 08S e=K0C 6P00e=K(0C0ce=K0C 9 QH5H%0 @De=K(0C0@ce=K 0C00h Se=K 0C0e-K B00e=K0Ce=K0Ce=K0C RPm4$0 e=K$0C0`0 09S4!I0;S S S 1 CR(~iS" IS gS vpS wS7 q00@  ))0SX 3#0 s00`00]XFgeK A @>g0"S T3#0 U9@0C9A@T3I>K@ 00@  ))0S)Q Q   S `2`"0 (l#|2 0S l"l4p n-I 0!1 0p909a 8U`S0  K8@T  <2@0S 00@0;S# jB0110\SS`010!0 e=K,0C P0 0 |e=K0C @Ph1p 0 0 <00@ p 0@Se=K,0C0K90,A A p e=K0C0eK90  p2,m-\-m-m- 1?h%qY Gbm- lyR-%T-H}p6dD%%m-m-;X 0 0 8_<00S000 S9Q& )09)S񟗖 P t P H |  @ D \,0T|Q: 00 0` p0(00$00S`<咻940SfP2(0S/$PU ` E QP0(0" f b$ KL00 \H 0< 84 00 (( 0$  p;V 0z0 $00 H; :R<000s S0P 0S Y: KP<[S<000S \:K  ``0S~ 0K Kt0P00 0S0 0K0 _00 ̐ Y0`V:,: :$# : `M \P ]0 R:9t `9 0O`5Y Fp , P 0S:X9 к`8 c8` ,9N00 R:9建`Ԁ 00 8 90S `0 00 00b0 }0`V:88坺|8$建l8 巺\800@6 8@_0S _O 0&80S (0Sg0$ N 㓺LPG 0(00 4 P8(0Slg$ 0 N r(0S$ ` H SPpP0f $0$ 0lN [W0$060S (0LSF$ 0 WN Fjs&0vQ: 00 0` pZ``0 ` R  R  Q 0 50%$000 P 00$00pW Wc `0Du0 0S0 QP 0 0 0 QP X`0P 00 0 -K0-K 0X0`X0 0=0 60P  /004  QP XX0`b0 PZ pWs 0a 0 0 ;00 ax K`pN`$N0$N$0pK0` 000S S @S  0  V#0 00 00 00 0:S 0S :P 000BSṬ0S U00 000 0W 0Sp$Kkz m- -P0L@0`T- P YP$ 0S t 00f?o20S00 0S0S000V00S @m-T. 0-LMP@P X"AK+A PAKAup"K0pH0  BR Rp R. p/%x%D0 0CS0S  0/% 0-4ALO0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0K0h'n-0-01S ^00oS^ P0P0S0\ SS0 s000S QQ q0S RR  r  d.n-0@-  \Ğ\ @ T\    %R    n-d. -\AL0 5S( <0S (00!0<bPa0U00\P lP b0 0bP0 R  (P | b0  ,P X b0  4PP SzKKhNHd. (o-x%n- 0-@L0`TP  [ |P000ST\\ĵPPK< 8۪PT( ٵ00%m-x% -L M@P1NP@P/_P@<P  @0?SP@ Klp0S SPH{Z0SZ00 !Ke  -L x% 0-0L0@0TQ0 T00 0001S T0S TltK0h0T@0$ XDK0hT0@  8K0hn-n-]a@dx%d.kw -Lp YLx% 0-LM@P#Z K T0S 0@T Z00 Z0"S p`K0 -L M@ P Kp a KD @-0`\PP"@S$pP0\ 2D0V%@D@% $02  /%$0 R  0 R0C0/0o-(0;#(0/(00#(0/(0 0#(0/(0@0#(0/(00#(0/(0<#(0/(0<#(0/0S00/00// 0 /- 0 /-, ,0 0*R0 S/00/-ظ-00// 0 /B$- 0 /w$-00/.<00/00/00/ F00/00/00/00/ 0 /.<- 0 /- 0 /-0 41?o241/-00/00/00/00/00/00/00/00/00/ 00/00/)00/400/300/>00/᭺00/!00/w00/H0/x- 0 /x-00//  0-DPL@ N R QL0 &0- -L$0 00pN- 0-LP- 0-L;Q-  -L@PP`L0 0#PvP$6SP6W  @N- 0- LP- 0- LP- 0- LP- 0-L8M@XP @N @0 L98 LKW0H0 0LK@0 qIK0-- 0-@,0L @M 0 .90-- 0-@(0L @M0@90-- 0-@0L@)P0- -L8-90- W- -L LW 0-@0L"@E 00ظ-`- ,0-0L*0! 5 0-ظ-`- 40-0LF20#" 0-ظ-`-N L eJ dH `F _D ^B [? Z= {-L.0D- 0-LM 0 i K -L.-  -L0-- -L h-1 -L- -LQ  -L02-4- -L /- -L3- -L4- < -L-- < -L~0- < -Lt/- -Lj-- -L`0- -LV/-  -LfL-  -L]B-  -L]8蒸-  -L].t- -L$0- -L-  -L0"-$- -L#- -L$- 0-@0L@Y0u- 0-@0L@O0u- 0-@L@'0 0-@L@&0 0-@L@&0 0-@L@&(0 0-L@Y(0 0-L@(0 0-L@'0 0-L@0 0-L@M0h 0-L@C0 0-L@ )0 -L+ -L+ -L+ -L+ -Le -L.< -Ls -L  0-L OO- -L%, -Lx9 -L -L -L 04 c0?o0cs0  S00/ 0#6 c0?o0cs0  S00/ -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L2 -L|2 - L X2 - LO2 - LF2 - L=2 - L42 0 S  , , , , ,  $ 0 (00000000/ -Pp00L  S@`0(7(;0(700(Ux  Uu0a r wRb ( r dV@0S  3/(p 270U(Kh; -LM@0(``  "0 PP P0 40 pP 40( c  =7W 0S0 PP(_=0 0f QIpS000b 0b 00PQ  0 0P0b?ñ 00e40 40pP00 Q0S 000 $0 000Q000  Qp400 0@ 0W 0S L0 (7  ( P (aZ((KoP 0-(@LLP I0- -L@`d Pa  0Kh> 0-L@Q/h t      !  PP  d 2S/ 5  T L D0{ R  (K0h0-h-1-h--.-D- 0-L@Q+l x        | tlPPh  H 2S/  <  0(K0hy04-3-/-2-hP-O-Q 0-L@Q7h t        ' $ !  XPP  d 2S/   X P H0{ R  (K0h00$-#-0---"-h@-?-.-D-Q Q Q$  /  (/-0---Q     <  4 , $  (/--/-0---Q Q Q$  /  (꒸-0---Q|    D  <0 0 (0{ R  (/t-$-.-D-Q  0 (   (/-0-0--- -L< Kh8qq -HL<03S   O-4-qq -HL<03S   --qq -HL<03S   ?-$-qq D-@LSOP ,\0 h-- D-@L;OP ,\0 h2-P- D-@L#OP ,\0 h"-@-//00//00/00//00/00//00/00//////00/00/00/00/00/00/ 0-@0L@0u- 0-@0L@z0u- 0-LI-0S00/ -L0- -L0- -L-- -L-- -L.- {-Lv(0D- -L0- -L-- -L.- {-LN(0D- 0-(@LBP F0-0@-Pp@\$`    R\ 2D0u%@D@P(UD0% -L Kh 0- @LK0hA 0- @LK0h= 0- @LK0hB -L⎫x% -@L`V`1gP`- &(RP S {T'.2P99 @0 0vjPP` ,4P0D("!0(S000o-@.% -L,M@4 P T: T0AT 0 !0 S00(P FC80S 43/(0S0 R   ``000 00 Pp 0S0  80 F P80 j S 0` K80SP``㘙 U  "8 PeUP8  0S00 0L9 0efP PDfP`_ef  Q@ Q 0 |(8 `00 0P 0 M`0e0fS 0 ZW p 0Z $0 EP gKWp0088 0Z P($8 0 000xjȀ 0  SjU7 P PfP`_P0 >P( +(0000 Pp | QP ((W10 0 >,jB,Q 7> 0SR$ 0C"  0S`4(Pf!<P` PY  P PV PP P P P d6P ?P 0CP? >PP =,6P 0P6?@ 0C "S񟗒,      0 0 SSQ  0 S0a0$ 00PU0(e7p70 ,>P A Y>4t+[P` 0`SY  S  410 1 TkKT_! PT40ՀI'AQ0S  0a a/? 0( C0 BS `0 ^ RxP  R00)pzP`PxP@a@(PcJ0S`$020[B,@!vPr 3000] KP-0P(Y ,P (=(6@0U0< 2$0R0 & 0Spw43/P ``(1 ,P (=,%.,`( @( .0(010A40 ( ,P (=(?<0S 43/P(.,(PPJ -,PG`\XxP $* ? -1B%dP0S 000CPqP uP Ԩ<PU |000CPcqP Y0C`>P APX0P0CP h0P N0CP(K0o- _Xx%8.R@.%%S -L8M`p:SPU N@@ kC E8 TK3M0TKP0 0H0 >K- -`PL`:S0S N @@ BC E- -tPL`:S0S N @@ %C pEL 02#PF- 001/0o- -L Mp(@aPT!0 i0P0 200 L00P0P0QPDhP0@0$ 00R 0 000$800800p@00<0 0000040(K0o- P0-L0D0 P00A00(P ,D K0h}L0o- -L MBP0 OU0 H/ P  P`\P @@@t@Tpp R @ P R R 5P   R        O P R i5P      9 T @5 fR@T@@L5 4 O54 R J5&X f @T: `  1 W! Br R"Q   `| D@R 5P >     H0(KHo-% @ -L,MZS  R0P <0 @ pe4D`  /0X0 0S @0 Cx.u.r.o.zGP48 40 400@c0@40 0pD0 @00H0 3 0gSpDU404pc40(U00ӧ?0pU0 gQ pb4 0gR 0800 s.24W 20 8.008 2 gQ2=Hx21 Po P P@HP PID2P3 0P AP@T@D0D0 2 D0STGD d 7PE0p00@ IY 0p00@Y d 6@iPd @0 X@P .CF@PU@0JU1000  0D0 0 dDH0 6H0P@D0H0S 008 0 g0p 000<0S U@0 0 0<<0XS B(KoiHo-=z3TD%x% -x@`PLp `3P3P0U d`PP (0P h`0000Ho- -LM0@Pp 0^pT㸀p) P@@ 0 00B 0 0h` @}Pu 8G@P ‚  Kı%Ho-@ P-L@\`0PPs Hp P fP 0P*0Aı%Ho- 0-@La00000Ho-0g1Ho-0v1Ho- --LM00  y K --LM00  j K --LM  ^ K 0-p-`@PLM00 0 0000Kp -LM☒< `8 Pp2@2V"0<00 q00 0`S 0S 00TE``00`T`80 s@fO@080 WpU PgХ_P0Z80 Pg00D8@P 80h0P0 XP0<8P 01 9?+u+ DF80 F00G08P`$`+Y+0<00 00 000 0aT uY  8 i)P;|d)b)(KHo-H8. 0-0-@PLM00 0 00008K0 0-p-`@PLM00 0 0000!Kp --LM00  ^ K 0-@L2P20Ho- -L@ 0-LMKw@r<#R)!PU KW `d900h@PU KGT PT900000S$$廣K0(-bl-clo-x%(c 0-L  -LMMK @*GpPK @ظ"GpP @bP@bPU`@@ '@@ LP9 0"PKBK A @ⲸBK @BK @PEP T108 dPℐ 08dP `BK @ Q@PP;Tp* 2dpP%  0 ‡0T 0 0 0 00 p VTfT @DOfKfIf@P  8r@;p(K?c[c2vcP0 t 80-0LS 0P Kh,p-H- \-L`;P P < :(,P Kh 00-@LMQ0@  Pr H0S YAPK R0Sb OP_@QDuPk(P^LZ 6cPO +10S: (P wDP>P, (P)P&0/P(PPP(P0U QP (@P++(V K0--T- 0-LM@K+@>?K+@0KAK+A@3?AK+@%K@'PP AK@'PP 0 @@@@ @@@@ PAKKA@&K0eU 0-@LM 1@@ NP> OTP80P1(P..P+P'PP#(P 0@C LCK l0S 0W R P<(Pxx2K0--ef8.@. -@L M@ 'jP /P@P K :0S 0X PK -`LM 0 0X*0S ` 0f0 0 SS@@@ Bp 0 S @B0 S*pQ>P @P0Sj Q %SR0S dS& %S iS sSp200 /%Q0K RK R 820 R@ @ ;0QR5 K͠0T KP'@^ 0dP K 0@P 0 S T10@@Q0 @0 aR cR-  @R$R0PPR@ KრА Tn ,0K0S  0! S 0 =0 @S$SS0P @U:R0K3/PL 00`0 (K% 0-LM@KPU K c 600ppP `SKP M5E+, S3K0l-cf"f-fFf -@Q(PLT<0<0`P   0Khl-(-OU -L M`Q@`V12!1B "(3,'I, ((,>,'@TppWg'@g B.0 c3@Ptp||B(KGP F '& KA K@.pRfx%qf -LMpPVK" `72 0KV?KKpT6 0 aKVK((F 0S  P R  {0S  r밥P 5렕P 5rp@ P c00Ah5 0K D$aKVKx1B?a/Kx1 :tP  h@DP  ^00APzAP# P  d# t#0S p#P l# ,!4 zKC2,K"!0311`01   0K rKzK?K0/K rK  1 CP0SVc^] D0SP `2PU C ZP0 KT U j/K@2 0S `2P <F 2  hSR  2P /4 2 "080[iSRc ,0\P㌑,0K"!!03N KK PG D,0K0UCKKx1KKP,1[S @0 aKKK'K?K00 R0SQ H30S  02 !P20%?P UH(Kfp-%ptbtff@(-l-fgfIFf.-ffH-ffg2\ 0-LM@KPU K~ 300$PP Kj sw3l00S CT SC8 4]%K0(-bQ,g=gh-Qgx% 00-L(M00@00 000 0 @0@@@0 TPP DD媝@0Q ,夝TK0h= %x%vg(- -- LM0p IK1 BXoKIKUP 00+IKLAPP TJIKJPPJ \P`@p ᰼p pT@00@Xo$KLb --@L8M 8K@ <@ 4@ 嵋8PU` 2I 0 e  PW0 %0'Sp0W*S+ ݲ@PpWi 'WP VPpPp  ^`P L%Q  @Q c B*A/ f0P  H0 {@H0D S/  D0 S =0@L0 0iP0 DhEP 0.S 0L  H0 9P1Y@01T0 [^`PT0 CH0P 00 0I1Y _DO5q0 K3[S03K2[SP02K  B.>0<0 0K8[< 3[0C3K40K0800 K00<K@H壻<0T?o20S @0K8>< <PR *<*Q< 0pR  b$T <0 0b?oW20S #f(4#p|(S ^(#t(*O>T @ w <0P S*@GW ##6>00CS0000~*>.f<P P0P 9!40S  7d.>8J_PP E_B_T  K(Kg@ggght@@.%dK 0-LBMlFKQPP1[S .FKPKP FK4 @ PFK8 8K0o-p- -pL@ᨀPB`AT!*Y W /o"/Y R 000 P @dQ 0 g@00%g -`LP Np@ `@ ,H aP~q- -PL6<@3<p `h~80S fQ0Q.SP $ ( c _o-}r-p- p-LM$KPP  P8KPP  C8 p@' ( K? K KPU@K$ \#8XP#`P  8 ( (PKp!i~s-%is-~q-6i(s-v -ML,MMXZ^K- AMPl=Q ` ݚ\\ Y p`=K 0CP0S1PP1@ < P@KK31P P1 <  0@P@AW L0T1-KPOK@KK✜@1S ` h@`V OKלP@ `yL R(Kr0rdK5/k>xKrTr -@L0zW8-PRo-3p00S :S[%@-R_ ?,:S%KhC-Ը- -0;ML M> 0: 0wNK> :> .0S. F p> +:PP 0od0oedPePP>e S00R0|) K A PP MP$g30S c30Se0S P;.KpP .K Bp K @d0oobᗾVePU<.Kh0<l0<p0<t0<x0P;hPP,T2>K 0C `C 20$>K(8P> <> ?  (^ > ҿpW >[ST70)#0a?o277'S7UUPP0U67` 'S, K (QmB0 'S ,K'RA,K mB (\0^K PE0B Q S0, K0  -Ct x0nK `F#P`0&F^SJ ^Kj2 PEK⬎ ` 㴀 @b20>KJ0>K>K 0=KJ0= L6.K= 0= 00 B4 m =KSp, =[S)0K !nK.K `F B0 A.K BK0 @ t x0PE#` 0x%F  ᵽ0SyZ|@pW,5D6/L RPw~K^ cZ >K|p`PwK, P`P 0Z 00R ,K2D @ < h8 0 0 0000 0/0pP KA%0S> S 3  S  ? v`#Y /Pn00 P>|p0> > S 0S| >wK& H 4! +4#*"* ) 2) )0> +"P > P>od >R  *  *e R*)xhl0t ʉ *p *  <C CR%Q"(P 0 30 ] P 0  @0:0 :-1*::0S X1&T1pQU 0//? =K1K 0C Bɷv ? ,0KA:(K-D%]rr!zd@wv-Qv-NEFX{r'Q`r@.%,- :L-- -Ը-r(-rerx%pr 0co/bC-p P`ȀȐ@'D  (TpPP  @)T (T^@N  S 0 @00 0$ $0 0 x-L |  $  0(! ),!01 0/x-00/- 0-DP@(1L$) c (0,1 0 010x- 0-LM02.KK00 0d0@00 0T0@@@41 0 0K0@0<P2KK0$ x- - `(RL08K 0C 0C'K; JKc0 H @T K @p 0+: cP:S WpW >K 0C0; 8W0S R Sr0K;  a0p @;  K @⯷po ;0% ,K B.K B+s S; K 0C K+ A hp;0; *  ; 0P; >K 0C K+0 A ,([;R>KK 0C A (: ћ : R*,0K 0:B0 q;S; Ẳ>K 0C ⴲ W a0 ᬲ"@TtPpp` VDTB T DlP`Gc {4>K 0C tpP`b  R @ 00 00000000 0 0ap@`brKNt*L02!tf0'KA9 ?9S oob(K0-Dz-EP---T-td@edA$tt~-  -Pp`L@T U  PP 5P`U. 蘼% 0-LMh d@ EK[# EK◶P@P@00 08, /tK0*tx--9t=t P0-L@P 0P0 K0hl- --L M  K --L M0PP0 ( @P G <  KQFtStk --L M0PP0  @P ' <  KQottkptFt 0-L@&P@ @o00x <0-L@'P  0P0 0H0---h- <0-L@'P  0P0 0HP-T-l- -LBMaP0S  @1!00@IK=0pS IKP\A 0IK0|08 03/P C0X000 S S *S X 0SI/Kz}HX 0IK0 0 0S l00S I/K\ L000000$KP-.-`-l-ttttD-$ux- Q-ppP`1`#WLxPx@ Y,P w v-RO  ?=&Kh&@.h- p-ML M`bP  ኶o,XP@  ' BK#PP AK+ @!PPAK+p @PAK+ @PAK @cPGGKpd <-LP P *u3u=u 0-LM@P @)A 0 K0`ux%Gu -LMxtA )v!)$%\q( )0 @!< 00ܮoKFKPKp堉U(0 <80P00 0  H0 PPP0 pPb9h IK\ %!IK␴ Kux--8y-LI0 u u*t -LMPP@  $0yb-&P w`P% *G)0i`0 (1 ttQ00dPKe`L0pIFV(40 Kx-g-L-I -L< Kh 0-LMK 0 Y K -LWMpl1 h! 3Q 咃C g( 3ß'Q ^ Q 0L0P8S `1 `'V^ 0SY 0SV`1SM 3k1%, 0 Y-0"K 0p1 `!唢Rp1 R000000-R` )R (R0 'R SC 0Q`QR lh1 h1 kP` PEP 0!S Q}m 00~0000  W8A 0 4PC9P  0 bWWOKGᣴPAK❴P,KQP zP m|teh d(Ksl-u-h%x-8.@.P-u'v^vvvvvvw'w 0-LMK 0 B K -PLMMJK,@D`|PPp DqP P EH< DpP, DpP P EE0Pʲ pP ֠PdP^ ṲE Wx" 9P  0=SP CwP 53U'  婲P 夲PP pPP 喲PP  PE ųó 0E.E,E(KFtpBwZw h5 -@LMM`A.Kp@; B'PP ᨳP&`5&`0K rdA edA(00#(0/(00#(0/(0:(0/ 00/000/ -L|MPQp r@808 00 F 00 s0s"`@䐟t0@T0 ` 0 00 0 0 H0 ML l0xK@0L@C$(0:(0( L xK(K%` 8 - - -@LP$1$09<00cC1a0$S  2 R BoS \ (  ( #`CooB \b`V R(  ( C\( BoS \ B/oS" R0 S-k( 0-`@MPL 0PP`0 p W D #P0/W  /0#`0K譺 p-L$M(@K`$0L yP 0 00@@P$Kp Q -L`Pp)@4i050 ~ 00ᴐS$SS  Q  0LR00 07@2  2 *02`-- -LP` @ `0S 0C ^4#0@C R GRE MRT00cS800:0 sS00- -LlMR0`+;0d0 `p0T`0 ,0K0(0Cl0 2!넂0"TK0 0`000 0@0K0l0J0 00F0TK@K,"Pp u ?0[S @0[` R`S#a CL0# 6@Ktpd00g\0 0X0 0X0 @0[SLkX K\K@KnPX0\`0 v!p@ `0S 0`0J i! 0`  <C0&K P00X0&K 0T0@d0` 0bS*d0T@10P0p0@0g00>!0 0@0K 00 F0 2W@g@t0J0@cT@@ @(K-dKظ-`-! 0-QL L 2$ -LMP`0p@ p 0Z !Q*  0 $K- $0-20LP@ Q 0S(< Q񟗊  ( @ P l P(0A1@@:(P j ;< (Kh  =(PB(0`(P$P@A$ N(P> 0 G(P?x B(PCs`(0m 7(`Dg G(0 (A(0  (;(0@ (5(0 (/(0  ()(0  p(#(0 \(Kh(PE4 Khx7pxxxxxxx -LdM`PTK LV00 `8Bpph0 ' $"012 0@00 0h0@@K0 00KF0pp@m P^ ?0[S @0[W`S#La C102#& 60Ysph10;\0 0X0 0X0 @0[SL8X K\KPX@\p1 T l0 *B d d l0\ ̌ P&K0&K R0R0&K P0R0d0\0 0L\P01@`0S  0S030f 0`(Kظ-dK!`-- -LA\ S R ^ ^ SR LPQLpPX@T L`V P@WYZ`W@#@3W@#T a ay(00 0( S/ A00 0 0 00 S<3:} S;3:s;:0/ 0-PLQ@=PQ 40 0-@ 0LP)PPP 0 -L0S010 40 P40 000 0W <0 8 RP8 <0UP0:0L U0S 0 P DP(K舃-%n --l- -pL M`p B R ?( * P  ruE'D74F'8G'K0CCu=T@@ӣ/8 $K#|:1l&R0'4' B B0'4'0'  ,'L Kd- M/0-L@u00; 1<10 10$1P0(10 , 0-L@a0 08'<7@70  0-p`@L(M⠀0T 0S   T0@ [@ 0D DK"PU DKP _@$KL-0BϠ0 01!2#- 0-L@Q'L ` t (P (Pp< (P`D (Pf@ (P<4 (P,8 K0h0 p-LAMP`@ GK V{` t H  ` j(P ((P #(P(0`V(Pz,0`Pk(Pt00`S0 HLIP0S@!GK⎸(@02,(P`T <X0S !GK~(@"(PP\0`&`0S GKn(@d0Sڬ GKd(@h0Sp GKZ(@|/G/K m(P(`l0S" KpS|! p-LCMP4`@ GKwVA  @ h 0<`K1K@0S G?K` 8`V(@#(P  (0Sڌ GK(@,0Sd GK(@T00SD GK(@4G/KKpS !| -LBM0`@1KQ_ t   0 D X ]KP p@0S 0SG?Kp(!ᶷUp(@]KP p@0S 0S G?Kp ៷Up(@qG/K#(PjD'(Pe,'(P]`0'(Pd[4' (PTV8'(PDQ<'(P^L@',K qrsuvw -L,M @PTp`VP06!\ @0@3/`P +.20 `M0( E S 0"00 G/  ( 0 DP7/Р(Ki -@M⨅L MPBP 0|0p R40Z08p,6K,3K`  0 S  P   Pf0$0 000?K̶V000(0S0b>K 0C$ὶ00,0S0b>K 0C|$pᱶ0000S0b>K 0CP$@᥶0/K 0b.K0 B(P)pp`000; R&pWY 00  88 PQ+< 0p PtSLl3@Tg(K ,0,&KSy0n00b>K 0C0#Z0 #00=0Sy0n00b>K 0CK000;(0"S b>K 0C ";0"00=,0tSy0n00b>K 0C,0k0` 0S b>K 0C $P"p0 ; 000S b>K 0C" p0 '#0=0S0b>K 0C!p`000=0S0b>K 0C!\0``m0S0b>K 0Cl!(ߵp0 '#0= 0S0b>K 0C4!еp`000=$0S0b>K 0C 0``m(0S0b>K 0C tᲵp 0`07#;0 0b>K 0C᥵0b.K00 Bt $-o}}o8}A}J}S}y i}r}wL{}}}}}}}}}}}} 000S/ 6-(-} p-`L$MP<K@V| $ `  H a(P2 (P,1`S 1S 1!<KG(@U|(P1`S  J1S 1S$!0<K((@b61S 1S1 <K(@(1S 1S 1 <K (@1S 1S$1l <K(@p 1S 1S(14 <Kc(@< KKpx!p p 0-L@;0@0h0ъd K0hɛ ~ P 0-L@000(0,0000幊d K0h豛ꐧ~ -LM@ TU   0 d p | 0 000 |@ta;(0?o2(0,0?o2,0@M0@0 00  @@P@no T@aX@`\0?o2\0`@`d@ooh00 S0h0l0?o2l0@@@`VTPP@ GK0p D0 00pdPd@K! -LJMla@0Ps 0 ?@T" , ` l x  6@0P 0PP@0 E)(Pio ,P`0P`@@P`VU@@@ GK0d ۳0 00p!"dPdK4%! -LPM0a@0 $0Ps@ 0 ($P U7    0 < L \ l x 41$ D 1 $ @K!v@0SD7P6 nsN`sN@_osN@` sN @`M`PP`@VTPPP 0x#0IK20n(P@`_U 0I/K00$1K R m{` p R IK IK0WS(P H70I?K0D7 0S 0(PSxt s1 `S X0 yH 10 0e0Sq 0S(@V 00D0"0<0IKe(`LP 00p#% I?K A`$bK$aK0SI 0!K10S AZK0-K0Z?K/W?@1 0<1 L1UK81 041 0-K0U?K01 =K10S KK0-K0K?K 뀑$@ r  0p 20 0  > 00 00R0  0S0C0(KL--h-$-y ,-t& $-\-\p(-0-_ PQ-LGM0001 0005e@UT3 0S. 0S P% P  :S P P 4PPPܬO4TP K4 @T@tP`0#00KKKKլ`P K/K嶬3@P K/K宬K/K  47007,'xp0  LP lQ'"@ 41 41p0W p0  LP lQ '" 41 41p0W  D70@70<78'a0K/K00l|P0 00HrPv040 jPn00 bPf 00 -; 0QSVP P HPUV,Q+ P t @= ` D00<000040@ *P 0(0 0 P `00       P P P P01S >P (KL--(-p-`@-x%ۀ%@kXm7ρRm p-L$M0 0 0080"40`0CSP @T 0S VtPr 00M@80 R#4  BRaH' x' x' ' ' ,( ' <( p( T K :S 㟺 㜺L0K0!㖺TG PE ?@K@!㉺;  0 0 00  0 0 00 " 0  0 0 00    0p 000d00`0Kp- (  D-h ( (-X   D - t 0-L4M`@ 0 D0K}PP!0 00CP S D < 20!TH RW l^PP!\` 00 BQ RDpK 0,!0 20  p!4MoMVM?/ 6PPP(0 0@9`0Q  P= 0^ ^SD'20 D ͩ R K#F-`-{r}- Q-LP` @p pW@d1> R U 0 QVJ 0, 0zDHS1 Z>F, 0  ZCE LT qU pQV0. !0' 0R; 0S00ʃ ̌ ^ 8@U \@QV8   R8<0\--$- - CMLM`0@K,J# "PUA pS S S3&R&R-P&R) C,K B0 dCF0C8 B0r=K80CD n=KKr K 0C,A@@<Z? 04P04nK04P0R0 0K000P 0 Ah儸p@ UK,A7Ÿ5S(40S R  3 GP ?0C#K 0C!pC+5 P:|BK JT" lP,0K@,4[/S1S0"У/(P TP @T0:   @/R K>K 0C C.PZPKP4: S pW>0>+  SP@]K PEBK+ @ P(*P2 0/SP,4[_oPRS ~pBK @z0%00 PU+ P*BK+ A P:?00 P@ @@(K臫8y -LMK@JP  Ў@P KŎ P ߎ ݎ 88S 00p R K  -LM`pP4 V V /@P% 0S P DP0 0KLpp峈0P V@ VP00 8 0b!(K舅 -MLM,} PKA PKAP KK A@ďPPYKK A@⻏PP XK+@KK A@?@PPhI.K0 BXP.KH BK8@K,@K+@KK A@@P K@.K0 B]PK+@.K BPP 4>K0C"HPK|@K+@K\@.K0 B 3K8@K+@K@.K0 B K@ @PK@ @PK+@jK@.K0 B@`PK+@WK,@ K@@K @ `PK+@<K@tpԀ1BK0>K0C @BK@P B.K0 BH㽿` VU C۷ 㷱 K %/8xBNnZ=om~}%C-pjP@cW ˑČȌ̌ S ̑́  #3S#X0 S* c T @!PUT Q0R@-Q0AQ20n/2S 2!R !!!! !/ -LM K   04 8 <0 S0 2 K -L M K QQ@AOoB0$0 "^"R      /o"^P Q( ( ^  H (  H X Q  X K0@-O@@ T? @?A @ @  @?A @ P @ @ @DPH @ 01#? #"0R000 -PRP``bULT0p@RO0<0S 0U 0V*L L@- p-L,M@`0Psx0 0p00h000 060 0 00㥳p 02ZKp贿%dn M 0-L(M@Pt r|0|P 0h0 00 00 00 0 (tttp ,K0贿%-` e -LMxp>p1@l1h1  A?0@@ DA@H01`S0`01cP4< 4A0P  0R 0Q0@@PEZ U04q4 00 P004  0*  41@@cDB$0@ @g0P@44 PE@(K`--ظ--O p-LM⠵P㝵`@ T00@  ` P@@0  KpB -LTMr,K " 0 `Wd0@8`l0, K0" 04 8 p됓 X) `S?KlQ%{oVK0\# 90 0G?K0 0 0l100<0ppu WKX\1 R bP 0,K# a V:V: 0 04 8 <S*^P ,K"  c  XP [/K ^RX \rπsc P:r!R, t1 P t1q/2x1r0#Ƞ0r/0c0#8s/001v/u?q?r0s ȃ0p800#8w/0rs/080i0#802 02"R uv080i0#80p0  08 [?K &4 0&8` 0&<`f 0&4 0&80p1 `0&lQ`(KX-ظ-`-! -L(Mr $K ` WpR@ 3,K1pPu0#E0 0 0割 8K1W800 SPU <0  RQ "RrW (<0rU0  Y 48 $<0P(0,K<0"R  2S8 !R<0 20C211Ss_@rq?0ro (0s 80 0P8 00#800T0222SH<0"R vw/08000#80<P`48 <,<2S|000p10 K04KP&40[030[ 020[ 010[ 000[ 0/0[ 0.0[0-0[00SU <0@ Q0R000US*<`2S %2SP  0rπ4 8 <2l0<q?!80 0 s$0(0<0a0#80P$K贿% QI_X--0 0<0810S 04 8 <  /S8/C/000 <CP0/;81<1/X-- -- Q0-(@L} Q(@L H0Ax0s(@0, | (K0h輸%p -LPMw`P@0 PlKl KP0lK9K@>PP0 PlKݚl KP0ֱlK(K0@S@d00 <`CH0P ? ??WV0KX-! --d- 0-@o_LPQ 22#@ V01x0t0 C0` X4 o8 Q`Q#    Y   屮 J\   048<8^  QP .B 0\Я~̯ٯBPpV Pih廯4PP !P(K--(-sTl PQ -X- 0 -LDxp P |  }贿%̪- -LM`,K p0WpS@0 RU:0 PP[1 |(; P0 4 PX 0<RPH1 0 00 1 -(P  Ā RȌ a ̌0  0i \ P I  ն00Pq,@ᆵ rP  eW 0S p00(彶0 (帶(K$ظ-? -L MhRp`1S`( 㾮`㻮d$K00`@X񟗃n o Do o Tp |p (P婮`: ry(P埮0` ( 4 8 <8(`呮 P0( 4 PpX 0 <RPh1 000 @01 `0(Pm0` ( 4 8 < 0    p 005!(`M0S`!d!z(pC 04 8 <( "0 "S0S`! d! K茩-ظ-`- -AML M\4 @PR `*P 8$0P P $<10 <CP0;<1/4B.K;P Bᰴ0P44 p0T 0+ $ ,484 }a P!l3$RooY`8484!RQ !R QR!R!RWppRr"Pp2?⃯84 Q  04 8 < QR   Y  $(,0$ 4|p84 S`YR 1W0SL a1!4a8al20ad!h!l` 0V84 7 PPG 1/bs0s/84 PH!q<0f0`r Ƞ0#8s00 `i1&41&81 f&<1*4ڡ1*8*a1ݡR"PW "0S Yp~PP @344Szo@ HU01U01 (KX-- -d--UU 0-bMLM<& B.K0P; B㯳0P46 ,U 2bK, @86 86S 2S !R s/EK@ QP1GNK1@p006 0   (      9<6S6  8@6 ` bD&  V `!D&@6 ` `&a? ?`0`0C`@6 `@60b@6  V `!@6`00`&a?0?```06@0S06 d C>K 8&bK;$ 0, A4`PR|P4>(KX- -U14 `o/U -L\Mh0 3o0x * Cl RPʓ?\Q ` X#0A)P?`p l0x0 h0``<0K0L0K0T KP0K HP`VL#K R?#K40K0@0K0H KD0K 3Po#K@Pp@R_ 0EK#KX0\0D!#8&K `0 -LMt@t3d:*别0K K$K@P!K$ , 勫$Kn K-ܸ- -LDM8P0O00@0 @R.(@$ 5"$K X4T?$K080K E>dK`p$K 8K/$KK0`*pK?X4(T00+@ @%$K P!80K0P@ 0 Ͳ(K-pZa -L MQ@0S pǪT`aL0 $#6S ML @ 0TCt `&R @LX; L 0<0`  hWH* DP0H0# 0Pa^P X 6P000LP0 /SPP0Kv> 0(000(0$(K--.F mp -LMΏ@ Q0P P R00H4S 0*En 0 00 R0⬐ P/N p?:H4 0|00000?` v?)`f@0`0 00FV00hA(Kow ظ-`- -L\M0 0`0 @H4PS"0$ `0S "%K0\Xh$h \ H0( r0S0t ?Xĕ $ T400$ 8Klp l0DpK38K0 0 0 00`0p)L%K0nP40S " R0E΅" 0 040ZP!XD%K DpK HKN0 %KH 0H0 0MS +S GS SH  gS cS20mS sS 2020RH %K%KHp0+SS0K QP Y 42T0j ?&KP0F?#  ?Ph0! %KP00P0 `00s%K"b X4( T0X40+S R %K0XD x10*KR K?R%K%KKSR0eK,0E%K`Vp `p`%K"0%K 0H40H4`00s(/ d0K"0H40CH4Y0fYڔ0V0I f!`  %K 0 V"x(K-9ظ-TD|`-t- -LTM$KKͨ8@;SV(  `0/ p-;$+`A`wsUp`Pa΄TWkP[VLk `k(`kf`˄kt)`km@`p㺞+`Iu`rkn;+Fv `p;+`A,h |7,\>o *0,`>e 0,d>h^&-mp?00 ~ G$KK 0 i6P0S < 0bKtH;p+1!%0KP 0KP0$K 0 0L;>p? K>C?%K000SI 00 b0WV U : D0 ?$KP 2#fpD0C$K H0D b1!p00 b0QP U ?$KP I2# ? @01# 00>CPC000000 >`CVD0 0:NCP 00 ? 00 R R0 D0C{@j0F5 ΄`L?Q0P0P- 0V L30S 30S 0 - 0p?H P -=`PZ`p` L R0 L0Z `? S0Q`L `- 0`?0C`?P 00S 202 0 F0R0 ✤0 ;S`?S0** F@>`CV0p?S*?V0^>Ђ U r *? V0 A0PExN0SU bT10p/TZş A 0 1#( `pR ?R`pPu1``p- 0+ V000U00S00 U V00P 0`#KdP 0 t]P00  `0#K#K 00@#K(K- ---b| X-}#F -OML M⍦EP`V :SVNK- @ N0 ̆ L R0 N L0 N 0 L5P ` L``N`X0 ,Q.K B.B,K B$`V~KA ?IW?.$㈦ d0**`-  a>0RL0LC pL0 X# &* &;6;604 ;S  87;D'<7`7 0 0 30S#0 @SS HP T@T@0L T L <, LPH1L! bH!@0E4 0В4 4bsO L4` 6SCT1S@ H!R= P0C0.p! p!$T(T!VpT1Pf`R ~KL N nF``pp\` V S$ $ L 4! R40C4 10S 4QK0p0 8 K$F -L(MP`pD@  @K 4 $@0K  0R KX{.  0-@Lp0000 -L(MP`pD@  @K 4 @0K  0R XKX{.  -@RL RB700Pp:`W *WP0 ӋP00۪ -LM@`Pp0*@K(0 0S* -S,0K :S S +K00  0 00T0S V  ,KK@PT1*K J 0Ym700%48 @0( P@48 0(@ R` U ` pHL0S H0#S 0 0R G(KX{.+ 0-LM@P 0$0 0 0 0 0 0$K 0 Fup #0S$ 0#S n0 S   00S 0(00 00 00@0 @S0  K0? .0-L@Pp00D U 0 p 0 0(  # 00-L@q2 ` u`qvfoQP` u`tbvPPP`V 0 S   0 t p-LtMtP0 K 0 +p@ 0K#K tp`t@ 0R {KpX{. -AMLMQ@ӘP0p00 ``7008   X8C>K@`V CKit0 0R K(KX{. -@LP`pP \0 dP \'700P PP0` pP00   0-@Lp0St000 -P`p0Ll0@T T 0S V EP @ Kh- 0-@PL0QL\qc$0U =JK0h>X`" 0-@L PG,<,08, ;0dd7- 0 0 8  D #0(00K0h g~ -@P#:#l0L00`V 0S 08 B  B  0 -`p0LP@ @PlKh 8  o@H, 00@]p D 0 DP 0-LM0P0 0l0@T- 0S( 0  R Q H R00 bP000 oP oP000 0S h1S P000 @ K sP0  0l0@T 0S *,p @K0b D0-SL@ D0SH 1CD00CD0H0H0L0S L0SP 1CL00CL0P0P0\0S \0S` 1C\00C\0`0`0PU aV 1,P0C1`$QU (aV (1,P0C(1$$a,QU 0aV z01,P0C01,,aPU`V i0,P0C0` -LM@}0 PP @0 0<0+c0(080CCpi C C C#Kh^K0 #0(00-L@0H+08,0&00D0S0 SK0h+ꙞT 00-SL@008,0&0 D0s0EM08, 0! SR qK0hց -LMPp4h@؀D0 0* D$ D0  ! D؀D 0 0  D؀D0 0.0 D D؀D 0 s@00+": D؀D  0!9 DD0!0 2D 0S D#K 00 0# 0#K 80܃KD8 D0+X ,0K8#=0S0%00 P0 0 Y  i &, K03?0" DD\X0 D 0' 0S$ EP0X  \&   X(Ko\&S *X&0^X& (K@w 0-SLP;08l 00$0 :0 V 0 P@@@@ 00$0 :0 ] 0 P@ P@0$0 :S@$ -C$:0L$l0`V $:0 UPDZ$90 ]PDY$:0`0$0  :0@Y0  0-LM0@0K# $ t0 0l0PU k$P P@2 < 0 P$P P2< w# 20  l0!# b0)0^  Kqp pP P 7`d KƏ P @H qp Khpp pp  kppP DqAq>qvp#)#pp KNpp`x eph #0#]K0Pп ֞g.7 0-@L@ #K0h8$#K0h- -LTMa@0P(0 l0S 0$I0@hK-p| 0h0K p0h KYP 2 UpP @ p h= U㰀  @00<0x( 0R  KX{.Zl -LM@Q`p` R  P0Q}0 0 WV  $Kk$K脟 0-@L 0S0 0K0h -L(MHRp `l( Y @P 0S 8، 0y 0Sv VH0S$p2`P $p$0A0AS`v $0)D0s\ S  $0x00D0($ 9Rj( 0RE$Kk<( 0R=$Kk V3D0S0  H0D`S l`Ip 0 HK⭳1l0V HK>P 0@ <pde(jF_( 0R$Kk ( 0R ʟ$KX{.T -LM$`0xP00 E @ # Dq Q  0 1P$0A0AS 0,K2@0 K2 0$ .+ 00 0d0S  P 0h Kd'( E+ 00 E 00e -`0 K  W\6Y*0X 㓉(᩽P 0 K0 0 0 d :`p 4 E 0 E E 00' 0S] E0!0 *m E 70 5~ 0S E 60'~p x, 00 0STP Q00 0R (KX{.ԟ &0 #0(00-L@ 08, 70 A p {K0hOU -P@LT` pVP00U0V0S&` 0SY 0x8l+' / 0N ~ U V   F@6 0-PLMP@( P PK PM`!``< T00c0@0lHP P) P8! P!P  P 0$! l0@T @ l8pxK0hlK0h\K0hK0hiK0|RBbKjt/ 0$  0-QL@0  0S0K0h -qLMpP@( "l@P00z 0S I,;, 0 Sl   0a(0K ,K Ptj@P00O l`P 0S  $0$0= = =0S! ))0 S   000l0 00@l0 0S 0@ <<@U, K 0S P 0 S   0\}$K9 -@LM Kl$/.pTTL0S$ K 030@ 4Kgp` Kd  0-@PL0P 0 S   0 P 0 S   0P 0 S   0$P 0 S (  0DfK0h 0-LM$K-hpPo@P P0P0000 P00P 00$P(00L0hpDK0 -PP0LHMH0 1! ,0S , 03/H R :@T4 \KgeK WVTQRQ 0 S   003/00(00@(@T R`0Q$KD  R0$K00D0 0SL'L@K0 0@<0KDdfp0S `P 8 R<0@<3/$0R  R 2/Kvsʚ; -,@L M 0 ? 5Kx% -Pp L@` P ڢ30#P00SP00"3 0 ,$0  Kh%x% --L M  KOU -ML Ml@p0P(0 `BK0 @8zGB.K0 B$( 0R  KX{.OU --LM  K --LM  K --LM  K --LM  y K --LM  K --LM  a K --LM  K --LM  I K0@~% P-L,0 ~V00%~ -Pp@\`LT`0&P @ 0-@PL0GMvfaTK0h  0-@Lp 5e0S0'K0h 0-LMPd@ 0K0  K0 K0fp9[ $00R ŕK0X{.i -LM@` 0PK 0 appb0  K0P K<ZKUfp :[$0 0R KX{.i 0-@LT LX@0 0-@LT MX@00Q  R0 # R//R -L M@PPG 0SD  ;P> ` 4P7:YpP 0K0!0 0    04S@G0 * 000040@@  0 P@0:S 0@00 0 0K0!0 0  M 00S000K% p-LDM0@P P ` Q@ XKpU HK P @T0S00 0R ̔KpX{. -L$Mp`@T6 0S1 P, P0S S $ R P0 `P K0S 00S ` `000 OP `P00  T@%@(K P-L P 0Ql00l0P $0// p-LM`Pl@ 0K 0  K=0@U K8P e 0pR EKpX{.i~i p-L Ml0`S 0S Q  K" $$0 P   l0@T  R0 $PU 0R:D D0Rʌ0S  R H R 0Sx Qu H0Sr R0S  R H0So_P_P y_P _PV q_PQl_P}_P d_PM0S h1S0SrP 0S4 h1S1 rP,h1S0S ~rP GP h1S qrP @ @0R*p $ R 0 l0$   0P00@@@ZPd 0P0@@ @ QKp -L$MhQ@0(0 0 S0<S; Q Q'\%DK@)Q.Q /Qo\Q$\ <`K p\`,p`` V0l0@T 0S @00( 0R  KX{.c 0-L@$p0 !p`0 -L]M1 5`0PF/SK00 9<1 pPD"p;@! p X5ZT% ! Y' 0S 0SaKaPPU ]K P PZz&1]KP s@PnOa40 0R 1]KPZPP PZP# 20PP@L0TP0 ]KCPL0TP@ @X0 ]K5P @T0TT0  T RP@H0 ]K!P @D0TD0 @cOoSB@TP  RS]K!PP]KP$P]K13/ ` ]K0$0 0S1 d  SK < MK ۥ9<1 1S/K0181 bps <1 p 1001 RR6*R 5R R/R 0- R R0( 0S#D0S U 0P1 V1P0S D0S! P!P U hp0(01 = 0)⁥=)L(0P=S 0SD0SPP#0 0R0S 0#pK#00@0#p0H0@0 Pd0@0UDP b#D0000@@@(KX{. _i@P/ 0 S S S//P0/0 S S0S//@-84SpLe0s0840A E80L -LM4 @ᚑ`P_=DpP llLPP 08 Z8 `P6 R0 8 0<0 P<0&T k@P( 0@0pP0aP 00P j0 @P  `J@P0 1a 40@(K藍 -LMRp0@00 8 [0"ST 0:\13K0  4KP00 P3K30[S. T,  2KZ @ 02KP0A\ 0SP20[S T   pZPT 0@T0@P`pGoTrpW00<00 0R Wm p(KX{.% -PLph  @Ph$! (!h6 0 l60 00 =0009 00J0@@ P,! 0!p6 0 t60 900 :009 00J0@@  !`6 0 d60 00 000 P000p@@ -L$MRP` 0S U00000V9 K/ត@PC (0K 00 0 p  (0S V BPU @PTW@ /00DV 048 B 40 8 0U K & 0-L M0K 00P 0@ G0 S0 K"0 NP0 P00 P00 0K0 -@P,pL ` 0e U*PP,p$` PP(0e U*P$0(0$0 -L\M\0 0``0 >p0P00 \010CzS9 P-P-4P-PP-P-P-P-P-P-P-P-P-P-,DD\t\ \ P-\ \ \ tP-P-P-P-P-P-P-P-l  H ` \ \  ( t    \ x P\ hl8\ P-d  H !!!P-P-!T -p-"0"<"$!T"t""4-") + +$+`++<+x+l+,+,!!dP-,d",T,,,`ps,%,T <P `0 sPPQ u, ,,",0hT3  00p@t,',C,",,&,,+,,(,T @0K0D0K0H0K0L0K 080K0P0K 0T K<0K)P@L000P 80<TPU X{.Eg_lҫ9=^Gcquz¬ά۬ $-7<KXyF6IZixȶ>/ҮzOV\dks[J$HH000P 80<T`P00D0@0P 80<TTP| T @0K0D0K0H0K0L0K 080K0P0K 0T K<0KP@H000P 80<T4P RL000P 80<T%PPD000P 80<TP@000P 80<TP8 T =ᆊPl'x EP0S P ,, , .P   %P P ,P  @P  T P  hP7 pP. @KDKnp  8Khp M `P 00DK @K$ 8K@ 00` 0` 0SQ XP! DK<p ! `P ,pK' $ DK@ 00 ``) P  P80K0-0 0/ B80Sh `^ p}PP$/ ᮉ@PP  @HPPT00 80K0 0 0 A80S= 3 1 @KDKP/}P0D H@0 BP D6D H! @0D&0 @KDKP/^P0< @@0 BPp <6D @! @0<&0T QP LP,2,, 00,,0 0,y,0,s,0,m, 0,g, 0,a`Pp DK`MPHL PlBP L6P L&D !|@TT: @0K0D0K0H0K0L0K 080K0P0K 0T K<0K0@080P <TVP~ 0S  pT TPTk< b T QX Z^p O,8,,!,,!,,0,,5,,5,,0,,';,T",9,Ak♏&n-Ak⛏o)Ak❏'nAo⢏0` V00 `0X` Z T`  VX$`( $ 0` 00T \0S' Ph {  P80K0c@80d S  d@P \0d0 pP0:0pPP 80K!00 0  8@8X Y ` :=PPXP X gP a@RPpP w gPPN@?PpX gP @@1PZp8 VDgP .@PVpx DgP @ P\p 2gPP gPY~ zgP; ugP pgPSn jgPPg8cgPPa L]gPP[ `WgPPU tQgP PO KgP@PI EgPXC ?gPT\;7gPU 1gPU \. *gPU $gP\" gPW 4gPW HgP\  gP\ gPV PX0S <X0    80Sz\?o2= psWX-a@RP040fPRp pP \0S0@<0  <0RdPRQ 0<0 ,@T d0Y(X0`0 p )P <  e4\00CSA,'3 R@8 `0@T `P0080K0 0 0 `>8pXX@P 0 p` 0S< :h2Px 0 t<@  |?Pi 6< &!|xvT 606, 0,|,8,v, 0,m,7,gT_ lP00^$Y, ,S,7,MTE P P P,#,6,#,1,4,+,3,%, 4,,2,T 0 p9 QTn\W30 0 R 3`oTrpW @,<, P pT /ኅPP004KP1pP40[X0 30[\\0 20[1p[`0 0vS$ T X&#" R$ X#S X Z Z X\\\ `\  R X>P_0\&T0\604 [pX` 30[@020[`010[0000US@@ 0S 00j/P@ zCpP X 0S80K0x 0 0 <=80S 00;, R>P{.,@0$ 0 0 0$0(0"(K迶@2Mn TNe:ïX{.pX -LMP` 0@ 0 P 80 4 P4 80 PbUT0@$QW8  0,0(Ko)(K萍 -LP0@P 'f8p B`p`B`pk`plc Ɠƃ 0,Ѐ Bpc0BBГE -L MpS`P@7 0Q 8,K# 30(0K0 0 =p0   |    P  U cK8 `p $KH%l. -`QLpH1SP 1PP 0SP 0PP  <1P P@T`Vd6S d6,P0Cd6`hVl6S l6,P0Cl6hpVt6S t6,P0Ct6p|V6S 6P0C6|V6S m6,P0C6XKhE -LMP 0 `P /Hp G 0 G0p0 0 0pS# 30,P0`d6,P0hl6\,P0pt64P P 7l0܁0 0 ȠKPH 0 R q0P  0 0K0 s0TK0 P 0S 0K000 0<0 s 0@0P 0 S S0P\S  @`60d61h6`d$1l6(1p6,1t6016hlpt060<,#g0P0 , 0 < D)FL5ߓK,:SP(K @0?o2@ @ 0  KK?p)  0 \ \ \\  #\ ;\ R@ \  P \P  "P! #PQ  Yؐ ,K+P 0S 0( G:$ G0@0 0  0@0P 0 S S0P\S  @ <PPV 0S\ `;P `\@w`01S@\@A@>H P 0S6 P3 @p P0 S% P" P@_]00Z0S  PQ XN0K00K00 0 0,B@?嶔   Z R 00 0S G$: GX(K 0-@LP 0 S   00 -LM1PP @0 0 1!O QP1!0`K< $0  @lpK <  ~\|X 40 P0 p0 /fP bP Y   0 Y|0  0`000 l 0p0`\00X 00 0R )(KX{.=lI.wò5߲ 0p t00x |00 0/ Q0-L0P0 { 0Q0@|t0l p匸R R AR 0S0\@00CI P/0S/\0 0-@PL,0, (\pxK0hCI P0-Ll0l hG@T 0 S   0@P O L0C I P-L,0,  Q0 \l+I 0-@PL,0, ( PP 0+I P-LP0P  \00S40, 0 0 0\00l$7I -`P@Lp \0PV0U0t00PPxP\0PV0U0|00P P-LP0  Q@`$p h0` d嫷P @T |0 |0$PO,I P0-LL0L BH凷\0@xP00 S |  0K0htl4I -@PLP1!i\0 `R 08,0 0 1U'U #P $P UxPPI |0 |0$\ \0R0. 0+\ \0R'`P"|0 |0 @@UP $$OP 0Rps0S t!ph0S Lhp( k=AIb[w -L(M$aQ0p(0  1 !Fض\0PxY@" Y.P 0 S |  0p@P 0 S t  0HK0| bHK P \pP Ꮋ|0@0p|p( 0R $KX{.lDI -LMP@0,`K,pK0&0'U8` 0p  U\B 3P <Yd 0U@0  A UZ PU\ pP+ >  PB\\P@@PaQP``uPQt 3 xqP \\ P@@ZP  P R8 0 0 0 0 @ pX8 0U A0U/0Y0t00>P\00S8,#:* S R p M0S I0S |I00儀 pa40S t 040t 4  000p t0R(K賳N P-LD0D 9@崵0S S/00輳Xdz P-LD0D O@噵0S S/00輳fdz P-L0 c~0S S S /000 8P 0SQo輳qdz -LPx0x tNP P P0p 0o/00輳dz P-L0 %P P P0l0coP  0SQ@oj/00輳dz -PQL@`0 0S Q 0 Kh"0 Kh<0( `pUdz1I 0-PPL@0  Q0 弴0S 0S 0P c0%P !P 00 S 1P P  BR # BR #K0hQv wdz -L$MQ`P0(0 1!Y pW W8005 0@`@Oo@T/04 dP* 0# S @n*0Q 000S PS P( \ Q A/00@ጀQ0 DK0JDKCpKDK[P D08 @@ ( 0R | KX{.Ŕ -dz -0LS`p S0 00 0b/00WPPA@DBNANA@B/0Q `RôT0@d_D 0g @S01bSHP@T 00BW $0$ R ij@ -.єdz P-L`0` ` QP0D L嬳0000 04 8 <0#80輳ߔHdz P-LL0L  Q<04 88剳00000 Q 輳Hdz -@LTp P@`@P r@P` pW d B` -LMPpR@O@`P$ZP0 D_KU -SL$M< ] P0C00 00`V00 Q ={@f0@0 04 D0 D0T( 40  80 0H0 4 H0 p RPH0 _R@ GP  `PP 80w80`@0S00 `Pp @AP8]@`pP<0(K -L$M`0@p0< 80 =P W p0S6FPP4 P2,PP, ᭺0P6S#  P P P P | P lP \PPPP0#0!00 000 0P4  0@0 m P @0*f^a 4P 0* Y^0#0!04P~ lK\*0 F^4P r D0S,: ((*S00*4^4}P` @0)*^4sPV H0) ^4iPL $0)^4_PA  0x) ^0l0Y 40 @0 C@0P $ <0Jl00S  @0 0 0 0@000ILP 4`z80$8,0 05 @ ;P 6P 1P ,P4` 0E?oX20S 0S0E?oW20S p0SUEP 4`Xz$ Uj8P4`Lz$|Iz(40$ R ( R X'! R 0D8p 00000 $P 0`4P 4000 & 0Z]$P0l0` V |$P`$Y 0`4Pr 4000 h& 08]80,0 0 0`4yP\ 000 40-p0S p0D0 4  0`@ c@ PE 4 0 D0%  ]H0S+ l0I`0$02p 004 D0 @ C@ D0P$ 4 1@%  400 l0$0000000 0E?oX20S0E?oW20S)I R @ 08p P04P 0@4 0 T $p 000 00$0K4Kgpx0S |   qYP04_P |0004 x0  ^Yp 000 `EooXb`V(  Rh @0P048P 0@4 0  p 000 80"800K4KpCU 7PQ04Pu 004  7%U)0S= h1S: lWP6 t0 0p0XP-04PQ t0004 p0  XpF 000 U @DP04P2 004  0D80h1S 0C@ T04P4  10PPP 4px401S @0P 400!40< 0 4@T@D P ?4<(K[`hTu~} k´ʹִ%5CU`V( 0-LMP Kp 0K0!p@ 0@PPEP K0 0-@LQ [04h D0-sL`@s!S! !p0P`S  R H R pP6P pPFCP -CP l pP0S h1S [VP 0h!pP菞Tu`h -LdM0 0 (|0 1PS`0P K&p@ (!R 0 p0 0t 嫮P` 0P@ P坮Pp Ѷ0P 0#Z w01S V Ṷ pက@0P `2"Z0@\Kp`kp8 0\K||kl h d ` 0X*10C>S00",K!@03@0lK\Kk\Kkۺ t0K t`0xK\0KF`\KkV ̺`x`vt v%V# |Kp0S @df0|0 |0#40 t 8 4!SP t`P_ 0[0\0 |0 0`V 0 \0S \Kp@ 9 0 \?p0|0 X,`|0S\PPEP T {[(KdpFЌOUӵ޵ -LpX0 0"(0K>p0 0R 2nKX{.0p/o= 0-L0MPx@( 0@K0 DZ @K0@ KH>p (0  0R nK0X{.6i( 00-I @ L<p0ll0l0@0I00 p-L4MP@`( 0HK 0 危 HKĩH Kh>p 0 ,00S p 0R mKpX{.6i( -LM@|P`K0  0 ^ 0 pKX K` 厩 K0X> 0P [R mKX{.:i -SML MX3PQ @0 `5 @3@#@@RnK\0 `F0#*0*5K0@005 |0 $5 0)EK 5 x@T/$$%@0$5 50 5  P \0`00 50 5 ]P 5 0 5 T$5 0$5 $5Z<0$5 0$5;$5 R 50 5 0#@$5U~K 5 pG0 5 \0 d5 ڰ d5\EK0@[%K0 =x܀T@@D 5@@x @! Z 0@0 K @G5[S\0 K@zH[K AvYI @ 5 $ i$0S00C00@ 5 \%[[\5[S00C00@ 5  ` M`0S00C00@ f r ;p`50 0`R l(KX{.l^ -LMTap0xP(0 00 "0@0 0@0 @0K K@ P @ mp@2P@. uP @@0K Km@p@P@ KP,0 0K,0 0@T*00U^00y@T@( 0R Zl KX{. p-LLM@P`0@ `K 0  `K- 0VL O KP0K/ K00K, Q? K@0K< 080V` K,< 0R &lKpX{.ii@ -LM@p`P0 00 0K⌀弯 KKH00PK0K⣠KpKx%dK 0Y<0 $0kK80 40lpK K,<0 0R k(KX{.kii p-LKM`@P0.QK 0 傯 QK⹧0KK31KMKB0Q/K0,y< 0p4R kKpX{.Ii -LJM@Q.0QK 0 Y QK⏧0KK31KH00MK0Q/K00L<p (<4O?Ka $  P ```$` 0 0 bP  `$ b`Vpb 0R nkKX{.ji -cMLMP@(eRK0bK00 5  H@(6 , b~KbK pG Av F ;p@f $ P& Pn*5[S )5[S 0CS*S :0CS[RZ1S S   0@RJl0P %R R 0$%wR75S[K Ap@ 5[S!85 ZK0%[ A]K~s5[S05KZK A^K0t%[8@~)5[S  %[  =K 0C5[K%A)[Rͮ0@0 E@ @lG`P K, M 0R iKpX{. -LMp -LD 0PQ -L9 0P: -L ML0K00 0K# K kp  K -LM@lQH 0 0 0p0cK`M cK℥c/K0N:p>0h!8 0(0*000R c/Kh1 7:p'08,0!0 .QK QKUQ/K:p^0VS dQ/K\:pR0VS < 0R PiKX{.liH WiH Pi 6Oi H 0/0S// 0-@LTP0q00 '000000 -@L0PS 0` 00-`pKh( -LM@"P0h`K00 0 0000K00 0K00 0?00 80Qp /P)dP[c[ 000fP!:0l0p0W' = R )0 P0 p8[[ 8RP- 6[[8S( PPU'U% 000p00 _|0 Z|K0 T|K0 .N|00S K3/00 0R h(KX{.4OU -LPMp=@0`(0 (0?6K05K0[0K<5K08Sh l \@K!`0K)00 P|8UhP8U P8U l`0KP< <700( 0R iX -L@M`0Q P @ \ K=<0Ȿp(FH 0 @(>H @ $ 0R fKX{.A 0-SL0 S  $ ( ,\ P 0˪00 0-Pl0L@T OP 0 @0P K0hR0 -@LTP`PL00@ 0Q P,\@P 0V P @ @tp(v -LP Kh 0 0-@PL0P0 y0 S   00S 3/fK0h# P0-LP0P@ P00 0-@LK0h 0-0PSL@  0`RUPU0 0S 3/ 0S 3/0/(P/ -LMpPQ`0DD(0 p 5p@A K(p 6p7 <[S<[S.8/P) K⁩ K⸡ K6p K|6p p`P 0W  P p0$ K0"Xe6p4( 0R e KX{.U@qB@^lBfB@pB -L,M@H L p@000 `V H40S3 ` @K0`P0S8`3[ QP Ph U P! LP0 סP0`0` 00S00%%0# %0%u (K -LM   K5 KgB -L,M@ (^ 8  /( K!K( K8  )" K00 04 8K ,0 04 0R eKX{. 0 U4 -qLsM  (0SzyKh 8 vP ,_Kr=0)P#!  B    0`@p r Bp zKQ< RӨ7000<Q@@@ `|@ Q @HH Xp@`|@  P @@`|@  Br P``0 +0j01`1P ] @=000P0pH |00OC CqCw C*CCPU@ 0Rd700@0p 1 0p  =P*`00 帀 0X@U  0T000 0B0B0 C pCaC8CC 帀CP j! (K耗8 -qLsM@- (0S&wK,mK⏠a *K `0*K ;K0)KwK) 0K0K0 0K0K0K0K0 0K0K0 00K@p/0/ 0-0Lc \@SS0Č 0AQ0$r0" pp0 -LM<0 1pQ V0`000 @0P4` Pl  0 0 Q* R R 0 P00I R `S5 ;P,l  8 0 P:4RZUPP<RT  RS0`D0 @ P @ D0 !0S14 4 0 `8@4 TX004 ӟ(KcSc -LM@ 0K00xP 0S T00K -LM@ 0K00_P 0S00K -LM@ 0K00IP 0S T  K 0-@0L8TK0h80 8,0"00-L@P =0S0%0`00l0 R R 0S ``0Q 08 0r` 0=0S K0h} -L`PK@P 04 8 <0L0 004 8 <00000000KcSc -L$MPp0 !(0 }p@+ 0`$PK0%0` 2p1`0 2p  8K070K;W3K 0t0S040  8K2p ( 0R Yb KX{. -LMPR@p1!# 0 0Ȍ,0Q .0` R 0R00 %P 000(1!$$嵙0 00p0 00p0 00030 0 0P0 0:0 00P00;0 00P0060 00P00Kh -L(MP0 `pK 0S 0 (0'Q@P# 0T 00000 0 0T0 0 @KR@0K@ K0 @KDB   K (t -LM@yp`W  1PuuPx0S y $y0pPp T!(  (y0Sy (KXW@ 0T(hT` #0!050( 0)K0(00 K% r`2I -L@^ P T"0 ``0@c^"0000S @T0, 0 8,0 00-L@ $IP (0 0  00(x p-LM 0K080`P PU P ⼾@P  K00Kp -LMMphR`0D1 0T@00 ͡P@Q  P! HL H 呾PPHL1O n0, 0j  P 4 A`PP;\P600 0MKK40MK0 0 A)p051K,0 @S Z 51["@0K0!,0 7U4A0 #A00 08/Z D1`041 `U4A0 8/A0 l`8/@10 0R(KoI@10 0R ,`(KX{.}@# -@pPLQ D`,P,P1,EV*0S , Q 0, \C `,PPU`,@ , CP舙  -SLMp`@080 P0W$P8 TC* Zģ0⨁@8 @R*"003#V70S @ `F@X 0  00 0K0es0@0p =C\ 7C @``0 0@0, +C0``Wg(Ks -QLM3PApQ Q +0 P(`U@P% 0  0%ab`(0 E@P d( (@i0<  BPUPHB00$K -LM 80SsQS00K0 0XP 0S01K[- K -L4M0SP@ x@@ `0D0 0@0 _0 @0o0W <0K0D y0,pP4<0K0D 0!pP3@f@P< 0W80 4p  0 8Kr j 4 p8 0 00S  S S 408Ks0|04K$0K@0000@H0@0H0 L0S Z00@0T0 @V<0K0D !0P <@  ZG 08 0 00S pP@008S  S S000 040 P41S 2S01 00v4 408Ks0|044K$10K@.000@0pp@0PpppR<0K0D 0sPI <8p 4p ZC`P 8K0  4K$0K@000@0``P0 <0S0L0 0elpq0L 0R'* "0d000 040 @H@t] @0h,0#0` 0x0P  $j F# F(K袑! -LM@` `X 4P\\2 0 ,K%ba`2pQbKS`kVP PUPPl0S Q2[P,0S Q2[Pp0ȅ`1W'*0X"!P !Xȁ`dƜ R S ,Q/K \"P D2@ 0 0cPp,`X2`fd6X*0X"p!P w/K \"P D2 04`0 0=P,``2V@2  `VA >P$0 K00 \2KpL > $0 KδL#0K@?K# K´00 \2Kp LH s>#0 K⯴L2P i>x#0 K⥴l0S Q2[ 0,0Dl0K?K4# K⓴,0S Q2[ @0 #0,0K?K" K⁴`,0p0v 1V*``,08`v0v 8d6V*``,0p0v V*``,`,0Fd2 1YM*,0X"!P !BXȁ`dƜ R S ,Q5/K \"pP. D2p 01 0d2 0@0r@2,0@ }SD2S< << P D2p0C 0D2 1p  0@S@2@ ,`pX2`fd6W*0X"!P !/K \"P D2@ 0 0 @,@2@ p,`@`2c@00 0R O\(KX{.E!P\A@k 0-@LTP0hq 0 *h0h0l00l0pq 0 pk+0p0 0%0 -LM`@p 0尀SP$H` #000 0 0 `00`00 ,#K0 ` $6=8 0$r0004 #K0,0 $#= c0003H0\@0S3H000s8040$= OLS `00080 zSG{k{'{z *S:G{k{'{*z8H40S zkg{{'{ z 8 S zkg{{'{* z1t0S $0P x0<00 $<00 #0 lH(KoH0S0S x   0R<0S 0S210S11H000s8040 14 0P0318 0P0+10 0P0#804 x00@0S,0y <i/,I*p` (*U*x p0s 0S  0R 1sZpp(Ko0| (Ko(K??wC[P0 #0(00-L@ K0hP 0 -@LH PR`  : P P.HHKh*R   PKh, -@LTPp \0 Kh08, 0,0 \ 0y0+D0S0S <0S $;  _ #` 0l `e ``a000` 0`HpV0`8  `$` 5 -LWM5@0h 00 0`p1 0Rt1 D0Sh, 40 5 R h P 0$p1`0{Lp1%   0AR@ 0pWK%p1% R0 G PT  0U1SeX6\D0QTQ Suh, 40 4`V hR 0chZ[{k A{7{p1 `0-0l1 pQpP ] PEp hR_l1h` F 40KEfP+ t0S h! BRh!R ( Q  R "Qx 0 000(0S0 S= )  F0"0 0Sh1SS00h1SS SK )> C P0D0 aQD  R0 20D1 0 "QP00ȁpM`M F 40l18Ko*!EL! 5  h![ 8!R i Rx1 = 8  ⒕8!x1  $ RY DPUhQ QetQ xR iR2  $  < P6 bR6  <  h!R.< R iR6   <   ueAOU5wɚ;rcScʚ;79 %OU*9>X{.hQT h!R iZ800000 S00h!R h!R/  l!  iR PF  iRq2    F   iRbt   I Ih!h QRIu iRx1 P9  E pdY/K x1 7#R  iR<M 7#x1 l1P Ẕx17 "R  iR&<  "P x1 妔x1 9%R  iR^ 9%x1 l1P ᐔx19 h!R R iR3   ,0K # l!KKtl1pX2S P 0 iSQ0W0 02 0000W00 00 "9 f 0i R` 0   <84S 0 iS+ l 8$0A 8*8 6S0 0iS|0000x`,0K #l1|V Px6V* 0bQ0P00S {0  000 0` 0iSg `7000p , Q*(,lQQP  hP,:@P SE ,0C, pl!X`&, dP$*Q*,R ^(,l  hQ,:AQ S ,0C,   b B  0 `hK/VÔ`v  Z pp10X(勼 oPPa  0W 000;1C00 pP6 0,KL0($t@t`0S0ppp`tpW 0t 00`pt0S  0 t0 p00x?$0PVUT 0S3P/ @p P)X' U P D (0,Q  " Q X $0Ȍ 50 044P00 0RC Jx0L< lKX  ^, x 5 LlK< D  J#pP |0D0|0w0 $t0 r0 @t0 mRt`f0P00pp(KX{.V}b -P@ L p`h01S d0S `0S \0S  TjP 0 @T 0Q0 PSP 0SU t0T0x0t0@OU 0t-P p8Ll P@  0S / -@LT`PP(尳0@ @@@蚚 -L MPpP嘳_08, 00 P  0@4 8 < R S  ]@P`4㱧@P `` 048 P *0 $( 0B-048 * 0 p ?p 0S <D9ᣫV0000@@(K訚 -@LTP0S08,:* S R x0S 8`$HKhKhS$`  P (0Q,0Q 峲 ,0( CP1  0x t `P Kh0t0S  $0R 0x0t`gtF0SHKhO0S .O0S/0S   / -LMpR0 `P 4 l Rߌ0 P PԌ00y  cW@ WE oP4㲦@P(Kop      @@  04 8 < S 048 )0 $( 0 /,00X0000P(  $(, R R0  04 8 <0Cs<4  W(Kov(K赚 -LM0PS@  T 0p `l00 0@0 @0 @@(K P0-L0@T0P 0 S   096K0h2 -MLMTQ@0L 0 P`D0S !宱1?S @P@01墱.Q@p⑯$ $U^,PP p ;B.K功 6,pZpW PL LLzU Z,q01 0R GKX{.jĚOUI M 0Ѝ⾵ -MLM8 0xR8 0 8 0 8 x2( 000 08 0C0PPB 0少@0Q@@Y@@ T~700r >K08 0 Y8 00e8 .K08 B 0j08 ; K$[  ܃Y1 088уK @LK K @ӱKK A @ֱ 8 廃8 @@S *8}#=K0C 00& 08 0p 8p`j#=K0C S#=KR0C #` 3WV  R 80 S 000 0R G8(000(KX{.Ԛ -L M@0KcK -LM `P@p!@ R000WQ P#&!, P?@ R0崭KhC \00-@ L@@P\  ` dQU 0U0H 00S \   H HR 0K0h"A` 0-QLU@ tP0 P1 100 -L,M`@1pSP 0$K0 0) ! # l  I  =  P(00=p K Q0-LP@E000 0!SP0/010Ě -LM0aPR0@p 0  0S 002 0S \0  0l00 S* $ 0 @@P Wx0 00K0K$\0,|0\0|0A  @`H 0R E凯KX{.̱ -`p@LT 0S@ RPU  P 00000P -p@LT7 0 S|`1V 0S  mP 00000`l0S PP x0\0L$ @0`000X0P0P0@ܱ@-Q  \00PC 0SS P  ^ P p -LM#K0As0S0Hs0S50;Q7#K000 #K 0@4P 0CK@0`p ($(P@0C $$,P@0C "$.P@0C !$/@P0CT 0C lR"004K0. X@P @X ?\@PK S@PK hSK  K@ hS@PCK 0#K KcK`pK 0  0(K Q0-L@P\HH@o0 P0 HcPU \0000 -LP`p @#?o o2R00STP 0@@0P1! 0-@Lp 0 0b 00yK0hu -P` L ܭ0pG01S C0S ?0S ;0S t0Hp`@T  HbP0 S   0@Kh  0-L@D P"00 -@LT`P @T VH0SI00S HLbPU X0 -xSLM@P 08lpc0 0K#0 0Tp @Rȇ0   P 000RP00T0 0K -LM\P@@pH P@P\P#0$` ` P@0S0 vx- W<K000 X0\009\0H0S0I R STY 4SH0S3/# 00KI00SX0Y 0 S   00 3/ ᙡ# 00 .V0 S   0    V(Ko04   F@p0 $08(00000@@(K -PLU`p<P@T 0S 0S @P,٨ 0` p@0 A -L$M|$0P00  0S P08, Dq 0#0(0S=@0D )` J]Ph  D]PaV0}pWpPw  @K⋂2@ @0 @K0@Pj 0D0 0`8,0#0$` ` H D0K 0 0>pD0`03Рr0H000(0S=0S)0P0*0Q0+0S`R00T0,0U0-0V0.0W0 S )0P00T0ꬠ댂V00KP00#P0 ᡠ끂0``V$  H \PX0 08,0#0D00D0 ᄠd100`"` xX00E .0` 0`0@@7 cP 0`0 0R ?>(KX{.[c -LDMPBP`K0@K00 0` pH00d@ ! !0S@(  j\PP  P0 00$0x  Z\P00]8 X X0,0H T 0H0 4 T00D 0D0 0l0X 0S 0S H h0 3\Ph0@Tρ00:1  0@X0080`0(S80 0c$0P$$0 0S 0 $0S S00ḟ0000@@d00 0R =(KX{.!-N -LM@` <$K$KCP $K Kk 0-LM\0@  00S0\ $K $K PP00(U 8K0~ -LMP0Ā00@ 080 T[ \p T $`VQ  8[PKZ80`80`cVCGp\p\00\0$0S &#$`p cKb- ?!P#KR08 b$$0$0 #`p cKb ?cKV0 08` 0f880 $0SY00@ @(K 0-P0L@T \ 00 S@00S/0S Q\    \ / -LM0PS@  T \0p 0`00 l[ 00H@ 0@0 @(K -LM`@l0PU 0SpP\ 00S  =P00pW$0K@Pc p lyp lsp 0 $K -LM`1P0@00 0 0 t0K0  s K l K (k K ]K XKp  \p  K0 0 0KK┐ 吀 ` 0 嘠 ȀX. D0S+)0T0 .0P0 $0xp HKKX0 ` p t`Kk0 KX p垥00S0 w|\0 0@0Ң0000 0R ;(KX{.HR -@`0LP 0 0٢V 0 S   0 |LÝKh违0/ -P`|@LT \0 R@ HP\0@0\0\0@x `@\08, 00@@T Vh00Kh豙^h l00-SL@00 S0 Pޤ0S0 0000EK0hh 0-LP\ @^@@^%@%*&000$1(Q @T 0,0\ 0 -L00'3 l0S ~P0X LWP8KK?C L;0P00(KK/B0 0FPK. At0 | 00(KK/B0P0SBPL| 嫢ZJ G suZP\9X9K A p D 3/X0(KO/B0f l *Q  0h00?s0l0S00S 8K>C mP !8pP0p0P 0t l0S000|0S\  \ 0K(KKA0HM/B0(8Q0( 8KN?C 8KM?C0S 8KM?C0S K1A 0A8KKM?CA0S15:03s0 8KJ?C0$8KJ?C0(0S \0,8KQ>C 0$ hRW R` RbP `K,NtN@0(KQ/B00(K.B08KQ?C0S8KN?C03/ANd0N0^S S0^0S@u8KR?Cp8KS?C8KR?C0S|`V (KQ/B0 SK A VVP' `R5 Px媡0SPą8K=C0(K8KM?C-B 00b(KM/B0>8KJ?C0$!8KJ?C0(, P 01=001 8K>C0 `Z  Z1` V 0@ 0@0R*0`00@@h幭h嶭Y``100@1@0#0(0 |8KO?Cz`P0 厞0 刞08, 70 h0 8KK?C0S @8KK?C0 S kp S 嶠#0(0 刞!-8K>C0@ 0圂08, 50(KQ/BK0 A `P0 8K 0C0(KQ/B00280(X000`8KQ?C0`S  HP oᨂ8K>C0\00\08KS?C0 08KR?C0$0\0  P X P\080\0X0$0S 8PpZ (K0.B0 p x@(KO/BX0000 0R 6(KX{.?]Λh ;\6  /F_[ Dls -@p`,$QL,P(1,EV*0S , Q 0, Tc `,PPU`,@ ,T P  -H0LS@0Hpl0`V 0S D RPU  HTP 04!I 0S X00TS@P`T0`0=0S0000ߕPP$Kk蹟w00 0 0=P00H0=0S 00=0)00010= lr00P0 $KkRޛ -LXMr@0`(0 \0@ @\ k 0`P0 0 Lh08,0#0[ 0SsT  >p y01S y0S S $0KL #H0 0 pEZp0X K0\0H00\0.00P`0  . P!  0D&Kҝ&K4Qd  0P1e6 Qd @0l Kl h ɛ'Y% 01PU 0V P |0S \XQ S 000 `崞P ( 0R 95$KX{.AEʚ;ɚ;0U\ -LM0p1`S2 4PK⡀01@T 0WVX00l`0| \ $ X: 0V*8Y$ `|@V $K 1-SLP`@@T   1SPKhl 0-1LS`pP0V PU|@T  P@  1-SL`pP  P@TPU |@ -@LT`' P妖@㣖0@1P 0pV @l0 R 0S  q e01010S  P| R \XQ //01S 0S  P R//01S 0S  P Rh  // -@LtM3 0`|K00 01PU 0Z0S " PK 0" PKV 0"PK8X0"PKc|0l"PK]V@PLpHp/p, 00$0咇 (W* p p, 08h0咇 08l6W* p  0 !hl 0pcX5 00 8[cX0 *w00( P  ,R $( R P ,^   [V      0P KT@|pW \ 00S V 0t hK`0h KPKঊ@pPM00 0R c3(KX{.#˟LV 0-0L1`SPp@  0R0 |\@T -@L1S0 L0`10P  PT `P0S08,:* S RKh薻h -LMpQ`0@00 t0K 0 v s K l K (k K] K   XK  \ v Kv0 0 0K0 0K0 p 唠 吐 v x P  = ~:0tpK S60S3 . )$  K\ 0 p0 K pO0 S `00@ 0写@1Q0 0R 2(KX{.w -@L4M PU >PPl1s<: 3Rp` 0,pK$0'0 )p! 0% )P p p LKu=p<0  L0K:p L0K$ )L p{a0 `?00=0S00 00P z00=0S 0)0=0 00010@= n0S ? 000(K[ p-LMP0  08, 30d+ 0"K2"K@$  0T1CeH6LQ, ( `Kf$@ @J[{k A{7 +S8/P,0 Kp eAʚ;ɚ; y 0 R Q0/(0/p/ 0-LM@PU Uu00 PE [UK:[\S@P`ru0K0 -LMT` Uau0 [0PcPUu"00[00,0S ^0,TK -LMP|XxF0Tp`(0 0@|S!0 @ JK{p  @T: ՚6 @W1 :nKt0o0xPe$0K#0xQ|v &pY*WWF V  nm 0R rHF0VJK0 am( 0R 0$KX{.X 0-@L0s0S \ $)\ 00x -L,M`q0`00 P1RHA @ T0K4/P[o? 5[S `7 %K[P[oPK- S@ U01X  0 PK+P K CrP2 l0 0[O0Sh0 \PX00 P3/ ሒP0 0R j0(KX{.H}(  -L|M0 0R0 5000 Ht0090`0 0S \\0 Bx p |0 t0 p0Sx0h [p0pSK:p 0R* t0 0ڙx0p 00 0x0 00`0[p0 rPPK P P@ @Ts0 0@幙`K 0pd  Cw00 8[p6K0\60 0 W X R 0 9NP0 pW0#0!0 T K 0`K}  t=U0X0 \0  \ 0\ XPSX T K 0dKd0 0X0 0\0Ot0p@ 0 p0|0 h [Y \0St S # 3Q R0kPj0K PX &[0@dR0 pd{s0 0<5H0HK 0S808 4S4 @_s00408   * HKP@TH\00\0\090\008 480R\   \ S$0 S05 0S S0@X  ˘Y X R ?o2R03S t00t0| ?oR20Stp00 0R /0 HK @`0岙0`0(0000@@(KX{.Bb4 -LMR`p @0 Pp* 00000T04KO4@K@0 gP0S T upQ t R,0, ,,Cf@0N$K  \0-@ L@@P\  ` t5UP`00S0 \ H R 0S (hŒKh%AC -L M`7P$ V0PO0Xp@V tP $ Kb   j0@V [S m00RpԀKl,0Sp?Y@@@eA#Ĝɚ;6eĞ@Bʚ;#Ԝ>NX{. KPK`Q  X0-Kh000 ԍK)X0x @Hd!9#0 R p<0K c00K |KGP K@mh0K0 (00 )0d0 .0`0 $0`XK` Kh0 l` `0 p 0S p` +0 Kp , 0 S,  8R0#03PppW P0 嵏H`V P0 婏  (2@ 0R ;)8K(K -P pL孒0@`0(0 0#%,`$8`0 /p)p`t`p  Kh豒KhnOU̟ 0-LMP@p0S 08,0 0 p0 00, (08 0pHH K0hy000@ 0峏K0OUVԠSP 0-@LTP000CS00p 徏0 00,0(080\p$$ K0h8K0hQ OU -P0L 嗏@ `0Sxp000 ,080(00#/0$*p ((KhKh"OU -L0Mha0P #(0 3p@? 0$pK$0'0 0$0p4  DKk0C0K0U4KDK D KH0X 0S00,0  DKp 0H0 0$ 0)0xp U @0X H嫑t E( 0R '$KX{."/ -LM0@PP \ eeQ   6/ 0h! S 000C Sxl|h1SD5h1h1 S45th1p<0KeP 3[S 500P%*?000000Kh1S4h1h1S4h1h1S4h1h1S4h1h1S4h10Sp  W \00  Q` HpX ,pp0S0s:kg{{'{$z0S 0s :kg{{'{%z3h1 000s08, 40 00s 0S00 0S00 R02  x p0x0t0|0h0p0l0t00h0l0#0(0 h0 CXS S00 00Bs \10(0㴍 0Bs10P0娍 rx1P0X \1P00喍pWU \0  0 S ` $S` \   0$ 0嘍 0S 0  p ??  Q&-5=Fh[؟p<'0 pS < R0Q 00d6/ Sx6/ 6/v$X@` 厏i/Lp`t p+Y`@T* \0  R @@ HP\0@0\0\0@Te#    0(0 ,hg!(K 0-PLp0@S0 (  S00CS 0 0 00S0S0K0h 0-@ LdK0hN 0-@ LXK0hp 0-@ LLK0h -L$MP@U`p `0S x0 S 0SS TP0 &P $׎C0,80 0,<0 ,0I@0 < 01R1*, 801 :01 0r P@ 0 , 801:01 0r P 0@ P Ύ <0,0<0 uZ Z Z:00CS񟗕ȯ0 Er0 00p}8090@w 0 Pp 0 00p0SS00]0S\20KR P 3[S0 0,2< @R0 %6 0% k20KS sP 3[S0 0 P2< @R0 %8 0% W0 00pr0 H8086h 0 =aY0 Ml0W h吆^PhxM h`lp0SA0S0 < R \0Q S  ܍ 0` Ս#0(0 0 ^ 0 , ( 8 H p xx֍j 5(K(QDQwMFc(ZOU -MLM,3(0HK00 8,@D\DpP  `D0`g0KA 0Dg8K0C0(K00D0002W BK0 xD A℠唀倐<pd}4D.0 %Z 8}WpK AJpP 0D nP )Th0RdB0P  \P   X0T S l0@TM 0S `0S 0 @Q `0T PT P T0R l0 TPT0TU P `P ^^ P P  Ȍp 0  Q ` P Ⳍ8K0C00 0R <#(KX{.mv/#0 0-@LPP0 kU0K0h -LM@PpW0},2`vv``  r1p` Kpp?o0$K0)p 0Wtp0 .t0SD0#0!0RXPL R00 QP K K,K R0( R0(0t pp 0s. R+ `'KpmKlK`Vp-KR0 08, 40 p kp孄0p0t00#0!00S 0$K%2 -LM`@ 1Ps#0(0 p  0#G9 * P!Q R  " !)`X"R   ,, R  $Kk3 `0p0`00 (\V)*XVV%0S R  R R R R S  ;P 00090000`P0Q Xƒ,\0Ѓ >0#0: ,07 pe0S. z)P' 0 (   P, 8 Ap l`$Kk[T00@ 0啈$Kkq$Kx4OUSX -@0 L P⦈?08, 40 `uK\08,0!0 )P Kh7KhuX -@p`,,QL,P01,EV*0S , Q 0, T; `,PPU`,@ ,,Pu00S \ H R 0// 0-SLP`@ HP@T -`pl0LPU 0S@P -P@T/ -PLP QJ  x0S?<08, 705 0B RS/Q08, 70 P" .0%%0 00`la` 01 @P , $Hй0S/[/0S SN  0-SLP 8lcP 0 ょ@Tb Q003 Y8 0f Q  R1 D0Q0C?o20Q00S$ Q000,0(080H0p88 $Kk݉x0S $Kk x6t p0| SYx0p t zj W V Xx `h00@l0S0 S R0U q 40 1ǝOU f 00-SL@0 ^ K0hTX 0-@0L8 0S@0T i@0й P-L@PX0 0S#0(0 08l`w0 0sEQ 0 $Kk -LK 0C 0B~KD4 pG0 S XV p0: D p@X:SV@`\S S S`:S``084 R:pe{@e}Pp<4S 084  PV 0 S@ {0#SS "P@2P~ 0H4 C>KX4 = Pu 0 `R0 :R `0@D4 c0L$0 BK 0X @pP,40 w<4S T wW w:00`0H4 Ht  @$ Q :Q@$ @$0cc00S:S:0084j0dZ84pe pD4{0e84 C}P@e`e84~<4S ,(P 08$ @D4 `D4 fpkL @DgL,~ @GH <4S eT$0A084T *}PP~` 00P4PH4 ~`` pI(K0-%o 0-LM  0K K 0-,@L P b/0 000- -MLM0R48 0pS 0S`B0x PKA TG0P@ 4( B4(R%000"S Q3 Pu@@@t@T/0 @@ T e ! "# :P #P R R 0Q\S0 Q\R  4( RBK J 0C R :R0 0 \R KA F0P( P% @@@t@T. @@48 S>K 0C R :R|R   0 A0S@J 4( B(K0-?% 0-@PL5K0h@ -LP= b@P dy`Pd p: _ 00wTS@ 0pP^ 0:SS ^S 0S:S00fP@AX`@0G\S@D0S:S   0C\0@ 0 B T13 0 BR.ES% BS CS" #NS RS FSfS cS eS bSrS tS nS 0 0 0 0000fd{P `d{P`:}` -L`= pP2 dxPpG@d0_ 00"0SP   :RR Pdd_{P P@d0dSPA R{P@|@ 0-L@# P 00S 00XS@ 00Bs ^a0BSW0BA0BS70BQ<,00 00-8@L0P d00H-L -PaLMʯ8 q P@U00j P00CS0- Pp0 0 S,@K$LDX00XU(<0  v[P6X,2XP 0KP0  R@@X@@800SP4 R  4'?4,\P  @ T \P0 0P4R4 00(KH-! X00- LR@ R WPgP00H-p- 0-L@DP08G0H- 0-P@LPP0,P0H- 0-LP*P H0@QP 5P87SU00H-p- 0-@ LPS P@0 0 0-LPP H0 @RPP87SU00H-p- -L MPUp``@nP 0Y  B P 4 00 ZP004 T  PS T1`@t@(K////// 00-8@L0P 00-L -L MpP0 'PW 2  >P100CS0Q, Pp0 0 S0,@K0$0 \V``XW ZPTVHVP 0K⍷P000SX``Z``VVP 0KvP000S VP VP0 VP0 dVP LVP 4VP$z :4Pu(K-!d -L Md0 @R R BP ;0,0000CMPK--- -L MPt0 `Rp@ R 0/0P0S0` K- 0-L@P08D0- 0-P@LPP08+P0- -LM@PpP X`QP 0 POo84BSUP$K- -, LM0K0B0;P K- -LM@PpP X `RP 0POo84BSUP$K- -, LM0K0B0;P K-/%/%Q P00////////0S  R0// -pP@`L0 P @U*0Q 0R* /0/D% 0-PMLPPP@80T@@x[0 K0袑3x%PQ 0P///%00P05057%/%00P05057%/ጿ%/// 0-@LLH9P 5[,  )K0hKx%U --L M  K -- LM  K - L -- LM  K /// -LM  K -L -LM  K 0--L M  K ////// // // 00-0@4L0PS P0w^P 0. 0-LM80P @R U@KP K0. 0-@PL 0S +V@P/000 0 0/ /0 0 0 0 0///// 0P-L  P -9P P/ / -L,M PU0 `p\ a@d  YX00@U00S 0WV2* 7#hp 0 0  U`p'  d 0 0K+ P 0K! @0  00  (K 0H `0  (K@dꘙ\(\T  -LMQ@ \00 `VR` `r KЫ 0L0 x0f-00 KЫ`vpR `LV 0 r0`0O 0p-LM@`0K#PK-PK6PK  dsSi  W RKphPK Hw L A< < $ 5 0  )7RM` QPK '< QPK  p  X H 8qKp     PK QPK QKph8PK\t<0dH<0  -`Q0LM0R0p@00,PK0%4射080 40<0 40@0 40D0 uRP 0S nSl a0CSpVnmBkjihgfedce&`_^\8 UPY T000V000 zUPbY T070V070x iUP4Y T000V0008 XUP#Y,T000V000 GUP&Yd T080V0800oS| 4UP (K +UPYV000T000jP UPY7 0 UP   UP  UPaYM T080V080D< TPi @ TP D TPNY< T000V000*V080T080!V000T000V000T000V070T0700 (KV080T080V000T000l TP gT TP `$t8t -@L0SP< d ` \ X  t@ p@ l@ h@ 5$ K@ 03`K@0 tKmp- TpK  "p@ Hp@  dKZp@`+W pj"%Wp#WP HWP$KW00$K@ -L1MK1M @D M`Dh` d h, P" l< 2pP* .K B Bp! >BK4H08 A` h,@d R0 X< X<l,R X< "X< R @(K.KK|@D B A;@ BAT<SK p p<10X< 410\< ,Q00tPH,KKK` HP FP" 0S K|KGM0 QP<  p5 Kpp04@0si/u0p0 +!MA^K PEp @&U0#S<p@ U00UPU@Px0H%@8 -Lx -L@MHPKKTK%KP! @0`0#/DAb@\KACP_ KΠ@00#/Fab`1C@Tl_u'%KPKꫪ* -LM5P 0@`@pP+CN `c@S ] (S0`P@ (P )PB 0P$K0 `-`Coo+pCb0V` pppP00-  0 h `s'00 R0 Pppp @$@4P$K-`Coob`V0`  r0 $K 8`Kp %K00.SP W*80[S  p00000S@DQP0(0 7QP 1QP00'QP OP P6 rp#} KP Q X QP ~PrPpJ~PP Q(PPk rpQ PP p50[.S050KqpPpY PP pWO@0sS qp|Q PP p\qpPpQ PP p70[S08 [00 QP\Q PP Ps00 0 R .R 0Q APPJ^Q PP P:  ,  @, <  t    0-SL@ S P0SP1`0`foPFq `Ao P 0Eq1p P 02P'' -L@Md=KK\-0 @ @ @ @  pKp  @p@ l@ h@ d@ `@ \@ p ` `\  l0@ h0 @<帐 00 <00 <00 <00 <00 RCZD1 $!R  Rx, 0=S \0S'0S 0008̟h0l\  l0C$Q\ AUH Q P B:`p`p(K1H"Z'0 0NT0d\P1K B1RMh|DIA@_"~xx!)3!^`0$G 0%HL0AS!ES R00 00Sm Q 0$0h0h0 1C /AE`h0 \@  h Z \ (K Z `B!P Tod S<* h `\ (K 0!,0SIZ1 $Dɟ PH QgAH"Z#h0d S* \ g^ h `\ (K 00C0 !`l4pV h0\@$0SE"x$0S .""x|$\y<` 0!#0! 2x`i( ,0 0( ,0_0\P00^\ d h0 Rp' @g\h `0\ !K0 PN"EdR"&!E% #.!E& Er r! E%E#P0~ & % E#!E%!E# & E% #00 $0S@< !"x00 $'`rpg(0S  R $ R pe KV LlKd 0L#d 0zLd 0wL%\%0qL$0S"x E ! 0 E! 0 ! E# # #"E$!E$ E%h `pc 0lK2L<0cq# Kpd 0*LV 0#x!E$ E$h c 0 K ES R S RQ $hT 0$%hJ 0SG !B#E$"E$!Eh%9`H`LX\0AS"Eh$) 00 0%XK|K 'KxP D H`v. ` LP?% KP?# TX?$ ?$,K&000\PeEdV0^f$E%#E#"E$!E$ %(00(0 0$%LQj Eh$ 0000 ,00,0( ,0 0( ,0000$0S"x!E# E% r$00$0pb h0Sp\ h0 #l- 0& KdP0 (0- 0$0h0 0$z3ldXD@,jh'lEQ P\c bS R00 00PlKd 0Kd 0J$ 0p`f$$%?l` `l -LM`@ sO0,2 pO0V0 T 0gK2c ? }K wpP 0?K@P v. ?&ȟ?KK # 4 DDE | x t p P>tQ;p1S8ʄ!R5|1S2  B 1S& " R0#0FRCdR 0& O$Cp`?K@P0X42 802 rKH0, 4A`P(2 0 8 NW V000T0T @@S  0/K@(2`4"Wv^E01 2pB PEVQ q 1 A e N M0 QP> <$2 !0#82S 1U1W1"R1T1("R10"R0 YXx QQ",2P0>C 0C @2 0 'PQ@x0S Ng00K0J xPQ@0|1S 1S tN0 ," (K8^ ^01  rKK$ uP: 1!v> 001` 0Iv@ 0@(2  0 ISR0! " . 00Q1 8N 0$ 0 QP`p J 0%0 QP`p N0S`pN0S 㟆l Q(d0 Ϡl^0>v L`0c?o2M0  (KM#00M0S[x@xЀQ<"b!"b!XŸ[}.0X01 e1}K2 pP: > KgK g$2 M@a$2K0rK P3  0 VIls'T0@T,P5# 0  0 QP oK0M0S 0,5#~M0SꟆQ: 0-@L> L)p0}zwT00at T00 R PQ R  /  \L\00DP H0  " /0P/ /ᐢH00 P/A>  " /0P/ x0@-0@TP E>0 P0, P̡ -@LP`p @P@0% P PP0 0;ؠ0 0@긠 -L`! P+ pp᩽PPP`E^@ 0p0 @ᖽPjY@ X 2H  @8Y`d -`PLQp @Q P@f 0DB(000S   -LMpP`PP( TL K  0@0SIL0"S!1Ds0P000S0 5/K2L0"S `0PX000S K4 1Ds@lp  0-@L+j )jK0h%j -L MP`Up4  PP2SePC XP@G gPP P h1000 `p0Լ@P, 0nS8 p=P00PPQ Q P 40R 0 f A W Q 0000姼@P(K000S ii(K0oS@p000ii  -BMLM@p}Kl UP P/Uc ^C(K0<4 <GSe0P84 a @RB>K 0C<PCnK0@@ p 0M 0KK #  K  P K -L?M 0KK #  K  P K 0-0LM K"0KHP K<00 P0$00 00 /  ěl4 0-LPBU@ J?( $ 0P 5/0P 0-LPU@ J?( $ 0P 5/0t 0-LZ@P 00003/0蜚\ 0-L#@P 00003/0P 0-LPc?oU20S@ 0 0 03/0 -P@LeTUPQ`$ @04/|` 0-LPf?oU20S@ 0 0 03/0( -L@PAE`PxI,`0 Kh/Ę 0-LP@P 0 0 0 03/0d --LM0 0 噒p@ K 0 003/Kd 0-L⃒p@ 00003/0蠗 -@PL MԀ(0K 0`@pe<(0S I@(0`$ @6/ $K -@PL MԀ(0K 0`@pJ(0S H@(0`$ @6/ $Kt,P{vrnjfb^ZVRNJFB>:62.*&" x/p/h/`/X/P/H/@/8/0/(/ /////////////////////p\L8(p\H4  lD -LLMpPW00@@ S` S S H 0 (K>080 X`F  8 P V0FP P 0 W S R)W <D L  0 4 pH0 W pGwp@ Wp WW4 <R  V>00ŅP0X000 0(KXࠃ^& \D a0b L@@V> P ̅V 0p0 e 8 J00V P <P ̇Y< p40<^PL@DVD  ŅPL@ p@ W4X) 0Q&\D a0b L@V> P ̅V 0 40 e 8 40Y0 P <p 4 i0VpŅ Pp@ W,4 \0V pŅ P;080 -;080 )0X < T0 4 P0 \ &K 0H< 0` Y# :Ip,Q[; l1 L> XP ZT a0b 0X  P@@Q> 0P ʅQ00e 8 l\ 000QP <PʇXQ^ `pX0 D AH H` a7H L Kh XࠃPKD` plg pL0D 0@ dKKp`^fK6 ZT@ a0b 0X  P@Q> 0P ʅQ00e 8 \ 000QP <PʇXQXd\ @0`Q0` (h40<\PP@TT 0 PŅPP@ FY@ @\0`p@W/ X~ <0S{ZT0 cb P@00V> P ʅV 00 00e 8 00S PbV ppWP@X00` p00S=0P0E&K 008 gP0 0R hPX# 2Y1,X 4 <QZT a0b 0` P@`Q> 0P ʅQ00e 8 h\ V0Pp00S=00ŅPVpŅ Pt00` X <\ 4 =Y @Xp\00`(<P+ZT `b P@pV> P ʅV 00 00e 8 '00WPV ŅPp@Yp XVŅ P0<Xp 0` \ 4 740<PQP@TT 0 QŅPP@ 0`@\p@Y/ X3 <0S0ZT0 cb P@00V> P ʅV 00 00e 8 00SPV YP@0,0` X 4 VŅ P00` X <\ 4 0`'Xp 00` @X ,4 X1 <Q.ZT a0b 0X  PpQ> 0@ ʅQ00d 8 {X\\0P`0`0V j=@ P p0L0`0V F=@Pp\0><Q-ZT  a0b 0X  P@Q> 0P ʅQ00e 8 :X\ P0P00Q %#,4 PY00Q #,X 4 PL@0`p\0<\4 @ Xp00`,X4 6X \p0` < 00-LM@0@K0 p-`PL M@ 0  4/Kp -LMpRP@Z  S)`P)/@Pa` L1 0(0p 0(K0S 1 0 P0 pD0S 0(K輠 C0S 0 ` 0|0`0 P0 pC0SC 0 C 0 @ds -L M @@K -pL@ p` 0/S /ChP g0 SP 0 S G/ < -LJM@AKp @PP+ /hJK A`Ap $* RV   t P0e KP 0 KVCO0@0@OC0@0 -LJM@AKp @`P" /gPP 0rSJK AAp) 4: S U   `0f K0rS C@00K< 0 K CO0@0@ -LM 0KK #  K  XP K80Q 0 080/ -pRLP@` pT p-L M|0@SP`  |+3Kp( 00 ^P0|X --LM$0 0  KH --L M0 0 K -- LMH4P $0 0 K 0--LM@HP0 0 K 0Q0-0L 8p 8@ 8 080880088  00<I 8088008`X/ 0-@0@0L0S x00p0 X d PP P00>;,<00005P0 0-404 00L0 @;?P80@0800 0-L@.?P80@0800 -LM0    K -LM0    K -P?LmM0pQ`1 @ K?P?!K͌V :?P@?!QKK͌U )?P>!KʌjόT ?P>!GKʌjόY ?Pql>!Kʌ 0S >PM >!Kʌ0S >P)=!|KʌBόX >P=!TKʌl1\-X R@@  QH0D$͟H 0\ l ̟ \̟ \ D ̟ \̟ \ h PX̟ \  $Q̟ \ P˟| \  QT˟ \' | (\  P780A1 T0 Q0@t  1 01 d1p1 p&>`P] ,-x! P 1嘑A10qpP  ^X, 00000U ?e PVʆ`Q`0wsK<11 =P,`1 0`1  0 0P%]UQ @0E1 10Qx1 rPp0ἑ | 堑刡 QP  `V^V|1,0 x\?  tpQ PHB  D],00x=p1 ,00` 0 P?33`00wsp1Sx!,0P1Q`A , H0 ?3`!3R 0 PdD,,00xq=p(K輑|1S% 1SQ,0q0` , H0 ?3`3 U I0D,0 0xpG I=p 1PS1!0S1 01 0=t0 1 0P0@|1 '= P 0x! 1 =L0 1 0P0P1 =0P01 =P``!0e fR1 0!  T1 | 01!p1 儑 =ᴑ! 1 V" P,ppA0 0P  p|]W,p000000 U ?#e- PV @1!Rp!P p! 01 `TK P@ 0\|K P@ 0\ PK @  0PUK @  0YGK P  0@TgK `  0PUEQK p  0`V# 0[Kp1 @p 0pA\@!,0A10>|Q1Ux,0@0Ap , H0 ?3p!3U 0 @fD,00xP<phx?^ 0YK∡ | @|1|1 1X/ ! UXP!@?\ 4OKȁ  `@11 1V1 1 ,XP`Z0 @0刡 @ȁ !10b!1 S0x!1 R!x 011 1!q=1 p 0ม! 1 V( p1P,0A  P  \Xp1, 0   U ?e PV @1!R! ! 01 8? Q EKq ؑ p `P1V1  WP`0q Pؑ?# Q W0 Kⴁ Q ء P @` Tq xWP@\1 00RX |1S' |1,@=p1 0Q 1P0 @[T,@0000  0Y ?3i=0|1 S11 S) p1@=,Pp1 A00 1P0 PY[U,P0000  0Y?3=0s t1S @pGx1S+ P1,qx1=p1 0A 1P0P `*[V,0   0  0Un ?3e=0x1PS1P1S-1,`q1@=p1 `A00 1P0 `ZV,0 `  0  0U?3 =0\ t1S @I 111Z1p?30Q00|q 刡 pP@`KVP@  T     @ Pሡ|qcxp?30X00| pP@t`KmVP@  T     P p|qPp?30Q00L Kx |q 倡 pP`@FVP@u T@` Px倡|qwpp?30W0`K$VPS 0 0X00 0006 00R80000SV `@ ᴁQء -L[MpP[?K p @` x1 @3?pK͌l1pQ?Klq t1 2?C@K͌D1@DA GOK2?SPʌjό1PQ PK{`2?c`ʌjό0`` `Kn2?spʌ0pp pKa1?ʌ00夀 |KTx1 ?ʌBό|0 0| TKF $!0?3ʌT0 T P0t!xp(K Q?Kt1 j GOKv PK `K pK 0|K 0TK   p-LMLL `@P 0`0P Kp@ p-LMLL `@P 0`0P )KpT0T 0  D@Q 0Q(00?H/x, D0D @ 0 R ,  R$ 00?H/, -0!01 0L0S5 ^ 100?30D^H0P* pH0W`@@H^,010\ R   ^# 0`V?SPHP0(0000?30D,0 00T-H H0 H?3Q0 ((  Q0D,, -L M0\S` (K7Px@7P#T> p@00 RPp@P0U0 T0 TP W@@0 @ppx0pD0T P)X@U`0 ?3Q HQ@   0?33H0SpP @xp,0 00D 0-`SL@P` `7P\0 ?3Q DQ<   0H0t,0 00x@-H ?0 00S p@p0 0 S x0DS  R 0 S H,0 00 P0-LP S@o0S0@T0 00 / m -L$MB2@0P`00 V| t2*lh2`\‚0T80 ‚@24 8r 0< (Ÿ  2 H0 0"$0 @ TpXppD \p H0p`pphp pip0pjp0zP吂8 4嘂i<0 $T@hXD\j`4 0[4 [ 1 0 %0  00  W(Kp|px| 8p l4 d< \`0@ P 0D0 H0H0D0 400d4 8$ -prLMPPp TmT@P 0` PZ3$20Åbbbdbhb``c ````ccc#`eRPV c pQ p|L 0p RR `b0``` &P: ```0 &P/ p+ !p' ``0 &P  %N8La000S :3S d$K|$5V3V$Kh0S r+Pj4id 0-@ZL$|}<VV(0( 00 T  K0hV\ -L MPP1 `PB+0OS->0 |010_|o#*:!h`0U0(K(0( 0h0A  S/ -L Mp㤤4 Pk`@+(@0(,pTdv4P 3LmP8$84&`0,$     0 ! ! ! ! ! ! ! ! ! !* %LpAAA(8VH0ho8XXcLfAÂ,ßA  LŸ2`Ÿx(2P‚0"L2‚>CŸ1W?CA@‚h3:|@ R 0S 10 S \(KQ  10 =1o{Hh@  \ 0 @(P0U(`0(K><^v8#:0'#J #H#p--`_|opryz{@|h}yd\H!+&!%!ns##4%%$%#d"e"(hA-d0d 0p_@ ` 0\@(pW(PP -L$Mǟ 74 08  7J0<0 7r0L0 7`0D0 70 0H0 QXA  p Up PP~ p:0Q Q QX80SZ?0P@d  $`0R07 0004 0 $ ?>  0cS 44Z &6 0(Kp PP@ 40 P40/.000b $4$ @60P0/1PpQ&0 ;0 TQPaPaU 00  ;0 4p@ @0SF 4@ @ P?>PP0c4 4$R0L@%0 0(KS $5$%00#?c pb 0P@8  l 4 pV 0 h 40P0ϠΠ l ;04Pp{ P p 40 04 0 $ ?000a 44Ĕ ?>  0c0  SP4 j 30 cX80, S 3#00#?c p S0P@x8   p 0$4R"< Rj  P?>PPPcT S|10P@V 2 $`0Q0  20 +0PR40 00 ;04p44L 0/.000b44?>0c4 4/D0H 40 P$0$ A/o000`4"1!00#?c p 0P@- `000`00ĔTnQ  L,! 04 001!00#?c p] 0P@Y 00A  00! 0.#N@0s4 40 04 0 $ ?>  0c 44@ ̿_l_\_L_<_4^D]\ Q\[DZXAHX4X؇0$   00044 4/DW -LLM@ 80P$0S`p8 PT0:Ó\?Q A䃃300Su(Kp30h0 X `300S 802 X0`:2S P 1Y (KTPK@ \K 0\ X |g `TpK@ 0X \K\   p  `K p j1`PP00AP0S  B*98# `K`0@ 30S0:3S ``004 0*`00( <0#0,A8J0 00 0-LP@8p0K0h-$$ 0  ꬲ 0-L@/P p/P F.PN HQP0S3 R  |*P P000@mS S00S 1 CR @P- ;P00@ SP0; C/o@"@P00@S0@P mP00@ ;P SP0@P00008 -LM0 uSPpJ|P nL0m <`r0Kr  0C|"R0<0  00P$ 0%P cTx%P ZX RL4$D4<4  T|0$$4X S03P00S p0S 4S 4S 0t#2T1Wl"倁匑80 u )PoX .P3l2Y .Pl2<l280S 8.P[l2LQ?;~0Ul2W8p23Yt2 PX  .P2t280S  .Pt2?;~0t2W  .Pt278t22Xx2 PZY .PP2x280S .Px2?;~0x2W .Px278x2<0c(K1l280S LQU -8`0S0S   <)Pp0 D0|4|l0|h0|4|0|<5|20p|2$ 0!1x20t2|200S0X0K?T0L%R44S 4S-0?o2*0 rr  0B|"R0<0 H5S1S0괰8 {0 00X0 0$  T X| hp  ` lT pH t<  x|J88 4x8 80 0Q $0X 0/0X -L M\`pP@T 0S"!0S S0W0YT0(K 0  -L\JP 0, S0 2 } -LM@aP`2Q$K p ` QR  R  0 PP 10 01Q( (  pq,0 ( LP( ,0 ,0 ( IP( ,0   QpG\p@n $0,0 0ܨX}h| | -L@|+pP W`G`PH0 w0"00V"1@pG 0 g 2@  -`\LP@T 0S1 RT0S@M0@SʶMKhM -lLp`@T 0S"Q0S S0YpT 0S -LMP0 00jP@ @ K~BK0圀p@PPPI@W 0|" QU *P< 0'@  VW$K<DuD -LML0L 0  R  * K0  | KH \0 Q0-0L@D00S :T 0k00 -0 0`L0@S* :#RA# # PMKpP 0:#sS#0:# B0:#!BA##t -LMH0H 0   R  0*K  K|8 80 0Q $0T 0/0$ 0-LPᰨ|@p@00@ .0ST0P0:3S < <0 0 0 :#00ġ8 -LMأ#  3S0ȓ*`3B0<0 3P08 0 p40 P&W[ p p P@W 6p  ?#  0n  @00@0/"1 RC P\ \w \W00f S 8 20"0#?cp v0@@Z0  |t   /,< ?#  0n L/o @00"Vp P@0`00(K R` ! 0  R   (K4`0 0RG 00?#>x 0c!S 00000(KS0@@ `00@ ?#N  0dS @0  i8 00 0#?c;p 0@@~p 0}[(K`008P0P0 0w D@@@@ Q>p>X=r -R2P`@P0Lp 80$0SK $ Pd0:#RR#R  Bd#0QSj<2Y ,200So N80E  0-L@2p0K0h100 0 Й  ,0-10@A p`'}aWLP `F@pG0A0#}W@pGP JY 0RG p T1 * @   T 0:Vp#:Dx)p0 @?330V*0 0C0 00X 0-L@<2p0K0h00 0   0-L(M,0, 0 <@KPK0ԗ 0-L(M@P2p <@KK0-$$ 0  L 00-PL(M<@KK0 -LM 0 KKK K -L\p`P   & Pi@A@W UV T0 0 ᰠ -L MPU@0R%Pp+P)P%100 `pW! Pd)P ( '+ 0 0#(K( +W100  (K(K(  +0  @-p0  S ? P`1@A p`V 0@P00? 00Ԕ -LM@ ,@ @ 0K KK @  !K0 00 0-LP@1p0K0h-$$ 0  ꄓ000 00:3S /P -P0 J3lp0`pL2DqPp 0ppP;3΄`s79 0# 0 `#oi0hτ财F?ɂȒ2o 2Y-?p 0pprࢄ#2E0  0 0Ԓ 0-H@H0@PLp0 (0h 0i 0 0t 0-@0@PL:#Rpp - ^# 0pp09:0 d 0-@0@PL :Qhh Ó\0- pp#0  :Xd 0-@0@PL:#Rp Ó \ "R-- ( pp#0:0謏 0-L0L 0@L0:#R#R"#00: 0-`0` 0@L0:#R #R0#|""}#00:꘎ 0-0 0@L :QQ }| #ppAP0 :0  0-0 0@L:#R#R """"|#}# #ppP0U:0t 0-0 0PL @:QQ t|} ppÃ#P0% :`0̌ 0@0-TPSL@P p p  000:#00 0-0 0@L :QQ }| #pp0 :Q0蜋 0-P0P@L:#R Ó \0#R "R--  pp#n0:p0: 0-<@<0@0L0:3S  00 0 0-<@<0@0L0:3S ~ 00 0ĉ -0 0@L :Q"Q% P Bb“\`#@BBpl \`#pbƒRB#E :Ql -@0@PL :Q$Q' `P“"ƒ\Ó` "\ `\Ãb pPp#  :Q興d -@0@PL `:PP hVh“T ƒ pp# :P蘇d0 00Ȇ0 00꤆ p-LM@ZaQ`% 3 |0 ` 0 .| 00 .080 | 0< .03Kp` `0 0 00 S*03# 0 fAP 00\8 0 000:/@ - 0 00L0Q -P0P 00L:3S 0pp7Є -T0T 00L :3S 0- pph$0$ 000:#Ro/$0$ 000:#Rq/Ѓ000 000:#Ro#00 /ᜃ(0( 000:#Rq30/\0 000:/$ p-L M@0@`P0$ K0ppp 2[S|000 SC q R 3/Kp 0:#Kp"[R $$00 ht@"8 (-L( 00 " 0-H@LDM@  ,K0 (0 $0 0 0 , 0 0K! -T@LM@, K0, R0 0 K 0 0! -L M1A00@Se 10 0S^ 1, KP00ppp 2[S1\!\1 pP1`0X?  ],100X2  T030pp 03, pp+U" Kr[W  S0:d00W0p:0S0S\K!!ht@8000S/;@ 0-(@L@0S0_00000 0S/400 0S/F -LMA1@PQv :3SU0a3pp`0SU10 0S#1p0S@  0 BM'X1`00|PF @1@ ,00 R 8 2 ,0 0X,00   :3,pp0 K|0`00|Pd @008 ,00$ @x~\@`X p-@L$M0,PK<`K ,0 (@ $@ @ Kc8 ,0 (@ $@ @ AS<0< 000:3S  0Kp { 0 000:3S/{ -P0P 00L:3S 03ppd{ -<0< 00L 03, ppz -808 00L030ppz 0-@0@0PQ0L0 |P t0 +d000*0xP 00 +(000*S0Tz`X 0 000:Qy 0- 0 PP0L:B$ P P 0t\   +00T\ <  \dy`X0 000:xx0S,01/\,0/ 000 \///@-P U P bQ2 (`@ TppTp( `@ TppTQ S, (`@p@ @@ V`@ B R Q00 0 0@-PU,Q (@0 \0C 0S0U0 800-L@0@T0I 800,-( R 0S0 0-@L@T0 0-@LTP0@T HP K0h0 -L Mʀ4 ^2 P Ĝ, 0!K|B 04Kh* -Z3LSp`@3@S 4S3p@`S -L$M4@  H0 02D0 0@0T< 80 # `V! {`p0K 0 50 X:0 0`S 0 #pP(K`800S3 S S (K@f80T0  "d0VX4S@<b(K80V0 H D BfX0  l"0@f@0X@D2 PQ-pp!LM @0 8 < ;80<:D0 3Q4@0S1WF $1P0 00@ P00@U# 80@ P0K 0 0 P 0PS 0 p`(KP <08CD0$02@00*(K pp(KiP  P E/ -jLP R3S@P4Pi>30@SKha> 0-@L J 0s3$ PSP"0<P |2 $R 02S 0L3J |20"1#40030000P :3S// -,Q@PLP$ 0S  0T0 >,>0|00 T   T   T  P =4=T `TT *2S T020P T  =g<0< 0 P @0?30Q0@ 080/TfX0X 00 T@0|78@0Q Q0@0/fQ@0?30R@0080/ T0-:|bL0PT!@RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ &  (!R 1S !  08!R 1S X  R T@0|78@0Q0@0@!R@  @ 00 0 n@c0 00 dc T0-:|2Ha0`T1LSP@/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  X00S L00001S@078@0  ]b`00 0 a0 00 Xa 0-P80800L@ $ 0$a -@pP` L(o$GH -$$ 0  |` Q 0-P@L I 0T @0*|"7 8!@0R   R0@0/@/0 0000TP P R  R ! R! R! R (!R !R 8!R !R  R/L1S/_`0 0000TP$ P R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/^`T @0*|"7 8!@0R/  R0@0/ 0-L@ 00 0K0hp] 0-PL@ K0h -RL M@ 0P \ S aKh  Kh 00 0 \ -LP@`D#p Kh -L M@00 0  @ K\ -LM K -LM,, 00  K[ -L0 @Q`  ( R R D R XP   !T" R H  AR     j(K0HSa:]\H '( 000(K00C?00(KT0`X`00aX<H` 0X001 0  p`00 000 00   o P 0S00 , X10 \0 ``008 0  000000000 -LP@`p0 00Kh -LM,, 00  KM -LM KX0X0P  0 8Q Q @0<@0/6S,M`80800  0 1S@0<@0/L`L0L 00008!R !R @0<@0/6StL`,0, 00001S@0<@0/L`X0X 00 T0:|20(Q Q @0<@0/6SK0 000@/pKT0:|20(!R !R @0<@0/6S0 @ /D0D 0 P0  Q `RLP//J 80-P L@`P! Qp Lf` <000T {$00P|J0 00IQ 0S0aSLP //,0, 0000P//lI`,0, 0000P//0I` -L M#3 0@`V 300S`H0c`QL0\r0lQ0H00 00c \! Qq   !I YPE, 0000Z00,0I YPE00L0 S-q0 QP0?33X P0,D00`5,00x zp(KJ ZpG0 X 00C <0HXP P\00lQ000 L0aZd0pjQ00 00aZq Q   !,ZP ,0   ^ , Z 0P00Sq&QP PY, D0  0`徻,00x00 ?## p00SpP00S`0 0CPVP Z0җڕH,0P0/ 0D0Q /p@-PPp`@Tf (, ,0A00T00PPpP  R 0`//P  R 0 `///// /// -L M,0` !X A0@00 A40 僀VHp@?sppX$ P800D xfp 0?330 @X PD  Z0?#W Rws00C0  (KL Y0 @ 0 |C0 00B?oP 2 R0S P/$00!//8-(,^0R0S Q!R0bS -$1L0$M40 A1@0 0R80 ,20`Pࠟ00 @0S# #SG80000g``` P  (0R0 (0008000g00 80 4 T0003/p 0PS@  00 (K,A\8$` (0-SL`$pP4@PS@Q Qa +ppQ(0PS@ p (0p (0-SL`,@P (0PS@H0@-0\  @ 0 Q@ R0( -@`LVTPPB0Sn ` 0@0b(00p`P0@pp 0S`Pa%, 0S@W0 @?3300 S PDʹPxp f0pS RZ ,1P d,01P 0X$ p 00l (0P,0 0,0c10U 0p0D`0@41P p00P4 QF,14 T  p0 0Dm@YQ! 0 0PC 0$ 0PUR@@Y 0 PB  0S `Q ` R 0 -Q ^ c$0 S^0l  -d`PLp  R: 0@0T@C@00Q"X @ 0 P0UPC P 0 0SW P ph 1 $p00V= 0d@T@ 0ePUPT100V7 D100V2 4100V- $1@00T@  S2Q 0@0 P0 U0P 00R)W0Ѹ ePUP0 Pp 0 $pl l0 0@PX@T@WPUP 0d@T@0:8PQ@ 00 0 $ P / 00S0/@8 PQ-0QLP@`C1p0$ P: 1 0p7 0 0p/ u0`0 p$ 0$@ `*0@B0T` @T 80@Tp` 0Q78 PQ-LP P`p Á$0P @T00T  0W1x6P0@-+ 0S(  \#@ T8 @ƌ^t p8 P,00P@R 0@0T00 S00 Q-LP,T$@0S00â?# 0\@0 T`cpl 0Q0`V 0R 0pW  `g@0 0 0 M@U80Q@0@080/ - ` 0`cQL(`0P0,  Q,  l!`Sa ` p  @T @T0pS ` QP(`@-8@E? 080@   R\8 \0 0 R80  R^ 28 RQ-LM0 40 ` pAڀ,@P= |~,P,p fw,PP0m 0S4. 00 HT 4 ?  ` `W `P`$ H00@0x0L0<8 !X0\0`0d0h0l08 (K(K(K<,P49 8 6,P8= 00@0P0夂 0 ,Q4W 0pV PʟQ70 30100 ,0 *0(00#0!0 00 -LMP`pQcR   n@  S@3 ^0 X+ P&@@&@P H Q0DH 000D p$`@0P R0$K$K,/ -L MP ^@ 0 K -L MP ^@@ 0 K -LMP \r K -LMPAp@ rJ Q `OX0 [W`bP0 PP] |1D 00SH0100 PR $p(00#@0140 0, S0qV00 @ Dh0?33 V  400S(K000H040 0 0 `40X0 00 ţPW c `f0 `,``e`(K -,8 0-LMh0h 0@ `oL P0  0 @`PP 8K0+ -LM@44 00@ @ CK* QP-DLM00@$ 0*K(*8 / -LM@@D @ 0 p`N0c bK -LDMRb S` P0c00X hP0``P@` P cAP pY P@ h`\b@ XE01`d0 1\0 T0Kh X0 `0\ ,00@d0@h0` @25&*W   @ +0  L RT P0 LK 0 R0P XV @* 0S\00\0 ((K( -LLMpTd \ Pn8 Xp X R \ `  aRࠣ^ a\  d@  d RR\ d ^ @c8 ,8 8 8 8    r ` `q \s 2P0 d s0H P0 q0L0 r0p0 \0:D0 p0h0 0l0 HL |0T0 0X s0, ,1 00 0P@|01t@@0 0 0X0( 0S Q8lPh4P 0aSdPs0P0s0u40 a0S4Ph Q  ae0s0,X^x 0C0bs00P8 <0 <0PSN 880u@0 0s04 0@ t@H`@^u`  Dd '(  @  DQZ D0?330x p 8 @0`D!0?330x p(K00 00000  00 000( 00bQ000  P0( @00bT080 @0P0( 0@00bT00( 00@0@ 0000bP0 80 80  000 (0 R 00(0 R 00S( QS0 000L0T P0 `r 00Ps0\ `H  H  S(K8 @(0P0\ 00Ql0h40 p0@0( 000a0s08 @ 8 8@ 8 @Wm 8'PU$ ,` r  , j   ,hR@W> -LM  0P KG-$`( ?@/P@c p@Pi nTpj`c@\ pV nX (p$@0 G -QPLP 100 01S1`0@0 S )A@@@T@9p100S@@TKh81@`0@0 !$1 00L @08@0 0 00@0 0@00@@@T@0@ 0 00Tx0 0@00@0@ L0 0080 0@00@0 `~,X -@P`LpsTV1 0$Kk0- S\00#0 SR \S\ P 0 SRSR -LtM?p0L0 0*#R/P  \   \080@80@M @ ?0SL/?@0 0D8L00 R \@ 80 @0h 80R00  L0 P>\ 0Sl0 ;0,!0 s0S>00S l R00CQl0S'\0,L0 L000S.  h R0 \00S0  fL0 P \0S%,0P0 0 l0 =00 40K0 \0P@0,01l@Pp0 1d0 0,0` 1`00 R` 00P. 0<0 <@D哰 0x @ pY 0P?33Q00d ,0000ML0 <d,00T0 0PU0U|T0 00S@0 u<00QC@ Qd,TL`aP8 ` 01 @C,0DP 0H` h0 `P<@Xp 0?3U ,0 F00V5` p0W <0d ,0@0DPH`Xp0T*L0 0H0 P00L0D0 @0U%<(;,t h00 T00S0?3?SO 8PJ Xp 8@@pxP 0PS @W ` Xp`00S\000`0\ 0 S0(00Q`0000:3s Q  p00Pp0 0\\l00pPl P , PP0t L0 @0P !  LPs ) @ (@ <) R @    (P Q )  @ @  8P Q (  @ @TQ   P ( {@ +@    P L( l@ *@    P ( ]@ *@    P ' N@ )@    P ' ?@ )@    P \' 0@ +@   4P ' !@  @   P & @  @   P & @ @ @  P l& @ @ @   P 0& @  @   @P % @  @   P L!R % @ (@ <0P UP0AQ L0  R  "- BR Y  &R    @ `D8P T0  @0SD H0  S RB @ l Q?  TP $ y4$@  @    P 4$ f#@  @    P # S#@  @   X (X Rh0?#S<0 ,d0 ! BXP xP |@ hP8@` 0?3U @D 0Y* `V  <0, d0XPX Ž QnA Œ Č ȌADxx AH0x|@c\`X i:<0Qd*0S PD ^  18 380   p 080 O! #L0<0Q 8  <08  L00U 1P00U R 0C0@0Uw <0 U0 B  t<0L 0<0P0@P 0D0 |000<0 0h0 T0H `0a<0D 080 >P`~l4,X0 @_ 08 0~p@(KL@< 0, 0 0000cC1L  0H0 8@ Xp40 0 3KPZ00 L0 .DPH`Xp@<080L000S 0#=0CS@T @T<0L  A0P U 0Ct0 P0*<0L  A0P 0C0P00,20Q L0 \080 d\@0 , 0  L00p`(KP \0 ,\  RP8p ,0A0$ 0SP `pp pW  pW0`S P  xX8p0  80 @0 808-L00<L 0 0CP0 0[0@  t$@0 R(h$@0  D=<0 L0 @0U)`8 hP @P 0?33X 0 @L0 \00S00 6 3h@4% ! R  @0h50p0 0h0 0S@0 T0 D0ST<0VV0,0H0 R PU p0EqX @|G@D,0T|G0 E  X b |!"H000 0C d0P0 V0,0 000h0V0`,0h` 1T0 `0P 0S`0 0TP,@P0D0V 00Cp吐D0S @0d `b0V080 01 0P p0S 4Sw <P >@P 0P 80 0p 0PP 00PPL   p0 0 0 B0  P0P P0 0pr  80P0@Px0 0UX0 D l pPX0pWf @P@0  PP l)X0xKXHP > V 004S 4<o\QpP QH5S4q<oS@  0 8< z00t5@ 0P Pf <@ f00$R    80@@P lP PP  V 00P  8 < P6x4@0P0  VDH%RQ  8 P P4@0P0 H Vh0,0D0 0H0 080 0D0 nh H g<0o4S00S4t  0 8P 00u00P` p R] $RD P <{3@P v 08 P0 0pj 0P< 00P f\ Z 00p 0  P BO M 0< 6H0 V L ? 0`0$R < R  Q Rp P  RL5S0P@0PP 08}00P p   R P f X1@  0  < b00P f 1 80 <P V 0@` @  @00@0 00P V 0@  ` 00LP p0P 00SV 00@` @  @00@0 00LX p-LMP0P`@0 R   780  00  0 n0l/? 0 0 Kp80t p  4P0 00 0-LM @XdP\ `0Phl@\PPP K080 800  0 n0l/? 0K0 -pRLP` @P@T P ` 0-@PL0@T0 -L M$1$!00`0SH0?S 0 0, 0p!p@qT P2: D x/p! 0?330 @W P D զZ0?#R R00  S0  (K0 00p -PPLp! `@0P`U0@ TIP 00@P`UTP Pi @UP @` T P0-L0@S T0  -RLp0,S`P P @< T0`S P RQ 0"2 "#,"Q/  00C0/H ,0-00LS $ -L$M)弉 9@ 0`pp40 0P80  |0<0 ^P40S?40@cHY80P lR b @Rʌ S@@@Y@T (  @(<0 ^  ( Q ϠΠ   l(` Rf( Ra a P T ^T H8HX000 0Bl@p gPP R y ]pܕ<`XԔdP |\ ܑ̑8(,Ȏ܍č0\HDH -L MS3P|C0@p`00 W 0004pVT$$3p` 0@T$ C R  0@DS00T" 00lP  R " Z20 0 Q0hP hB@ I`P 00 00CSZ  PU 20  (KPh@   叻1` 00S&T ڐ1 @T lQ  PH   <lP @T,10 10 0p0 S!C lj @ i0 00S00h0S0 0 0 Z  @LL0U0S`00 A $܊8`dXẋ -L 0 T -L 0 G-1!0 | *⤂X``!0P U, U. 0S'`,ppG@\  \ 00^0 000P 0P  \0`SX@TP,`aA0U0 < 0 ^P TXP0 00 0Q 2S0l%R h%R //!R!RtP//` 0 000 0/` -LUPP 5p0q   Q`%2`s7 L%s0S 1<<5@0Q $0P\`  5 0P 4 $0 :l"@ 0@ l%R h%R 0h2 0d"2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20S0\ RʀfngΌS4 RoʀgΌ`S) RS% RS! RS RS R~S RϠ[-²S 0Y͌[=.0  0 S `0ʀS``p" 1̓=,,0  0\hŸh2 @`"0 #7`:@/`@pbV, $2$Bp@0P! 100P H0 0YH0删 X ,01 0 78 00Q ^`V <10 oZ̀`p`ʀkΌ`x`ʀjΌ`loʀi~jΌ`_`ʀiΌ`S!R 0h20l  00!R 0h2%R t5S 0h2`$$X@e d1P0-0LDP P?P08 Q8\6 00ʃhœ\ 1:p“ @T pƒ 0^pƒ 0A\ B\  0    $01P-0F 00` P@ʀ :h“0\0 @P)#0000CS 00000000000000000 0-@LMPP@$\U Y͌|#3 P |P 00  ,0 K0K0<`XXP- H\ P Y͌# x 0-4410L :h2S! @10@ 00S 0 0#'*?pB00 R 000@S0AS  D_$hz@z0 000:d/ 0-x@x0@0L0P:h2S SL0000P040 ( @000@000x`Xx -Q1P`!L@. R!Ap@0夈ʃh"R R=1:?QE0SA|20 $1 0刁Q$*|20t1:?Q 0S|20l 0 0刁Q:|20h |0 @780@0z0!Qʃq0!QʃX/\0\ 00000CS0p 0/ Sp R00CS0p 0/ Sp R0 000$X!??@- R Q,@     000 0  0-@LP0P   0 na@P0p@-10`P00s0S 0P@\@@1000C10.U @*T /T pRp@ 0@D0@*Tp8 -L$MrS80 `pPd 8K 80@ @TM  Fr D L H  5/8 8 @T: $T <R`!  "! ".P  R>< :P<  ,K !0 D80 kY00S P00H  R0SL0?@P 5/@TY @0S  0Fs0 S00S (KL0`0@0~@P 5/@T(K 0-LM@ RP !^ "R Q  (@0SK0 -LM00 0 KD( 0-LM@<<<0 0P0 @+K0 -LM@@@0 < 80 @@ 0@K(@-000\SM ^Sk "% @@ ,{ cS2<""0 "CL!! L0  }!C!!0C00 00 ' Cr R1" {  S @T# 00DS@110\S# '  00 000 0% @@ + { 0@00s0S 0 @1@R00C00 B a4Q! -LM0K F`0 !1!1H"b2c0c b ,0 /02b!1c K赁N g -LM0K Fd0 0 D0 0c b L L$00?1c2c KkL > -LM0K vF| <> `0b 4"a1cL a1c0c a )9(0# a` K-?Lh *S0%p - 0  -L$M8   'pP 8000 8 6 0  r RPS@ 㤖Ɵ n mΌ@`< @ ,Sx 0080 @808 0SS  Pr%S080 +JGQP(NMKJIFEDCBA@?>=;:97543210/.-,+*)('&%$#"! V     bT0 S\R 0S0\S 0 S000 X Ph0@ T $ <000 00 0 0f/>0 0000 00 0  00 (K8 0P "!.S *S8 0PB0 SR % 00dZ0 00@ 0 d @00@0 80`fv`@0 S@00 000 00@000 800  &0 SŸ0 kΌ  0 00@000 800  0 S}0<00K0 0 0000 @   80KH0 0 q0D H000 000 f00D 00@000 @80 0 SLR\ %00@0 c 00@{ 0 S<R00KE 8KD0 >% +c0D00 0@@000 00@0 00`f0  80v`%00iZ0 00@0 80`fv`0T \00@0 |pq 00(K0K+0K &00K!$8 4 l  p-L M@0@P`0S PS w0  00 K0"]Pt00 R  QT00D0<0x 0 Kp Kp`chc 0l0 >\@ t h0 0SO  R T0KS KZ| #Z =Z =P ` 0`0PPP\  YqV k0 0SS|p\/0P\0 \0S0, \0 cV@ cZ @H :`f PPP `Rd`P,0KPVP  Rp 0 0c ,=0@@0 c "V@P0\0(K0, K $0 TPK$P a倁`~P `~}  `PtT`K Ph0倁cP- `P`T`K0PO븀PP`IZ (Kl0倁;Pp0< t04 1\ \@ i< 0 $ $4̊  z 400 0S0-L@*,0QP P2,bP,0P0 Q0-PLP@P040, 4P0 -L00 -L M0p`@PP %P0 pP sP lP0@TTW 0 0 0P(K 01BQ 0@BUPD0000 00 -@LsMQ` Y P\ 00 40Re yOK$ 3 @}KH )T 0 zK 0\ T}K01 0g K1 Q %Q cP  Q, 40,(KP@%U .K!?Qi 0EXSWTC'zP gP@0lP \ X 1!0E]Sfdcba~^]zyZwXuVUTSRQPONMLKhgfGFcDCBA@?>=<;:98U#543210/--,+*)F'&%$! 78  ( QP \  01K^ -0 0BgxH:0000{ 00E$:Ph01K!ug a10As R0 ORTP (KI@`V P` 00040 P, 0000X. 0H, K!ऀ00 !U  ~UOS ,K!0⤀00 0PU 0E, K!R00 P Q Q %Q0 0?R ;RP; @a0As Rz0 OR`,K1 0,K1 0 b1S101 1SVx10x1 T0PU ,0K1XPEP0P  C OU,0K0 00 90 R ,0K1X BY0 + (X!P}PO 4 , 0 p 400400PU{ 0E, K!P00 a0As R, K1 Q0PUe  E,0K1P0 X LP 4 ,0 p 40P40X@ H,0K10 X_ H,0K 100 &PEVU!~}|{zyxwvut00OS  ,K!000 0'SS 0S'S'Sl`00S 0C, K! 00 RRQ_ QX %Q0 0?R ;RM PeR -`LM MB~KⰀ pG0$ 44 0P:SS @T:T@@a R  Y R ],0K 0$44 DLwP P`0:S (K -ML M@L2LŸ0`D 0p04 @P2 0/Sp P~P@ P 0 (K0P B^K! PE 4P 0 /@T | 0 d0P 0S/S ݧP N X P U |P Q# PBK @bp 0,@,j HTZ |00$00(K 0 0 50@<00$00ꘖP 0  ğ l @ -LpPSP` t-h@P@ @ Y @  P00剐0 0$Kky,  000@0  @0 DrQ @0 0BQ   p  0h UAX0@D0T@t@@ `{E D/R񏐲~xof`40000 : @p` 0:?T@ @@ @0@Sk p@tP ` fkPQP ,0KAc 0 00P000x 0 h' 0p h!H 0 h<, (Kh   0 s0 u 0p h  p`0  p`0    @P Jp@t p r@I PnP?P7 ,0K Ac$0bq 0 h+P"P 0h  000 f0 )h pP 00P n0 < (K rp r@% ,Ps`PP ,0K Ac,40ab40 ,040 4 80 04 80 0 hb F@hX X?P  p  (  | p-L4M0H`K2P/@P KpU0 00S  R2Kp - Q !P 1`pPL@7 0$0R 0 "0 P,Pp|0QP`  XQ  X| 0 ÅPPE00 pg0`P00 ` 0-pP@PLP  $,(00 T 000~`0 000/H~`$0$ 000P/ /$~`l%$P00//ᤉ 0-LMP% 0K 4 0@!1!1l"b2c b0c 00  2?@Bc1A@d0zPK0赁Ng, P0`0K?//ᰈ 0-LMP 0K T4 0 0 d0 b0c 02"D@ 2?AcB@d1dK=PK0kL8 >$0P00?// 0-LM@ 0K 4  ><` 0b 4"a 1c a1ca 0c?-B0 B PP 2H?Sc<0Pe0?PK0-?L$ *S܆ 0-L-@} l@l @00@0s H PJI $KK0HH $KK0hz 0--L(MlH0@  @@S<qZCeNR,E{tN%I2 ;$ pK&dU0cLpK|1b9~mM{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210d0$cP D0 $ 4@ P0SY"4"KDKP0S !00 $KK00P$cP D0 D$ 04@ P0SN"4"KDKP0S40 0z!00 0#cP D0 # 3@ 00sS 0#cP D0 # \3@ P0S"h3"KDKdP0S,3D0 0QE!00 0#cP D0 # 2@ 00S"2"KDK@P% 0"cP D0 " Kh2@ P0S~ DK*P0S D2@@@=\0 "00 d00"cP D0 $" K1@ P0S. DKPy0S 1@@@=0 "00 <0!cP D0 ! K(1@ P0S DKPG0S 1@@@=40 "00 0!cP D0  K0@ P0S DKP#0S d0@@@q=0 "00  ? zę H D  , $ d ` G$ ԗ З ̖ Ė  ̖ Ė | | t ܗ | < L H 0 cP D0  :{kSF{ { \4@ 00S DKePE 0l#cP D0 `# K4@ P0S DKOP0S 3@@@=0 8,"00 0"cP D0 " Kd3@ P0Sg DK'P0S 3@@@<p0 "00 a0D"cP D0 8" {kF{ { 2@ 00SF DKP H0!cP D0 ! dk{ { `2@ P0S5 DKPM0S20 0!00 $0d!cP D0 X! 1@ P0S"1"KDKPO0St10 0!00 0 cP D0  L1@ P0S{"41"KDKP 0S00 0!00    4 0  D < $ $ Ď 4 ,  `  Ѝ t l , ܋  H @  G 0 cP D0  40@ 00S%"L0"KDK>P  0 cP D0  0@ P0S"0"KDK(P0S080 0 !00 f0h!cP D0 t! 1@ P0S"d1"KDKPm0S10 0!00 B0!cP D0 ! 1@ P0S"1"KDKPg0S2@0 0!00 0p"cP D0 |" <2@ P0S"2"KDKP;0S20 0!00 0"cP D0 # 2@ P0S"3"KDKP0S43H0 0y!00 0x#cP D0 # \3@ P0Sy"3"KDKtP0S30 0aU!00 0#cP D0 $ K3@ 00S DKPP+ 0D$cP D0 P$ D4@ 00S"\4"KDK:P 0$cP D0 $ 4@ 00Sh"4"KDK$P p0$cP D0 $ 4@ 00S\" 5"KDKP Z0,%cP  D0 @% ؛ 3@ P0S DKP0S,3,0 0!00 50"cP D0 " ,3@ P0S^ 0"KDKPf0S20 0!00 0x"cP D0 l" 2@ P0SS 0"KDKP@0S 2$0 0!00 0!cP D0 ! K2@ 00S DKPR 0!cP D0 ! 1@ @0S"p1"KJDKrP4 0L!cP D0 @! >{ { H1@ P0Ss DK]P0S00 0J>!00 0 cP D0  {k k 0@ P0SJ DK9P0S40x0 0&!00 w  D | , $ G8 4  X X  T 0PD0  P  (00@0 00P0S  {kS k  DKP0S3D0 0!00 80#cP D0 # K@3@ 00S_DKP> "0"cP D0 " 2@ P0SA"2"KDKPW0S2p0 0!00 0@"cP D0 4" ~{k k X2@ P0S DKP0S,20 0}!00 0!cP D0 ! Z{k k 1@ P0S DKxP0S1h0 0eY!00 0PD0  ~P[ $10@0 <1P0S 0"KDKSP0S10 0@4!00 0 cP D0  0@ 00S { kF{ { DK,P x G H D X  Ȇ l h ,     | t p h d 08 cP D0 D  <0@ P0S"T0"KDKP0St00 0!00 20 cP D0  0@ P0S"0"KDKPY0S10 0!00 04!cP D0 @! { { 3@ P0S DKP0S30 0!00  HK!JS"00 {kS k 2v!00 {kS k l!00 {kS k b!00 {kF{S { 9V"00 {kS k L!00 LSKB!00  SK8"00 SK."00 SK/$!00 SK!00 wSK!00 m\SK"00 cD{kS k ;!00 YSK "00 OSK!00 ESKU!00 ;SK'!00 1hSK!00 '@SK "00 @ $} @} SK"00 @SK"00 hSKj"00 DKP                                1H  "K᠈P0SB!00  10@0 10@0 =A  PI : S@ )"00 $"00 "00 |"00 w"00 r"00 m "00 h"00 c"00 ^"00 Y"00 T|20@0 p20@0 k k !00 E"00 @!00 ;k k !00 4!00 /!00 *"00 %"00  "00 "00 "00 "00  "00 "00 !00 "00 !00 10 0!00 00 0{!00 !!H )@ 0"K&!H @ \0K !H @ ,0"K0-DT! @?| $| \{ y /+S0@- @AQ MZOQ.PPP 00 Q8S 0 +CA {7@ 7 Ѝ03Q Q+C  7 +C Ѝ0A@@1 1S PePH%VȠW8k+C{7F{7{ ?+Cy Dy /P 0S $0S 0S P /? @4@P/ -PL8p\`8 , R V *4f `V@1@! A`V40,00 S404`Q 0 0( 4"V, 0:b &,0400f 8,04`00@( 0 (3/P8 0-LP0Y R 0  S<@pTP  $ < @ P@ˁ004? -Ll0P ,00040 Kh -L@ZPQP@a`Db/T`@0DTSpp8Q (0T $0(3/8p `(@$Kk -`RL@3 8S1R  -P/ 0 S ($ R 3/PP p0P@8p0`P($03/pH  $ <  (0 0P4?0  0-L@PPQ0 Q @P ^ <@<0<@00 -LTM?/0T 0X0 000 0PH0  0S@0 ~ 0XD0 & /0PS-0  8 < "P S.`  &DP<`@@d \ L ?U0  # D0Up1p!W $Q P  0c R c    0D0Pg0gD0S0&D 0LP0 0 U p H$0pS Q D0S2D57YU0 0YPg0&D *&$Q$ B8Q AD 8 @6  @ 0LQ)  R=0 U 0PEd@Tl50c?o20q$0Q000 $r 45&$c0#22cR0S %5L  0h0 @$ RH Q% 0S!U` 0PEd@T 0Sm $5L  0G0LP0 M QT40UD 0PEd@T008< L `R00S 00 0 0S@0b/ i L00\y 0S0&$<,&<0,4 S x3#L000 8 < D0P# S U018Y p1p!W  @D0@ 0g g D0Pg8 @ 0D0U 0PEd@T:0zD+10 D0@a6a+`l0Q|" "- TU PEd@0Ql0@DaS ` d0 8 S0l00\X pPX0p0 t 0PP0 k ! 2L  00* U p H$0pS $Q (D0S2D57YU0  0YPgr0! 0@T6cc0PEd@T]U_0 R$ R40,00  L00 AtN s d{ E?>?A?6?7?8?9?R?N?L?w J?:?;?Bq s O?q C?f (o @L`( &b0R@D0(S(0)(8L  0t h p l / 0X0 0p \ Xp P  -0PP0 & p)L  0pSS 30) 9`0L @00&4 4K4`K30K. p0\ p dT0 \0h 0l0h 0PP0 # H*L  0ps`:\*L00 p:k@L`q:*L00 0-L@PP08Q $0(3/$0(3/000P -L`PpP@0 VR 408 c?400 `88U000p -LP`pP@ 0 S0 R  P00R  ( %0P pp 0p0>?R? 0-L@P0  $000 -LMD2D"0P`0(0 tPp^w 2 Rx @ < R0@ <(,K 0B S!<0 @ Q00cS R#2Q SQ0S0l0^P@ D S0aQ00 R0#02S Q0 SQ00 l0@Q@b0d0@0( 0R $K@0SlQލ<1 S??? -LP0 Q@oA? -pL@WPO 0\!(`3/PPI 8X  ( 0(3/P@ 00 @ Q@ 0    PS.Pp *S.0p X a0p08Po=PTS.0a a T P (08#($03/ -LfP 0:+ 0-L@YP0Q    00 -LIP<ʁ0+S(D S;D`C?L? -L-P0Sp0`@G-M@ $0 0`@SR 0P`00SUCP0tSPU @$0P 0 P0 Ѝ0@ 0QY 0 ^`@0tJVS 0U0P0S0@d\`0s0^0R 0@C0S 0S`bCRP P9S#0  < 4 h#8 @  $ (0 0C ,00 q`00R0 0 R`080 b 0ӗ 0 0<00 p080aa1 p Rp`0 0J3 0S C0 4R0Cs0S4BZz 0 00᳠0Zk,0 0Sf 0X0 @h 100Z4*\0lS 0nS@^0:(04(000\00S940%\00S3$0 A0 0 0  cB! 0 uЍT@!Y 1 0 080@0<00 c/o9"0 S  R @/o"4 %S  RC Ѝ hL08<0P @!`0$ (0100LZ W G-0P ,@MXp\ @lB4w`F8apG`0p`pC`0(``0H0 4 , @< PT$p0` PPP0`6P 001`S2&f@30C0a1S2!at  `0 V0ՅP 60C0f02&P$@Aap2'g` Q pQ ՅP'PqpGp(`a`fX2!~f,`8V*QQ8`pSfp p0fp`D  001&=  ƕAlo`t0l 0` `pt0l  30 00004Y Y 0  Y  0S0U 0S~{*Y4`6 &R \ R80l0 b0 l0\000Ztpl 86` Ⲁƅ!909&tpl0 BpG0Qtpl0 WBt0SY4 :Yv 6S \0l S8 c\ R8 b0 l0\000S 00000  00#400 03 0  0#400 0  0000 XB<L0 0 0 0 0  0 S0 S00ӈQ01q00 30S0 j 000)\ R80l0 b0* l0\000S9L D!B ct0S*l0\06\0l S8 c -LP`p^PJu@D U00V0@0V p8 0S8 0U S 0 1 0P |0`0  ! Qz&R R LDA 0060PL D!B  0-L@P'0PQ $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qU000 -LM`20 80 0\Pp00  08Q1S00P| 0Q{ $0S xV`f0V00`FGQhFQRd0 R X`FoS㪢Z40 X @!(4/V `@Pm * 240@00A4002)PC0`,L0TX 0 P(3/ 0 8,(3/ 0 @L(3/pjwD 0 v(3/68!Q ( @ R% D PR!  0 0600&儀0$(Ko(Kx080( 0$0S~\080$0y(K@ @0 8 000 -LM 0 P 06 K -PL@?o2PPt0 `0@ 0S@  00 0(|!3/@P`!@剹 0 ,P(3/ 0 8,(3/ 0 @L(3/D 0 (3/8P1 @0S. DpYWpp( , 8 ^, @ @YL D DT P 6 ` &̈́00 P 6$˄0[RA-  dß  0 R0#s01 #R@$3 0 p p ľ T uPp`\ (Ql  ,|,l ,tQwp,ḣv`  lQ P%u%l %twp%h\v`Q l  ,|,l ,tQwp,ḣv`  lQ P%u%l %twp%h \v`Q l  ,|,\ ,dv`,Xp̆uP  \Q  XppuP\ Ġ| a|qP̌   p` T Ƞl |uPa\|Q̌ @D  T k 0B0 0 RP@0@D p0 Ġ< l| qap0̌ <'1 T 0B00 R< 4 00#s01Q #  4  G-RMj1|0'0PS|`M0Se @.0Y0SZ @.0 V0S; @.0 U P 0  0  0S! @.0 V P 0 0  ܍ U VY V /d 0Q /0Q /jiRG- p Q RR  0Q2X2H.7&c2HcrRbHV]B0 EWM0\\\0 \ \00 \0 \0 \0\0\0\0\\00\0\0\000\8΃7F`cV 2R0`cRQ R`0P`P@P` PP0` @P0` PP0` @P0` PP0`@P0`PP0`@P0`PP0`@P0`PP0`@PPP0@0L00\0B#2 B"B 0A Qt0'7bc"2bc80XHH$0^NN1 Eq.R@-$p@27c ƒ0l ,'b 8c"! b0qQ, H @A PAA0Rpd0 0TĄ \ PppTP~Q `Pp H h`  apRPP Qp YppX i רvp TpW Tv`~.ZPh`PH pY P ΌB^c y@^ ⾐NᾐἐpGIyW㼐R% P P,qT` X  PP >pGaQP `V`P  XPPZ JuT`d0LK 0.K 000\\0S` R ,0K0^N0 R000F` V(K 0\0 =C-`\PP@@aR㲐0+~ @00R! R0 P@0V 0Sࠣ࠳ R^S\ \ 1>0R00V P@0 S0Ѵ000°0Ѵ0P@0G-鲀MXPPRR0 10+=J 0>k00`p V0h?o20S3V:Ό0ḐP"r   P "$ &`VPbS50 0&PcRCʼP0`V" 6Wl W P0 0R0ЍX` X 0&c RڼP"Pr ` `  `P"$P &0CbQ0q6P b\yP3s0k`0` 00`P#4P 06 Bc YyJR㸐z&hk> y渐  P"$ &WbZ B⸠&P V Nʲ0&cRڰ"r P P  P"$ &0CbY0y渐6 Sr Jr 3s0P0P00P#406cR! 0C 6PPS ༐J3sRk>⸐z&k> ⸐&90&cRUڴ"r P P  P"$ &0CbY0y渐6 S3 Jr 3s0P0P00P#406cR! 0C 60q6.6* Fr 0⸐6 0y渐6z Fr 0⸐6 0y渐6G-J6 MS k>἖0 c R  0k.6 Ѝ` 4P0 04弖00300300300! 00a SPpy0⸐0 0P#40&Ab\~἖P6U*&06Q00 0 P<01 pb Wpy0000#406 BcW~ wpp&0Q1S tPc nU|{P"r    pP"$P V Cpe\Ǡ |pp&AQ0003ӕӅP 00c^@P"r    p"$p &CbU~἖0 SU `4 ec Rq,py0⸐0  0#40&EbQq἖dy wpp&~἖0~἖Oq἖Irwp p&Pk~`` P`,Ġ`0C`0R, 6 Ѝt$ d$ X$ L$ @$ :&@-R Rk.  k &k.@@ "$ :&0@-R R0 k@@&  B&0k.@PP@@P!Pƃ00@-P0 @ K@ +,K( J&̀8+k. $ˀ0PG.V 0S 0 ,R0+Q 0I0&&&&0 -@ LƐ` \kPs0 :̂ |pp p"$p &bS< B0&^u 0  u0#Ġ  <##400 _0PP<0ƀV*0@- Q0k΂0@0qPP0@P#4P06c^ 0C6 S0Ҽ60k@PP@0@#4PP 06 0C60@ @k06 -LMPPp,0S2 I>00 0@40 &M+@(+@0M 0q?10S BR j60 0 1S0!\Y\%  0 0G. 0R < S>+- 0 R00 W0(KQP 6kΆ Sʸpp06(˕ S< 8 !Aq3s0k0 00#4 06cQq 0C6 S[3s0k0 00#4 06cQq 0C6 S Br 3s0k000#406cR)r 0C⸐6ß MΌk 3s0000#406cR. 0CX 6ڼ6帐 Sʧ/! X304< J8 F 9(Ko0 S030#Q0&MSI>@00 j6 SLk q#0 620N.V 0! Pl0Q ;SF;SC<S@I>00 E/Q< 0 S 06q3s0000#406cQq 0C6k r 3s00 00#406cR! 0C 60I.0 ,0sHyq0k.⸐62q0k6<A~p0k6I.00   D :Ɠ0@-V@Q@F   !I.AQ!ѕ"х&  &0B`o0) ) -LP`@( h0P `0P @T @1@V@T yaratcid 0-SL@P `h0Q C X0Q p CW pCVpyaratcid -L M K@P N@oK -LP ? -LM$PK`p( K@P /@K Bp (BK@(;T  0- L@P @o0yara -LP   0- Lw@P @o0tcid -LP  0-LM@KP Bp  DV@P0K0ѵ0@K0˵0K0yara 0-LM@KP |Bp  D6@P0K0豵0@K0諵0K0tcid -LM,@K`p0 KPP SBp 0 ` @P0 K膵0P K耵0@|P0U0tcid 0-L@PP 0P 0P0tcid 0-L@P (0P0 0|00loob -PL`E@PP  P 0-LP@ X0P 00 P  QP P 0rbmn 0-LP@ X0P 00 P P0 P 0rbmn -PrL`P @PP  P -PL`rI @PP  Pm 0-LPZ@V `0P 00P P  00 QPH Py 0rbmn 0-LP7@3 X0P 00- Pa P0' Pf 0rbmn -PrL` @PP  >P -PL`r @PP  *P 0-LP@`0P 00 P ' 0!QP P 0rbmn 0-LP@X0P 00 P P0 P 0rbmn -PL`{ @PP  P -PL`t @PP  P 0-LP@X0P 00{ P  P0u @P 0rbmn 0-LPe@aX0P 00[ P P0U @P 0rbmn -PL` @PP  lPD -PL` @PP  XP0 0-L@P$0P 0B0gnts -PL`@PP  2P  0-L@P$0P 080gnts -PL`@PP  P 0-PRL @00 0-L(@P  00 000 0-@L0P A?0 P-L 0R P Q &o[ [ 0-SL@P T``PP Kh<Kh[ꬾ d -LP@P tp`P  N `Z 0-LP}@P PW0 000 -@PL 0 0R ePP 0 00  00`P Q "`ĕ,Y -@PL t0 0R 6PP ^`P Q "`X P/0 0R /|P/0 0R /T 0-@PL L0 0R 0 &0P Q K"0W P/,0 0RP///ᴓW -LM@P ?o  2P0S0S K0 P 0  P`pP 0 S  R L  Q PPp 00  \* V |V -LM@P 0 0R KQ" 0  b PP`pP 0 S d  TQ PPp ,00$0$ $0 7\) U oP- ?o02 ^0S0 S X P-L<0 0R P oT -LM$0@S`PU  K KP,0K P ,p:P 00 (0KP (0, S Y8P mP P ,0 0꨷ 0 //  0-RL@P 0S# R:   P0|P0 0,X0X X0 D0D D0 000 00  p  P 0 0-@LQP P0Q0 0-SLP`@ 0S P@<P QQ P>Kh 0-L@<P|P0/uP Q nP Q>fP  K0h_ 0-SLP`@ 0S OP@<GP QQ <P/6P >1P  Kh* -`LQ@ 2>Q# &Q P Q' <QP&PQ  PhPPQ PS 0-S>3  0Ls0S<\ /S `(`  0Bs\203<00#/R>R  R `R  0Bs0S>300# 0/R>Rpp0aU0 P ᥉P0/Sg 0$00>Sk SW 0`S 0Cs0SC` 0As R013200#=Q00S Q P  @r R <"  "=P  R0f`00"S 0R 0 "R< R  "Q? Qx`FVu0Sr 0(0y 23  0As0SQb 0 0 u(0SV0$00`>SP0``000 0 0`u  >R?00c0  D @-P <P RQ RP <PG &P@aT lT gTtP4 @mT' pToPsP;P'tP;P<qTuPoPtP;P"@pT@;T;P>S0S Q-0L  ᤈo -LMMMK`L1OK0H1 N?KL1 =KQKP1 ,A H P@ Q-  R၈PT$ D 0 3/P D1L@1 PA D!<1 8Q 5/P @1D1 0 0 0P@(K@L<1@8Q 5/@ 0 P(Kp  -L@,PPP DaDqDD@@`p 0Bs0S4<R6  %P#   P  P*  0SS  -S00-S0>S  0-S0>SSS @93@@@@  -MLMPR`phP5 @T2 @W /R ~/R 0AW Q/R 0CW /RW  C B/QW0A0g0S@1BKH ̥0$ K@4D.0BKH0ި 0 S*0100 0 &p@0  I8U %Ps890P K? 0  K 0  KO8p 8PP8X8p L8g8p0P 00  -LMP@PI% ,8pPD K9pE dKV?p`0 0`p P`i8p(   9$K0 `Pi7p  8  `P0 }ip 0 $K69$K7 0-@L 8$9K0h -LwP 0 0 0 -LIMMK@ KNK V 6/0  0 /PR @ATu 0 R 2/0P`w` P0 0 3/V@ 6/T ZwT T@AT8A . p0S2 03/P V 6/Bw81pS @0 R 2/0P`Iw P V 6/W3 003/(K 0 0C/ 0 0C/ 0 0C/| 0 0 s| |0| 0 pjh h0h 0C/\aT 0  l `  H <  6   -L@PP-  P $0SP  R @lP P C@P 4 `P@ P3 | P0/ -@LOMMKH X! L T0 00 HL0D! \@! -T! R/KmKQ_KNKOKSKP! T%`0 P#P4 HL0 @04/@PSoKR_K@HL003/@0 P(KT@D1L!HP <80 TSD @ H L (KX!R000 0 0K/  0/0/ 0-@LK0h ((-L Khxp=r= (0-@L0= 0-(@L@Hؠ0t=8v00-0  @ UT:0/  R0P0/P0-' 00#0 A  T0!RUT0/T0 P00 UT0/ -`AL@YpuPP (8P \PP S᩠X(0( (0 ๝;LTt ? -L(M 0@ ! C 0C@< 0Yp50c0 8KD0@S< j d0 x8/"b#80 0@000 8K808&A#/A!b!b0b@< 0)p @00  Z@< 0,K 0!c0 d80D v>C 0CR@< 80   t` a080 B00pD0 i 0@  080h Z@< Z  p@0 p020 A@< Z 0 0@ S< 00Z 0< dK?a S#a0`?o02 dK?a S#abo< MQm <@ \ @P 0 "#\  @ R @ R 00@ 80KX0 0L R0P .8<0 `L@$ ( 08 X 匠ಠy < RX0A8 P 00Pm PdT212 ` b;R0`8 "b!#!\< TQQ @< CQQ @w 1 @0 $ (0}@<@ u`/\#b b0 dK/ϠRlR3l0c?o2 100 1 B0p00n 80D DSd080 ՖP:\P >0Q>0^a$ 0(0<@8AALA^p^ P<Z@aPAaN0A S$MA>< @$($?Q $I Ф nl',  Q`8z F/o "<KPzV@<@ @8< 4JQ|0@0< 0(0c$0<T XQ0P 8 <0 bL@! $( !<X 8P 8 ,1 0!0( 0c$0< @ 0 0 0. 0-L@T 0 0-L@T0 -(0( 00L0S }8.\ -(0( 00L0S m-\ -(0( 00L0S ]-\ -(0( 00L0S Jl-\@- ?^ʎ@ !0 0S0 ,\ 0@S ^ڸ  \0 #\ 0^ #  Ϡ,? n@X ! @ 0/"-? b0 0 X001/(001/ 001 / 00-SL@1/000 -L M@0@0 0@0S   Á KhX+\// -Lⲁ- -L. -(0( 00L0S 㟁*\`o// -LM K"l Kvt -LM K$bPp Kwt@ -QLM Q Q  0  K  KC0 Kt ;^t 0($/(/$/ 0Y.<+ < 0/(/$/R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@᥏ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P/80000c 0#2 /UUUU3333R/  BP0P BrA0A/ -L,M\1\!0P@ T`p(  X0/o"T R= ?o2T0S f( 0R4 K HK0@0!$Kr @$RS $B R $K $Q  X0$K $Q   RfK,%  D   ޳: S S  SW  Sw 0   S  SI  S ? 0  r-w- 0!-@RM C RR ! Rs  0 r-w- 0! R; ( R0 Rs  0r-w- 0p! R5 0: R* Rt 0 C   /d 0 s 0 R-  0R-  0S 0 Cx 0 Cx 0 CS 0 CT 0 C- 0 Cx 0 C S A 0 c 0 l 0 |b 0 xp 0 ta - 0 n -L M0 ]@P@5 aP0 0墂pp! 1@ ^ 0P =R Q@`p PU1`@WP0D0(K=0 0  -LM<Ÿ<2 @0P |Kt l @`lpK#R} Rp #&R R! R  R _ R Q R  R *T   _Q R(KR ap>#R wR R R@0 >30 QP < `P fT  ;_P<0@00p R@0RY qR@  Rx  R T R  0>#0!> Qy >Y b @mQG  R5Q*T_Q^Q Rz R-  R {R~ R= Ru 0>c0cK 0` cKcK` P0CK@^T ^ F R " N  RHT ^E  -#0C>cP 0P>S P!>#"RPE P  P0#!!># R 01S@ >3A 0c P `P00C000 00 0A 0>c0cK 0` cKcK` P0 #K 0P0 0P>3000C0 0Y   -%L$M @P4 Sn*%4  Rv kR R4Y- @0UZ>#R} Rp #&R R! R  R _ R Q R  R *T   _Q R(KR ap>#R wR R R@0 >30 QP < `P fT  ]P<0@00p R@0RY qR@  Rx  R T R  0>#0!> Qy >Y b @mQG  R5Q*T_Q^Q Rz R-  R {R~ R= Ru 0>c0cK 0` cKcK` P0CK@^T ^ F R " N  RHT ^E  -#0C>cP 0P>S P!>#"RPE P  P0#!!># R 01S@ >3A 0c P `P00C000 00 0A 0>c0cK 0` cKcK` P0 #K 0P0 0P>3000C0 0Y  G-MR@ 4`8  pFN@v渂Q>QA !Q DQw WQ QV SЍV>SR 0 Q`  Q ?&QK QV0 Q  Q Q Q >S  Q VQ Q>S < >  eB̠QuPU0 "Q>S > Q  V0 W0    > ^ >>S U  qYn0 jQg  d -L3Sx S6 S0 s 0 S@v S S  E0@P0 Y00 P 0 p0T:(K0@>3@1># R@0 4P  E0@P0 Y00P 4P0H>SP1>SP1>3"SPE00 P00 S0 0Ppv># 0 0 S@  E0@|P0 uY4@ 0@p @0fWP P  p004@00p@ S S S zpw >S b?R nS   b>S?R cpSmG-RMP4p8 GNwA>cVD %V MV eV VW SЍW>B 0  Vb  V E&VT VWV  V V V` @>@ @ @ V SV V` @>@@ @n` VX  nV~^"V` @>@@@`A>C T  WZ X} @@ @>C T@ >@>c V@ iQduV ` -L4Mp400 @0 00H0 3(@0<0 0PPPD  \~ A? 0@0@ 04 0 Q U  U @ Y`  Y T A0 @T0"V  U- <"   _U \  Y <P" _YQ U "<   _PE_oRR  R0A/F BR;0P\4@@` 80 4 XD UP^ 80 H@00 v00  v000@ 0 P0z!V  Y  _Y RQ `0H0 v0``  Y  Y @` u Z Y,@d`Z Y PT VT  `0 @d Q L U(`4(KD -`LM0PVp<*01>#Rx R6 Rs R@u R R0  H0@0 Z0`0 P 0 p`0T:(K@>3@1># R@0  I0@0 Z000 F0`>3 ` >1>3"SH0 Y00  pv`>R@0  H0@i0 bZ0`0@ @@p 0SWP 0P p0@0p@` R R R `{p`x > b? `oR   `>32`dpRm -LMϟ唯 ^h0 @  (K 0 x0 `?Rx0(0x0 0Pp0 Sx000 h0 0 0l 0 l0 S h0 0 0l 0 l0 Sx0<Y l0S*ppP ` P@`T Rx0f@ Q:WP@ pP0S 0x. $pd l\0 T H0 @0 <0 80 40 `P X@ P 0 0礀 0 70 90 <` A?  | 0 .0 p0 `0 0  0t 0 l0 tSl p|Qp00 Vp0 o  Vw @P W  Wy T p |p!0  @Tp<U  V%  000_VQ  W 00000_W0Sa V  0 0000_V``VA_EPEUR0V l R t000 | l `;U  W 0_ W00 0S R X; 0 | 0@@ W  W P0S0Z,@P0Sʟ U* 0P00@z00r VZ: W Vl0sp0L0  0Sx0H0S p@d`Kp@L0 0 "P0 0PS 0S 0D\ 0 0 Sx0H0S0 | x0L0S H Rx 00 0 -PpL@ ET5* 0PP. p 0 P Xj X L0bh b?X _\ h0@P d`p X0R D  R "*AAT0 Sl l`d00 P00 \00 `p0L0 0S M0\0 HP Fx0HPzX h`b b? v0l@ 0 )PH \0 `0 v0l@ 0 (x0<Y l R *tP |@ `pP@`T R@ fQ: @UPtP|@0V `xp0 $pd lT \` H` `P X@ P 廔P@  p< 08  40 0 D nz대 儠 l T0<@R80Rt0 400 d0 ]z A? d00 @@d |  ts0p0 |0lP dPR t|0 Tl Pp00 Xp0 |0  X @` Z  Z T dPA0 @T0%V  X- $   _XP  Z $ _ZQw X l$   _HoᨂR  R*AoF`FVel@ d/o"Q R\Pd  l0 rl0d t r0d00P l Q 0w#V  Z  _Z RQ X#d 00 70`` Z  Z` @c}0 @m|` a,@b` a V" `` W Xb"p0L0 0S l0s 0Sx0H0S pdPK`LL p 0 P 0@Sa \0S d D\   Rx0H0S`0 y x0L0S H Ri 0L0p 0 P`L DQ2*p 0@PL+ `p 0 P Xb X L0bh b?X Wh0@P\`dp X0K D  R "*AA0l0 x0HPX`L0 f@h`f? `\`V T0\0 HP N@L!eEPH \ @Lp 0  0 j@\`\`@d0DP\  0T\00 `0DP\  I @ `l`l`4` -L8Mdd PP`p( <5 S& 8! S" Q   \@K! 2c^tV  p( 0R,$K@Mt    \@K2 p@tt@t@ X  uP@ \@K0 ,@@4 49 8 d ( -p`LW * S\ 0 0S:00S000000]\R*llP@gP 3pP0S PUT 0S00`wd: 0@-P\%* 0 P0  r R 0  R00S!0AS @lT@@R@T 0 0S 0000000tu0@-P `Upb0 s @   c0U `F`Q  00C 01>3 !/ 0 0-SL@ :0S000000 R [R.Q00A0 S*R .R 0S00(00000 ]R000ut 00-SL@P* 12!2#S 0S 004000000 HsPP0t -pRLP@`P 0!o0pp 0-LM0@SP0S*  !K0 P 0  -L$MP 0@ @0 0 0;R040 ):q 210S rP prP0 W @\ 1##2\d v0@ 塑))B 2 TH 0 Z p`0V n P&  n P WL %m:9嬙0D0 9 080 90<0 9000 W+*0]S" - S Q #R  -Sd [SQ%:0 `S*-Qf  00000 P0p`W:0S008000(K0:S< =S R :0S00x80 000-S]S0S00H8000= 0000DR*0V0=S3 0S00 ` p0S 00X:0堇S000-S]Si `80<|  %nP0S Z0S000S     000S`0Sp )ኒ R  J. 0 0pCq0S q R R 0S0000DR *0V0:S0]Spp0S00{0̅S00`0-S]S %4 0  1  000  R `hr ]RH0@ "-00-00-00p0W*000]SQ  0RJ 4p`V v0Cs Bk s dd  Dd 8`0^S L  ]S -S@ pდ0S 003000(Kpp] 00]00]00p`nR ]R -\ eV0S 00D000\p`0]SG 000(Kpp- 00-00-00p`;L0S! PJp0 `0 0 `000`0P0* H0@ " 00 00 0C0 R p0@Hbs0pSW00  O0Ssq(Ko0 00 S**`0T0j?o20S R4 p000Q00Ss! P `Y00 cB"(Ko4`L V 0L pY0@00 0;L0Sw0pL0 t4 x4 PqDqt$4 (qTppo oHm,Xk -LM!1 @`08p 0 qP 0qP00 0S 4040 0R K t 0S ] 0$KpP"K$K# K"0KpP 0!0 , -PL@`  aH0DP"%T\ !B d@@!_ 0` -@p`LMP  UP 00$K0SW 1 W00V V0SxtLKJsrqpo"kjihgf8pG2pG`F  h0  h$Kk;p0 h  h00SP ")0SC  " `Fp  h0b 0P  h 0 PS "0SA y $Kk$K \0 000$K  hc A ]  h Wc -LDMܚ: T 0 R\0 0@`00 0 S| 0 H0 <0 :z0X0 :吊0`0 :@ 0pD0 0P80  Sy* |R& Rt  $AXP񏐖~}|{yxwvutsrqponmlkjihgfedcba`_{l\ZYXWVUTSRQPONMLKJIHGFEDCBA@?, 00\00 0R$(K0S0080000 S:80S0S00\8000@0S0S <0 c  R*(0000 0S 007000 S* *B?RQ{R PK R:0S0070 0000L 00* 0^]3K4K1K10KP0 4K2KP0L 00S 006000 R:0S006000 D0 Z 0DQ 0 S*0)S T0)  Z 0!  R*00 )Rb 0PS006000R  0(0(0t t 0(,(,e0P0 0S 00D0+R00 ?R8 {R ,P 0+R{ ?R, {RBq0 S* ,R0  S * 0}R0( 0}R S00S 00X0P00r0 S  e0 S "0S   S * *B?RQ {R Z  0S 0P00< \*T P 0Su 830000 Sw  e*Rp0 S  e0 Sk  e  L0 L0*R0 S  e0 0" 000<S Z0N R  `   F00 0D8 RO @ 0R0 0SH 80H0 <0 <0 cm0 S0B<0 H  "b0@0 H0  c0H0   e0   e0  A 4  e '  e0 0S 00(8 a0H  q< PH0  cP,h Xb4bHb0b8bD``_,_^T^]\Z -LE0CS^ 1x 0IR0 S00 0HR *Q R\Q 0 ` 0R0 D  f)0 S  f0m  fP0 `P\UF0S00D0000P3\U;0Ss t*U P0S 003000u0  8Rh  f00 0 0  * ] ^02K4K3 K 1K4KL 10KL  00S 0012U0S) * 0 R 0 d L0 L0x  0 O {RY000 S*,P 0PP0 S:0S 00PP 0`QT00000=<R\PD R Q\P 0R }PR0S 00HH0 S)Q0000 40`(,  , (0 @0)S{L JL 0RQ X}P00`x*( VVVVV)U{@S} -0L|MSP `p| vih@@P s 0000 0P 0   0 0 嘀 @ ` 0KXK Q( `0P40p `` `(`,`0`<`@`D`8pKmH` 00C 00 0 S* 0 S: 唀0AX$0IP8I0S R  0SQ0P  X, PXa *(K4p X0wp40p ` R 0 P  P ^ 0p \0 0siPV P`0>#R ,R0 R R, @0P`@Rm >310>#R R "R (( 0>3S S0\>31SARP SQ(D 1L @ 0 P| R(dD `1L @ 0 @100 0 <c 100  )0S00 000 0 E IV@` @pW( ( P<@( p0>#R0P0 0R (,D( L00 @ SEeJJ -LMq K -!MLMp<1<0nK `F `F@ p10 8KP 0 0 R5(K!]K PE PE sl,0K0# T Px ΥP\HT PCKH4TKd0P ƟPiP @T\ؤ\դ (  -!MLMP1!0A@P x10 8K`PᕟPD~K pG pG 41ᇟP6!]K PE PE l,0K0# T P X kP"\HT PCnK`F4TK0 P cPViP @T\H0S h \l0 0R (K\c,$00$(묙 G  pFdF -GMLMğ  ` 4 0V0 4 @ F^K PEEK 0E A0C.KA;pPx4S 0E PT 0 Pl40IPPAt'pPPpT hPlh,Px4PlPhP*hP%x4$`0Sxb`/A `"P4 12pT h Rt40 0R{(K/!PppT  7PZ Z00$ 0 $1 !P0 `1 0$ 0 $X1 T!P0 J18a`Jx4,,  4 !0P4 21IPp @zs||j'ԗ  d D @ @ T `   x -LM@10p`K0P (0 jT' T0U0KPK @Kh@P00:KP*[/r 0 j/ 0 ( Q K0U0K jPj0P&<  -IML MDDƟ  4 0 4 0 $ 0 4 @Mp9-KEK B A$ Xt Tt Pt \4 pPp 0%4  x$ %5 |$ %t4  $ %F>K $ % 0C GnK$ 4 `F mPPD  PmNj00St40Ct4  Gj0=S0pSA @j0B^K PEPE44K 004SPA.jx0 @44K00 4 @P3p4 |y j0#S m@T 2P40 0R(KDppTpW p6W04 D #a#at4$0CRt4  0pPp4 n:CnKP# `Ft4 n ie @beT0D00lT dt i Pھ0 4BK I@CI  Z34[$S; S9 d5e d.e d'e  Pip$[R n p4[ S  P t4SN PV 0  p`  wPF PB P8e4P@Ci 0   _, P4GNKt4 w$i0S;mv4e4ll\ht % $ 0     )  l 3 , <   -LdM | !P@Kx `qP ppK0? s00 { h @ t0Kl@ h p P3t0Q @,@K@`@P 0V t0|  @tx00 0R(Kl\0|  @@Ơ 0੉$T " 8   8 -@ML@K -L\M,, p!P@Kx P p`Kqq0 0   h @ t0Kl@ h p fPtQ @,@L@/`t@0 @tux00 0R (K@` $C+$X  6 -@ML@K  -LM8 +K ,ğ 0  `2 " 0 k0^K2 -0ᣱP $Pw 1[ S S S S # @ S Si  000 S S S S\0 S S@0 S S    0CS00S 0   0CS00SQ 1[R @+SM -S51[Sp @Sg2SQ 2 8 0p`2 0+S' -SF dP00W0pw00\ WP}X6 Ppu y0p+S0S @S52" ?o21[Sp @S!2SGQ5 2  0p2 0S @S2" `?o2 Ap` ;p7dP0W# 20 0R(K22 p@?@@v m1K o #밇 , -MLM8R`42P0 K9 >K 0C  ) C.K;0 P[9SX NK +^+#.9p 9 9|5P@ #K J P8: S @4!41 00 590 0R8(K 0 0@0 k HP8S ) S 0 0@0t 0 0@08 L \0 0@09)0 0 T@h"T t P d X \ -L M `R @Pp 0000 0 (KoC``P p0 P  55 (K܀d < -L4MD@KP`p e H0K< "PH@T@T 0 PPH5 KHP/ KP p-L,MP`dd@ @00 0K8 , 0 ( $ 0PK/`Ku 0RKp!  p-L,MP```@ @000 K8 ,  0 ( $ 0PK/`K 0RKp!~  -P@ E`LKep 0P 00A|` V ࠑaA\WAAA\7A Q0 S AL\ 0 0 S$ 0dp gS 0ą 0R:0g0000 -0X@P?00@SL`P ?Sp1?p#@0 4 0R ? S *: 0 CT: 00?0R*00T !*0ᨀp娐 p???p .` S*! P* UR*`0 QS* 0d0H0000 -`p@@@0@PLo,00 @f{h 0-LM @@0P ( @PP VK0/ -L,M0K 00K0h 0K0$0K0, K(0K1P <,@($ K@ 0K . -L4M0K 00K0@ 0Kp0$0K 0, K(0K1P $K00,( Kdd 0 -L\M! P0@l P !@DK  @0 d l` hPPN @`L1Lq0ph0 LKN0` 7@P. ?aPTKb PP0K0X0K0hKT P XP X-P0S(2 xP X>P2c00l00 0R(Ky \ X H 8 0 -LMM1!00P1 000 r_hH dGPPN @`H1Hq0pL1 MK߁0` @P. `POKPN?K0=K0<H1 L% P @8 @彁81Sḁ2 P `P{2c00P10 0R(Kw  t 0/ * p-L$M0 0P`Q0 0  0@Kᆫx0 K  ""P C0 0 0R Kp8 !4}`P8 G@u  -FML M@0 0p]K (  a`PBNK@D+O Pʈ$ c@fc$@R( 0R K pt  -LdMp`T0T0 P@K0(0 Ԫ {( 0R Ks ..L0M0 R8Ѝ/0: !3P Ѝ/ d 08P0/ r 8P/ 0-D@L@M@PK %Z 0K0' 0PM1SppЍ/ 0-L M0 0@PQ00  ,K|- K0K !RC0(0 0R K00 )Y|PP0 lq ` -ML M@` }K pG( , 0 /`P@0@ X0 0 ZP0;CK+0R0" T 5 _P T0@T_0b@lb@,(50 0R(K+ b@ZbX@ QNK @DDpFKq  0-LM K -LdMp`T0T0 P@K0(0  A( 0R K(o  -LM?/0x  @P p@K0  0\@x0 @ da @ p 0P|?**P 0pP l@= 5,4,?P h @&p Ȁ hpdP  P@%Р 0 78oP 0 l !``| @\>.06:o`M P P)P|ndA0p( P%X `pP] n Hn'2ϿT0p$ ep` ^3`P0 .P ' aq@(ฐ m3L0 *M3`H0 ( @ D `Q͌3o1` `'l - @ %0(@0@ T͟0b$` `= @)cq@< 80] $3?2O@ P@* a '` `(``m0,  )|P夌 0P P%p 0*f-4 `'pd >P%_@ P @!|P p0@b= %`&P&`@' _cq|P P倠 @M ")(`0*d & `P` |˟0#*ठ `&`& 0#?0 0o#0 @ " 'D[/nA  `P*P)`.˟P `]p*ꯠ尐儠 `,0 0p$`) !͌`&eq P`& _P P**`P( P& .laϠ @ <刐'` ᜠ尐 P%堠 )@ I P%ఐ &|_ *@PP%@*O@ @p,P%ࠠyP%@*M`ጀ_pd᠀ P 夀Pn*P(..`a᠀  , *@!਀帐 ꯠᰐ`唠 P%嬀 pP%*p_n}@$*P P`*P @ m@$gq0p 刘p p P%lP%,p|P%_ (ࠀP P@pfM`&'p0 * * p Ϡ P%`P%d|M P%g0 *pp_ !|P `P (dA|`*pP)਀`}  ` "* "0` "0#$0#  ( ⟠ ꯠᬠ W倐 |gP} 0#刐@P . ` 0獈*gqP ,`&@ഠh1M`& ( o` ` P' `)P%dHM ਀`&  &`& Popጀ #.*ऀp*]*dA  ꯠ)ea} P%0 Ḡ | ***$0ꯠg!} 0P `%P & "@ 睉@ 鍄Ogq $0 @ @Pဠ P ` P%圠0 !iP%_*P@*_  @ P@4` m0h P$@͌ pfa0 P% D@ P% ᐠ  ᜠO @p*}*l * 睉  g3 0P|p0%p!CP!}i1 @ऀ០ᔠ Pଠ`P ᴐ (P` *@*OD ,c|@ ጐ圠 ` ଠ  `] gq*午 @*eQo  !ഒ@ ` `ဠ@0*M hhŸ`  0` 0! `#.?r䝉 dA-` ᨠ ip帠 0Pp ! 0!! p`P0P%P%P%_pq Pb!`p T0 `*͌@`p฀ `嬀P !p@ 0! P@&ᯠ` 0ᰠ@$ @$ 䟠 @}Ѐl `༐0 P 0`gq `᠀0  P%0删P%@ P%@0_@$0PT@$P  `@$mO歀@娐n!n yZnܼb 0 !faጐ$P 0 P !0 p 0_  Ppj!=  p$OP@堐@   p' @$P ㍈ p'c1@$|p   Qp p`! !p|`!蝉P͊ h#iaP)@p 0@$|p(@$ p' p@$0Q !O쭀 !P@ !@p_!0@P开l P &! ,!jP p)n͌p'0  P p0!.t2] `*l@  `&B @ .` p(m !p'e_P |P @!P!@ p0 ) P$Mp0f`&!0 ,P%(0 `T`p`!d}!@`3P%@$o P` ` *0 "@$ @$P獈OP%@ @ gq 0)@$ ! haP% 0' @$匐0#0 P%L @$|- !̓0 _P lQP pP!n &O! P|p.b!`0*p' P娠 0# "P p'd吠, 0n=` *p' @$ o| P$ `pP%P%㍈'du. c1@)  |  ha-!(@# .b@$|-_ & p Pb "Ȁ@$ V0@$n*P O p!`( @p'0@Pnp`x M P A(K#0@-((@((( @  00ܺ#EgvT2 -`L1VPp000>0a?`0?SP a$KkpT@@f iT`f W 0@W@ -LM0pK` 0P0@0(0 R001 13R0 0圀~? S  0~? S V `F 0"01 13R0( 0R KV L , 0-L M0 0@PQ00  ,KD|- K0K !RC0(0 0R K00 )OuPP0 bU T -QMLM@p mK `F0 `F4 0 wpP@0@ X0 0 SP0;CK+0R0" T 5 UP T0@T_0[@b[@4050 0R(K+[@PZX@ RNK @DpGAT  0-LM K -LlMp`T0T0 P@K0(0  dA( 0R KS  0-!$$$$ $0 0#EgܺvT2G-M@P@@ 0\@0@P @!0)P`Dn+ 隈0! 0# eH0c9 )! iL #! c;Pn ! ppT` }.!n X@i@'0 @$\g{@L0) 0#0T` `Pi`P; P$aP%Pa ddKZp#.hpc;p%p' lp e[i@p. p'@ppnH0p)p'0tpic=P p$p'PxpdK\p#p'|pc;p%p' p$`̞\`e[ g|@.x` ऎ)@P`n L0' )0\`,\ Lt`ˉg{ ! c=P$( `Pl@dK D`&蝟e\` #  aˠ "  h-c; %j!  fp|(pXpe[ *@. ),Dd@@͟|@n 雃0" ,L@0͟b+< @)@@$PP|p@ipX p#p 'c; p @̟|% dL e[H@ x lʉ @' @g $ p @`L,THp, pp'0H0|`& p l((;`lˠ`&P p $x { )dKPpZp#.@@c{ pkP`lL % . e[Ɏ$ a.4b`{0 "`(P tP,`-)X`Z P0b+0#P` lˠ0,dKaˠ @ @|j` |`h !@h`ppP Dz @$0gKPc9c ph`p'Lpn 0pp0#  lʈ "hXp8n0, 0 0#@ꫀlp9lˠ (0  " Lpp)h0* 0 0# (\pH9j 0 ! 0<@p I` "@!hJtpb+#! jTpc;$ ,dK. ,  *xpn! ,00<|p\a" ,@@L`p4b+# ,npp c;$ ,PpdK. ,  b-dpn! ,00Dp8a" ,@@IHplb+# ,|p@Wc;P,Tp gdK`p   ,`Dnpp'00ƟLp8a ``&@@J\pƟb+ )xpnc;(aPXpPdK* dp 0Ɵb-n PpP%00c9`lapp'@@ş`pdJb+ ``&ppc;(HpUdKP,  b)Php`n)0@p0@ş9a PpP%@@I`Pb+pp'ğtpc; ``&dK`p. , nXp ğ(P! PP%0a0=" ,@b+Dp@XğdLP# PP%c;Lp0P$PP%dKlpğaP. PP% n|p b)P!PP%0a@p0ßc=P" PP%@b+Tp@dIP#PP%c;pphßnP$ PP%dKHp@P.PP% ntp ßb*P! PP%0adp0;P"PP%@b+\p@ŸdJP# PP%c;hpP$PP%xpdKxŸP. PP% ppn b,! 0a|p0c<",@b+hp@M# c;n$P,DpdKP[.! nTp b*%!0e[`p0="@!\pb+` #,Xpc;a ,P` HpPe\!, atp )%,0e[xp0c=",b+@p #,c;Lp ,P$`PYdp` !ekl,$` ``@ z@04 an %8 " < X0 L @0( " 00p0h P,`:P拢PyZ$M\>pmvmznܼNS! PP婄 x8@n @@"TP@ic; ( 茎d@j   p"|p gyi @ !0 +0`h@ P$D PYg{0 0# @H0H(b+,\Hae[0p0#`flp@xdK ,X1a0p Pp'l̈́ Pt1fk0 @0"0ql@=npP P%hTBlˠ@ ` p"p@p8R|c;P! -D@\h' . PZdg{" 0,@dJl2b+%0 ,ah2e[$0 p,`h@2dK!0  ,n`$3a &0 P "ȄpL#fk P. P@P%0;Pt#n@, @ @$ht@#lˠ# `!p{Lc;@(@@$ b)\@h' . P]|g{" 0,@dMx<4b+%0 ,aTd4e[$0 ,ppgmf{XdK0!00#H  aP&P`& nk PTlʄP@l[ 0.0;cK @ "T4 aˠ 00#ppd\%} g  `(`jf0p%\p' Pppଅg}`g`& @@HԕdLdk p p' Ɋl[ph6@0 @$ @ xdJd+ ,H6D0aˠ@ p@$nn @L60`!``a. pPP6leY0e!  *bk0X@P P% PG|e\@  " ⭉ tp@ 0< 0p 0# 0 $ c0`e[ `Ѝ -p`!!?@PjUL@Z P@@ @  L@jT@V @@0VP*  d,KoL -LM`@ 0 P?@ n##|(0K#4R &K!̠!'0K$K!4 n"K B#0K!K%pK(K T0F  ", @ S @ "$ @  @ 0R` KhSL8 ܲ Q`$ 00 Rk$ xB@-d @4  R  *4 8/4 t0 S@- d@ 4 *8 R РS /&BxB:/D :#Ƞ R  /46S//0  0cA <c< -pLM,@K4`K $ P0pp4 0 pO pp0,4 8 0 pB pp 0,4 8 0 p5 pp 0,4 8 0 p+ 8 R B   R :0 0CSR 010! R0*̠p0+4p 0 8 p`(K(KS0 Ss -ML M00 Pp0@.K(0 nKp`F  JT"( 0R" KKAAEp nK`FPT JT"(@D@0*/R3 HtH 0-0@L@+PP0R@P -LhM8Ap@0SE |@KP$KP5Ot1O|`l0 d(OP@O`tO|Pl0dO K P@00OO'|4@B p- L`c\X0X 00P`@P@@T Q bPD 1H`0?P0T P0 !R 01 R@P///0H0@>S 00 00//(0H p-LM4@K` PQ0P0V E>R 1"! 00 0  9Kp>RH 1"! 00 0 Q00Q00// -p-L MP@U@ ` `0 jP a 0 QX0X 08 R;0Kp0( ( M. X9 XQ@- -Q =QR-+R 00+QqoQ uQ gQR   +S -S =S000@ @@    000000 0@-0PXS oS= uS8 gS 0+S -S00PXS^ 080P r  R @@P SPQP@R   # !0  ,àI@ -LLM@wTPp 0<`K LKL0 H0 D0 @0 "@ @j`PC 600000s0S X0 0\ 0p``  `a0HSGEDCBA?>=<;:976543SX=XQX R:`p`Ah d0 mP h @D gd0`  p\  Z R*Y\0 0 X00 X ,X9 +X@ 0-S6=XX00X0 0PXA@ Q񏐸% II00Y  <Y  ;I?S R:`p`Qh0 d lP d PE gh0`  p\  =X: +0H?oZ20S R4*Y\0 0 X00 R:`p`Qd ylPc d PE g`  p\0T0 0X0 wC'=XX 10X0 `p`Qd OlP9 d PE g`  p`p`Ad ?lP) d @D g`  p,O 0PK  P0@0StO0"S1Ds >0j-+! @0 (K`` O@`m`O@(K`XP `+@- +0B XR R0`0 +0B0p+R XR  -R`` p` pWpP@QP``(KPuOO00KO`00(KDO0`` 0+  0-L M K  p` K P-L 0 NP/00/00/00/ 00// ///00/ // / -@LP`e P& + Pu 0 000PhPP0 r`sx0P0p000p0+ Pp N@N0@ 0 -L@r\P` 0p080p0 `@0p0 0-0@LTP` @T0rS PzKhP o0+SKheP -L0K$M #, K]0P$0 @10(0  J 0100S;CXp@$ P RC 0$K0( 00S.$00K඼ K @,0 * N@-Ch0( 00S d$lNLM0@K,$0 \8(  ̫ -L$MK 0,, 0 K 4 0P$0 10(0  A 100S4p P 0$K&0( 00S($00K K:4 0,dM|0( @00S d@$kM0@K,1 -$0\`$ -LMP1P!0p`0S581PU 0V90S P@T0S7lM0P0Z000S `K^M0S   4pP qk PKkkKd\0PULػ/80 0@ $̻\dP 0-LLM,PKl`KD0%0 p@ pp@M0S +wPpp0S@#W !k(Kp hpP 0  bpp p p@L0SwP@ -LDM0 P  0/8D#K@0040 0w0+D#K@ 040 U`0 00 SR00 Z0X0? R 0 d0@@ L 0]x3@0H0 6H0D0 0Z:0@TU cK0 @ GU00T0S0@" !R0l 0i D00Z:r8_L0re4 2@B!e2?A1c1 B0 @0H0  0 d"0 (K0+HB#K@040 0/#K(2040 20H0 D0 0cS0Cn d`p b0Csp2`VpX0@P PCK 0 GP0ZP @P (K@G@0!`402H@d 0 @gGL!?L1!P 0@ (Kd0@0 0@L0 G x0P c 0h9# 0@0 0@L0 5d0@0 0@L0 -(K@0!2`p@ GzG Ȧ Qgfff` G-0 `P Mqā0 Q:P0 0!S2  S3 S S+  VZ \ V Q*P0@!S  S S0S;P0S `Ѝ S0 R00 00 R @T R0 R0 SR R# 0 0P`]-*?!%ER 0S0 0 R pP/// -ML M PBNK@D@Dp`+( P0@>( 0R K03/  -@`P``a V00 L!5IP4 IgpPH 0SG  p0S0 h@00dP. T h  P 0  0 ! 0`V*ZdpP T q 00S"qG0J 0 @ -KML M/P("p$ `@0 T1 /T   @@T/T  U0 0Rd(K^@/T:UU@0/T p   P=K 0C4 @$0 P   0S00. 0W/S 4: S S 0 0 0.0CNK+ P 0@P4: SW/ 303 101:J/0@@0(03/  -NMLM`  p 4 0尠P@ 0 4 IT&*0U@$ @R0 R0$0a?o24 00RU4 0 S400E0)P04 04 4 4 40S 04 gCK +A 0@ H 4S 0@ $04 =K 0C4 0G4 :/P 0  ß R   Q .R VY R   WR: R YL4S[ 4S 4$@P4: S $P 4IQ/03 10I10040 0PF00K A$0P4: SX 40 0R(K  .R R .R V R  @% 03/Y$ 0L  QP 40I0 oPm 0$ .Rf w 41Ya<YH0S4 04P0 4"0S. CK +P. 0S + P@H 4/P  0 3/  0 H / 0 P *z  -ML4M`50QKNQ=K0C~\@ 0 VB  ;K,0CQK[K08PE0Q KQ=K0C0 @(((Q ?QM [QB *Q3 q0QQ=K0 S 0CRQ=KQ-K 0C B0 S P PPQ-K B 0QK0Ah4b0 nQ=K0C00 0R(K S  S QK $0 C !^ ^ 0 尀0 \B  \ p]\W !^|00]Q  0q-Q]\ |Რ ]Q   30 0o    CU S R CU S R ]0 @Y 0 A 0p/SS` +K, BQK PB   R0p 0/SS;Qm 0K0,H 4XSR;Ph 0R P Z  R+SR  Q pR*0S0;RB  Q-KK B AA @+PP7Q-K0 B0 0< S&Q=K0C vP$;K,0CQ-K PC0[ !^ 0 Q=K0K0C A0C.KA; P4S PP+S *Q=K0K0C A0C.KA;&P 6  ?-*<*[!]L -LM 0p P` 0S0 0'0{S @(K S 0{S@R `0 P 0 }R R Q K( KF 0 -ML MQ჎Kp`  0Pi  Q 0@P{S }S! 0S [S0@S]S ]PPP @0S  (KP0UPER2&{QB }Q)UPE0Z 0 0I S:0 00000C R  W 0S [Q ,QU 0S00(K 0]RR ]RRR0 P -L^KM PEM0      nK\@  P \   "K.K\ BnK@ B{\DɌBR  \@ \\BK\@ -`LP@PTQ PEPP d@Td0000S [S \S ]SR 0S/*S ?S/Q0 S 00 @- 0S?  #S1 @C ST 0 S "S  P\S 000S ^ 00"S000 CQ S 000 -QML M1!A0P@ Q`(  #( 0R1 K R~KpGSK$0K pG#  p BKHx H0 p\P@00  02X  x Xx Pp 0p , -LM5e0$`P 5c500SR E@0pK0S %P @  0S @#S cD0 0P$DP (K u1`Kp  0@S 0 0 40  0S t帄帔 p  0#3Q0 |$ 0000@S  <P  <P 0#3Q0 # 000 q<P 0#3Q0 # 000 [<P 0#3Q0 \# 000H E<P 0 ><P 0#3Q0 " 0@00 0#3Q03 <P2 0#3Q0) " 000v10[#S `20@ R 80Pc 4 (K0 S S0 S S! 000R ;P 0#3Q0% ;P=Q7  ;P=Q6 d1d!d@00 d#D1 (K,! 0 000@S0 @CPP0 0 0P0 0 0ļTv lv i hv LȺtHu t t pt ,Ըs Xs 8s s s r r L( 0-PTL@P M@P$PPP \000|q $q 0-0@L@P I0000ص -LMR,x,ȟp ^ @0 P S 刀K+6pZ `\KP0s?0\ KP0   1UP  `/00K 4' ,' $' ' ' 0S A0K K K0 p P K  PZrr [0[BqQ Ru l [BqQ Rn k [BqQ Rg f [BqQ R` i [BqQ RY j [BqQ RG s [BqQ R t [BqQ R u [BqQ R4 p [BqQ RU o [BqQ RK n [BqQ RA m [BqQ R: x [BqQ R w [BqQ R v [BqQ R00K0V.:U# 0 0[Se`pXB<00`p0SoVV 0 0S~P00 0R(K0 ^P 0[  00K     30000K      30000K 00[`S  @n S L# 00   0[0S*W 0E A00 AUP`pP A0 0K A0[V00 0SP  p`P A00KA0[V0 u0[S V] `F, ἠ hA ]2p 0,@K0 h$e 0[40@ @ 0 0 @KV ` `( V& ̐ `V j[0P0 % ;0 g 0[mA0P0 V   ~0[0 WA`Y0p0;`p0 ``F  g`p`p`pC`p o d o o o , `j @\i 0-LˠM0 K 0-LM@P@Q  0ˠ0P K0@K0F"kp  ZP   -@L@0S`'@@Q*pPpPP ^N@@ZP  p ABdAT*`0000 p p pT84ȫ -`L`|@At0@P@T `0`0@T@@2<P00&v8(,Pv -pLp`@P @0@0S @@< U"@3*hX[P00]@@@u(xu@ -L$0 00( -`PLMP3P: 0SLp V "0 U@$K (K`pP ( 0 S@1㴑 Sb TL嘑!ap S @tp Ldp p R*G0C&S&<$#"3 ,  @p`눐 `tF; dK 6TA 0pd d \DD d  c c dR b < -BML M 4蔟0ğ       0P H4 0L 0 @4 +0H(P08  4L0 4廻P B^KCNK PE@D\ @g P 0S (400#S @d\ W P 0S 3c0``\ H P 0S 3c0``\ 9 P 0S 30  \ * 0P 0S H30\  0P 0S 303@E0 +62br,PK0`D%pD4 \  @P( 0S :PYY ;PD40S d;P` TL2LL0 $_U420P RCNKP@D\  PY 0S 100#S< \  P 0S 1a0`\  PPE 0S a`P;P p P;`!P X! T1TQ0P \  0P 0S q 10\ } 0P 0S d0  P$0 Q(K 00 00 00P0[ Xb XZ <pa 4a Dܤ o $_ _ h_ |^ D ^ ^ P t^ Ģ\L< 0-h@L@ 4P D`D`PP nx\ S @0-00LS iP PР 0-LPP 4@@;P MP00茠 0-LPP 4@@:P 6P000 0- @L@P0 000 -SL,M80 5@04 0 (K%0`004p P<  0@ H0 U 0|  0s0?S [S \S<0S U @p \0o  i0SD0 X /S D0U0Pp ^S!SL0 00T0  L   -`|pQpLP@ Q Pf@8 000pPKhKt P 0S 00 //HY -LLM700p0 0 XK00 PFf/@80XT0 R  |R:R  R  T0 :R|R  RT :0tFt0@ XT0KPT Xh0 @ XPTP$6P`  6PX00X0 W: XIP % X00X0PPK Xp<EP0@ X(0pP0 X00pl5P 0, ` X~pL5P 04 @Eh @XyP$$T150TV XcpP0  D@ X80Xp840 4P0 XK ``0d#PpKK,Ƞ!l0 80K BK:K.Ƞ&`0 <0KcKp@a6KK2KLpKD`Kd0 4K Xp6 P [R 3 0sqZ@;  X3K7K;K?KCKp㔐 L X`pP d X p㜐 P R H K@KXp   Hc4ꠐh XPlTGTU 0@1q00p`H#(Ẉ4K\pB K XC@Kmp0@P0t@5T0lAl1@X00Up00 0R(KX00X0(! ,00 XHp 0%[0  hT f Y̑HH H $ H H H  X<* H G G h|G x8 $G DF F F F hD <0F F E E E E E TxD WEVD -PPLB @T 2@0U /R> C B/QU0/T@/ PP@PP``; 00U&* CR0"  B/QU 0C C/R0U:` 0e@T@!LP@P@PPU:,P@PU0 0 @0 pt Tt -L MP@}2PX !@0 0 0   h! 0b0C SE<CBA@9>=<7:760 00Ko20`Sp! 00X 0S60"S ? *  2WV0(K0 VQP06 0 (Kx6" 0 ,  0-@PL> 0S 2@T 0/S0A 0C/RS0@/S@P;P 000T*0Q/S0A S  SC/R 0Sc4 @T@!@@q - ċ, 00-@PL@M4 KD TKL0 @0 <0 EKp K0S K0 -L`Pqcp@ Pp V U d 'p` V0@,> p  B1/R0 0b1/  BQ/R0 0bQ/  B/R 0b03/0p@-& Qoo @l\L\6 \P AO@@P$!/%1 0b l @L,$% ppPZ@l5$ `d& `D5&54 00@@P`L0& f :L1 160C-. o P!Qoo @l\PLlp@,\3 \0$!/ @@PP$!/E1PD 0b $5  Zl `> ( @>(>0 00  0L4 c:L55@ P@P k[{$0 {+C{7 Q/A0C0C A{ -LJ KhG{ Qp z -LJ Khgz p P-L ` Kh!400 ?0/R///R//?0S/R//P/R// -L8M0Q  $00w K0s KtQ 0-0PL  o9 -Lm# 0-LMPP P WP@Tt$ 㝿-\00,K0 0  : H@ Ȉ8 |00 R yR -000 0LQ4 Khvt p-L4M@00P0` 0 LKD00D0 L KQ Q Q "400 0RKp@0 딸 t,t,t,!,0@P/ P b/ -`LVpP! /@0JS  R@ D0JU R  RS0@0D@R-B0S0 0\ RN^0  S -LM'XP`aP`M (PH   'ppH 1/$!@ 0@aV0  Z(0(K8 40 'P408 8 40 '@P# 8 0`40P 00 '8 00@ 00 += `00  +0N3 0 l(0 -fML Ma`   Pp0 Y wpM 00CSK:@GKY>K 0C @5 D D 夡O^^K➡ PE5PETAXA\ASC>K E 5 5   pU  0 E E a@P`#P0&0 Q(KK A᣿p 6: S 2O0002 0 2 0 똴 L- 0   }̲ --L M0 0  K -- LM 0  N K - rL MR`@p R00?`d%"0 P @0P P0 000P1 1003^VP5 0 K4K#YP XI 40Y[VP0P0  i  0 001% (K4 ALP$ 0PiP^VP` C0PP 00%(K4 Y LP  0` LP 40l -KML MppŸ @ O` $ 0  G@ PRPcE V/P 10010@040 0R(K R f R1?00 UXRY2D 0 @F XRM>)V  D TDC>K4 04  c;0 V *0/S0IB 0C/R> V0hq =K 0C4 pԔY& -ۼp'10S4U ܔ0 S00S0 U P100D 4S ᥽p @0K0 A/0P0z4: S f100rួP ]1@@DOoBg_ <. - -@LM$(0S@ !0 # e 0S  0b`$0 QP!K00 0`VS <0`VPP 0(1/0 QP`p0#` 1T0`0#10`0 -L8MP00 `0 K@K08!r@L 0 H  1 S0 1 pp LKPp Dp P@ 0R K0 0@00U0@0뀫  0-@PL#P#0 0-LM00@P !R ! !R R20Kp5 p# 0P  0 l0 K0B! K0 R A  0QB 0 00P   0@00 0-@L'#P+#0 0 0-RL0 @T0l0 R00 0R0 YNP UNP QN<P MNK0hINeE -`4@L@(P幞$0PzKh谞4h 0-0@L@$P奞 0PzK0h蝞X4ȧh 0-8@L@,P咞(0P{Pኞ0 4|hA-M p1p!00P0@0S0   XQ 0`Sp@'  X 8$0@D 0X  A a  00bB "T ^ #R.S@8 CRЍ "T 0^ #R l@P@P 0s0 R 0@ 44  R  *4 8/ 0X\S 040:8 R РS /:xB -Lp`PL0L0@D尀 W   >l -LP`@5/0 M@-LH @ | \ -)+*)(%$|qP^ k OB5j?Q00000#Š,\Q \%Ao &Ao =Ao#4P 006 0 0  00  0000 b 00Es0d0W0Cs0 0-Q ^QM00#UI 0 `0@;UPcTtupq@dT5 1\  QQ-0 0SU.  <0@0v Uv =U Ur 0P0k00EQ00100C0`00ES0100C0U000N U U 00G,̰@ ` 401 0`S40000   70Es0 00Es0 20';U$ 40000 0!00C0PP 0AnS񏐳mS~}|{zyxhvutsrqpZnmlkjihgfedcba_]\A6YXW-UTSRQPO MLK G'E:000P0 00 00 00 00 0000| 00w00r00l00g00c00PEP0]100000R00N00A00PF00000   00E70Es004X  0W0Cs000'00# 00dTP,X! T!  @ -LM`< @,pKB1K'1KPU, 080 0  0S80@DV& 10[0T@D 10[`0F8 ,08 0(K,0 0(K  ;P T 0< 0 b,0 0T@D 10[`0F0  00  ͷ8# -A`@LPPh !6"#12b! bAqT@ 0S$ V2 10 R 1003/P= p$` n$00@!  R 2/(!T 000(YF10@03/P TSU  00 R   R  T p0$` 0U0 0S@HP00Li/>3hd&$&th%h|%! = -A`@ LPPg !6#3b!b bAqT@ 0S$ V2 10 R 1003/P= p$` #00@! R 2/(!T 000(E10@03/P TSU  00 R  R  T p0$` X0U0 0S|GP0 0$gf@$$Pf#eX#l -PPL`o 2'pPl 聟@Ti  00Rc<!"#b!0bqAWG X (PXJ $00\10 R R#<1003/P0 0 $000!  R 2/ W 000(1EPp0003/P 00  00 Rt   R  0S@FP00 @d/>3Xd!!c0!lc = -PPL`n &pPk 䁟 @Th  00Rc<!#b!b0bqAWG X 'PXJ $00\10 R "<1003/P0 0 $000! R 2/ W 000(DPp0003/P 00  00 Rt  R  $0S`FP0 $0 @b bLa4a SR-Lp`P4 000S 3/0Y @IOP H T 00 00 Y @IOP oH T L00 @ @0 0p`P``,``__X SR-Lp`P5 000S 3/00 Y @IP 9H T 00 00  Y @IP &H T L00 @ @0 0$ p`P@__^^^4 -@PLP Q P@`\ P`V )0@"SPK 0C0C/Qh 8 r/- Qp  /RR.Q'  e   hRl h"0 h0᷵pL (* R  R/AoPn@/Q  hQ .PQU 0t/S0V8 L8傎K He0\!8 wP  $  P2  !8/Q0#8 /@hԘ+)00FGP(K@U/000@0(K)?0U0/000@0 BPP X U)?00)>00(00(00(0P0 -(a@PL`3 $0QP0BP6 0 0^ @:^0 S \S 0@ S @ 0:S@ P0P F 800( 0 0PpZYY@-0P:P\\ @0\ \:R^0@S\@^ :R^:^ 00/ 0-A^  R:^|^^\ S C|S0 0:SS -EMLMǟ @h P4 0 Tl p T$ 0 X4 gT `G@PU P  B`P T40S \$ ' `$ C.KH$ PP0 00H$@p:Q9 \Qp Q Qpp pP U*`R @ Q W :Q +HPPH4@ Q@W PFp h L$ EDPPhL$ PZ `Zp`j #QQ`XL$ OP\500S 0t4 p5L 0X4 =K`4 B>K 0C 0Cd4 = XpP  :S 0PS 0p00`P4T$dGpGPg8@ pP p 0:R@ @ Raa00S:S:00j 0fZ|0 eH4  H48C `Ep]L$`HD`$0 00$ PT40PP4 0\4 /\4PS$UZP0`P4 T$0ST$ LEPHE\4S %' 00Ph40 0R(KPiPf@ APt (@0`\4 Lt4 \4S3hp$0A V0&:l4t4PP00PXL4 c  [CL4P`cpcPcD L `pPot X:00h0t4 .LCCP5 PP\4@S PLDP@DX4C~K@4 X"pG< mK P0 5/p5 P. 84PU4$0 B@4 <$ D\4S&8D& 0P0r2"p PE|@_o`PR& 803/Pp4pl4`YP03/TPPıyp&@Dl&@Fi&@De&P@?03/^& 0P07ꨈ W Dtq 0-LM  0K K 0-<@L@ P 30 0 00   0OO -ML MlSl3l#P0 D8 0 ^00 0HC0@ 0H S@ 8 ((C(s(c( @p`P  R K A A  P 8( B8Qi " "# :\ #\ RU RR00S\S00 Q}CNKp\b^K PE` PE0S6\S4 00S0 :S: 0 088 Sb04[KS Ah |S:Sh  A:S|S 00S 0@(AHb0S@AD800 QO(K P 880pC P\R    ~ 0S JPP x PP P ?P  m P P ^# 8 0hP A A.K XH xOTO$O OOO HN 0-@PLK0h -L@= P d?`P d: p0:SS ^S! \S0% \PfdAP 0`:SSd00f\PA uAPx 00S:S 00Q:Q 00As^0Aq^b10Nq^1Y0B0A2SIFBF=8CBA@?>=,;:9%7543210/.-,+*)&"&#"!   00@p 00@| 00@xur0mB00$ 0 z -LP= pP. db>P, pG`d 0:SS  R0@fd@P `d fR@A @P 0hB00C$ 0 0-L@# P# 00S   <, 00Bs QaPBUA0BW0BS70B^00 XR  0 -BMLM030ß0 8 ^@`p0 v /< PP7 Pܒ  :#00CS Uc C K0:S # 00840 0R}(K $P CK0S:SR 0S:SYi 0i@4 0@$<  RD E D4 彮D4@$㸮t 㳮0:S Z#0S#00UP R0 00 R!0100@M@ ᭮ 0@$ 0C.KH$ ;@$/@4H$, K0<$C D,0K0$CPK0@4 (00w  L , | X 0 00 ht -0-L M0@ 0R 0 P0 00\100M0 S P0 0S0,00 L 0RK04t  40-L)q @@80 B -L4MŸ @`p P0 ϑ20 RA dKD0K S qP T66T3OC 0 7P0* 3 3p]WW 4t` `pPM3@03 @ T t `P pP3#[ 3@03 % ,P csc3 #0 # 尐 P P 3~33+& #0 #  P@ T0s `#@`F tV#0 # P @3  0  TP T0F Sl#?K `# V @3 # [0C s pS  S   EPR[j}i<(U90P0CS00V  @PY %0NSp0ASk >> ::5 . )U o_UP 0s@DSP1*T T0@003@T; 33 K #0 # 000S 3#0bS303 3V`@ P03 3?K 03 # 3 ?K3 C?K3 s 0oVP0sC 3S#0303 Q0FSP1a`?K̃ pc3 MP3 +@MQpnlk]\`_^]\[ZPONMLKSRQPONMLKJIHGFEDCA@?>=<;:0/.-,+3210/.-,+*)('&%$#  #S`L 00CS0000PU  3 VM#``Vp̃c 5S XRo   d0#X  #0 # #3 # #0b303 VL`  M@ @@H``+ E  P BR 3V1 @PNU; 60U IUx P BR V @PY4 0S 4 0SYY0p0CSP0P  PV @Y0`3 EQ  0`# 3S  P BR [V  pP+Ej @0V  @pPVP 0P0CS0P0P0CS00V  P0p@3 3S P/P3S3S 3[ BR0 x V 0P@` P BR zVr p@P XR. 03 P pc ̃3PQ 3S fPP-  P BR Xb 0Pp3 @R3(3@PC 0 P0#0C00 00`V0 0S =P 3 3@d S 0P 0@ B0V 0 R P `#0 # 0#t0C 3 23iU nUA P BR : V P@`S~ 0`a #0 # {U 0 s B0,0K0 P C0 ᵾpp P p RPPP3S`F@pp0`0p3 PpUC @s 3P@D uTP KG#0 # Eo  k #0 # PL\ Q Pp@0sCp p@3@0C0s@ P BR X V > 0P@3 #S- C# Sl'0s pK0`@s00p3 PP 3[ BR0 Qp{s0pPpPP0s PE C @Ts -@s00P3 -@P`pLi 0 Pj - 0   M (2p-0L`@y "00S7 @ 0Pu 1S010` S00vpP1 0S@0P P5PL 0  0 P0@0`@000 m9 '3P1 ; BA@ ?#0 0Q0  Q*0RW! 08 @ < B`0 J P00P0s0 pp0 B0  M 0-@PL  P 0 -L@`pPtt l尀 3T  @0 f$  K X  0أ -d7L0[Mx1 P7Z0@|1 0L 00 0p@1 01 c z Pi40Ph1  b`a40Pp1 m 0SD1 01 l 91 @ MK 1U' haPU`p T U 1 # 0ᙼ0P?0Sq PgP@0PU0p`h1PcEQ U P!@181 `40Pl1  0K t1 1S V 81l! BSl1  h% 0S 00S  <% 0S 00S 00 00 00 "00@\000tp0' U+ haplPU& 0 7/P0P0l 6p6h66|10 0R(K1S@AVt p tppPPpL1d S 0SX1  vd1SP> p1 p\! 匑 TZ ` \1@a 0`1 S?KTq 1T C cSK:`_` p`p`RQ@" R*@@aTq\1PX1\Q U*d1p0Sd1 D10D1 !0RQDl00@5p5h5@`@aXQu* 03>10 @@,@L R% %< R8 R$ \ R , \   0  \XH0 =H0 ,H0 8H0Q @PR  B8 ,  \  %H0 00  LPYPH0T Z ,0 X  T 0  b0S 0.S4T0S,0 00 XSX00CX0 0X 0d0S `0XSYD0L0S,0 XP`0S0D 5&`W @?.T4 `,0D<%,0(K00 00`*.0 d <  80 ,0\ 0D, B/P S  0 X0    D`H`@@Qoo@b b8 m 8 0d < \ (0SXF  (KoS0D@504$0D4 @ 8jPM .D d 505,0 0< Q 0\ S  0b00Q0  R   a   R 0L \RF}D 0$0XD0 \0@08(PG  ] \ z ,0< 0d l -0L MPp04+@Pk `PV(,P  P  UP1RP UZ+ 7`Pmt0 ,Pb 0PL0U 0` ``PU#  0PD  ,PPA 0,\L0  P05YV00P0P 0P `PUYX003x!, |P 0, ` 5; X -(KP `UP1V 00V P,U ,,@,(K  `0 ,BP@00(KXp,00,0 0,(P `  , < 0-SLP %.L R.0@T@,L0S,P @,TP ,,,@ ,@嶚p` 徙,(帙0@bp尙|,W Z@p -PLU ,,5S S+ %RE ` ^,L0SA 5SePU@`T`N,L0s  ,0 @L0S,0@ $0S005`5 CRS@T d!WVO 5P @$,T05S,P9P0 \`,  /2P V P p 0p$ !@S /0, 0B\00 0\ s@P   ,@+TP,0 5 5 @005v,0@sp2@08 6Pj ,0<,0lf,0@(™Pr(˘U zP5 S(忘b0 @8P@ d @5 0T$ 5 0   0S喙P,  ,PP 05s]0S\d,0<,0,0 np(! 505,0 _p($ 505<+ @@0 0 | 0 $ 5 P(V P,0<,0  0%$0 4 \ L d  R-0L%  0  -LL`PEp @,0<E% R0 RP @*T V` L0S00/S ,0@ 0,0`<,0L0S  pp@0 P 0  0 0ݗ0 -x0x 0PL0@S0`0 0S ({( {(**Kh軗({\ -LBMxx R  ``  T ANK  Ph#      0- L -LMŸb @`P~ M RF Ÿ r"nKpP o0  0RKBX"B^K0 `Yp 0 B^K. p!0   t   Ű100! 08 ,( ( 7P(,(08 \ pAL+\ -<+*)>'&%$#"4   pp \WcpppppWDOQ{X 4 ,  ! p ̢ d0 , 0-@LPP T0 ,00#:k0cS0:5 A 0 - -0L\Mp@ t0 lP Kxp 0-S,} 0S00  0p0S@ XK (K00 x 0S 0S    0 C R` @T0`@TЁ00C x 0@0C P^  EPD00z xp0x0 0+Sz -S 00 0x0 00C Pxp P-0Sxx 00S 1CP!x0PC0 x 00C \x QP00PE0C \lP UP PPPex N00 PY jT @Y ppg{ WPn{ ڐ0fk01[kk Y 0g0S { !k{'{ 000 02P U00e0 ?@۟ ˟0 @??5?tN$cQ`a010 00  W0 0` `V0S c`cpc0S @P t#0P0  tr0t0 Z tPt w 0S fPPo VPPh W@Pa t7P\ 0  0P  Zh 3hc `Vi jVQ {Njȋ:S⋟ HZH{+S+S k0flK)K )Kk+Ckk h d30SQ t   PP   ! dKpK Pt  @P p0S  d`p c0a00C pS6`fI00 00 M  R-I0C%S)'&%$q"!  fQ Z C ZH{kWkW PkG {7 0h+S ^0XS xS x 00S S  ?Zl0Sh 46S 10kS0S0S=Ph ڈ0S00t kSr7St`^\ ZXl0 0 00 +{  h L00S"00 0S xp?A?P9P \0P Yx0P x T 0 0C P P0 x0 S  0IS1`YЁYRY x0x0Ձx 0@P 41l h0 Y t }"00  c10 El0hST S. 1܋K K5LlK+Ch U{{ { h 3`0S\t3 Rf `3l h0 0  aMS#2Sh #{ k0{'S P{ h 5&Bh k{{'{ 2h"0S&BS256 h0 0l 0 46S  ^H{^ C+S\42EM40S x 0 0S 1CPy 25&h Dx@K9P x00(SN 1l h0 x@K)P x00Cx0 Px0l 0x0 t1h0 {{ZG8l0S46S={NjZt! ̋J-{NjPBU Uʸ0{0Q 'P0P@0t0Kp KxK00@ SU0xp 0 ??5?55?||4 4 ,  |$ 0c $ [ !k{{ C2 S  Sj0ӈ0 ըj {  k{'0 0Q{ S{@{@P 0&K00 \t d`KR t0p lKD lR @! jR"*k b"R xSr   l h trpn lj0SZh0 $&R Rl0  ZlK+ { 7 0sZ#$&R lQx0a` B2%0iUiʘ2i0Pi {1{' 'b{@ 7@  z uS2k0QC{ h  30#:k0cSaS,4Sl 76 0C#h0 h US AQ`d KHP`0d 46h0 l 6C#: :l h0 u fx0C 0l 3l0 - 0 0 )& -LM 0K0 0K P 00CS  \01: K00 4%0;0G" 0 h  0 0  R 0Q`@//0Q/0S S//0@-PP0@ S 0\\0 00@"! -` BV"R LM4 0 poP@P-Tp +T@P0? Ɵ 0 K 0p8  `DK0 ,(0 ?0Np QaNPWNANP!7NZ| SRP \ "00 00T. VR? p$K `4P\Q8 r00Q) 0\E(K00 0R, (K0P@40 00XS00 C R @ 2Pp$K` A BRVs 2p$K`y 㙙 0 0 0@= -`L,M BV"RP < PppP@RP-T +T 0  ?$K$K$Kp 0K8 XNYX8^ \DԃKK ,4PΟK@0D~ ZaD^WDAD^67D^3| ԃKW RYX8^ \ ԃKK ,4ΟK$K"0 01#K$K$K"0 01#K$K<0S] \<0PPPEP#K(K0< 0R\ P00(K/o"0T4 RS  `KSl $K$K 0phj0P@W/o0"P@0  ?$K$KX 0 0fXQ0A P @PK`#K A@PR `KS 0 0 0 -@PLM`1UTp$  0S*$ P @ 0pKTT0pK@$*"0K@#0pK@01-0 001-|01- 0 001- ~<0.w0 00.o0. g0 00. ^0.W0 00.O|0. G0 00. ><0.70 00./0. '0 00. 02-0 002-|02- 0 002- <0.0 00.0. 0 00. ޿P8,/ݿ,0, 0 P8</пlP,,/ſ,0, 0 P,</⸿  -p`P@L@ P @ TPbO -T0T 00`p@PL@ P @ TPbOt 0-@LP( P 4 P 0b0 0-T0T 00@LP( P 4 P 0b0 0-@QL0  K0h@000 0 0  0Q0-L@ P0A0K0h/00 P-0L  @0P-0L$ 0߾ d -@QLp Q P`@T o Q þ 0 0  -LHML@KP`pP 0P Kf3P0P0p0 ኿K -#MLMxax1`p00P00 @PN H1 `0 S  P(/ p뎮K J  ?P% P P$P wPP0 0R%(K P 8 P PP0PS @P([p(P½ \{ H{ -L`X@pP  @P0 0`0`` -LMK@Jp 0: S  ͌p  _0Kz 0 K0K -L,M@P@ 0 p /$0+80 `k040 00U00|#S D 8  L0 e0XH0 0<0 P@ T  P@ PdP0 0000 zp P @` TP&0S<0SC40S^8000 ,  0j P ` U\*QY0  0Q @@ d P 1ZPPFPP00 00PjP@008 p$ @(K L0 00H00SH0 (K0@`P I 0 0!80080  @pp00 (KP@ D0 0  `01PU `80040 0S  Z  P P0 0S40S 0  00P { 0-PL  P @T0 00  {\  l 010/  C. *     -L(MR@`p p8K0,@ 08 K@PKPD0K⬿ P@ 0D $K  t t  h00 5CS A/0c#:S 0CS 00c3 A/'R A/ -QL M@4 0 ` 40PcpT1* 6/P Z T :000S00 40(K -RLLMl @00 aQB p0 0P`0 T 0T80 #@alP0p0`@0  0`p0 00\ 7/P00U@40 v*0 hpc0hH <0 80@ 0RD0 3T Xp PL@ P0 0`4p PX @6/PP Y L@P`TXpD0S01p1P1 *<0 003/P40P l S`0 b 0 P  T:@80`V:40pS h 0 P  T:@0S@l 0b` 0 @0S400#40 ` \000Q lP00T0 0h ` P0 `\h 00Qt0 C d0 X < X0\ 000h`S a D o @000X0 0a0@0 D @Z00#03TZ1*00 3/P0040 P0` pD `p@Si8 H@ 0@44/YZW pX8H@ZT0 S < 0W000S@< 4`8`lD 0i0\ @ 0 P H0@Tn* l@00 ` p00 h@ l0` S `@(Kh003/PG0\ 0 P08H@P0  X E8 H@ @pLP 4P0@W1P8/Z p LP8 UH@e p!*pH@ @48 婐 003/X p @ U:q<0 W <0 0C T <00<0 6 8H@LPeY.080 0p p(003/40Sp080 80 gYZ pT0BSJ< 0W@0 00S< 008 3/40S8  0pP0 T7*T0SE0< P@ 000< 00<0 \0X Sd 00d0 t0` p0 S\ 5 h0` `0 h <0 W <0 0C Z <00<0 @S T0< S0D\0D <0@0C Z <0 @d0<0 D \ R0 00X D B\D0a<00<0 l0` h0 l0Sh@p ``@ @(KV@00(K40S (D 4P`8`l - pLW` AP UT 0RPP !p  0-L0L 00L0@SK0h(kP(k0\ p-L M @PT@T T 0R  ```0 P 0 RKpSR p-L M@`P0S.$0010 0`   P# 0 00aR00  S R 0S$0KpQ$0Kp 0-T0T 00L0@SK0h("kP(k0\ -LP`@wpu0 0 0S (kP   (j]0SYp wP   L0S P(jC0S?p:h\  0-LM@K $P`$ 0 )0p PP$K⊹p@@ K0 S@pK -d`DBLQ_ne ge_Be MPn\ApP( RdPHX-( 0Rd$KU00ì?dPER ?\00S2 T *0- L  0R C= S@X !0e 4K[!4K?%?C RT*40[S0 0 R V@L 4K 0  9T*40[S0 0 R S@X 8 4K0e ꂷQ c Pt (t s \s -LϟM @ 0x 0 0\ 0 p|0 W @00J\ %\@z\ MKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   Qg %<Tl6@Jx00 0 R<(K 0SntKtPK7 K0 SR[ ^0 QPL 0P?  0S   =010-0C?o2hS W 0S0 0 R  Sd0,Ϡ ,l| P"n"bl!A #+  HK0S|  1 W0S0 0 R S0\ S| 0  W0S0 0 R W0p L|000p0 0|000p0 0.@  a bP0` @p ?dP#/bS#b0bSP*9PP@* 00d#/L!b!b b B`pVVA1?#c b p)dp` R)Π`YR#L `3c.0c0 Y(HPK0 H WPH0[S0L 0 R F SB 8HPK2?0c01R( 0 * W2H0[S0. 0 R ( W$4(HPK0  WH0[S0 0 R  W |000p0 0'HPK0  WH0[S0 0 R W|0P00p0 00 0 bX7HPK2? B1c& Ø WH0[S0 0 R S 0R  B0 b6HPK2? B1cx& 㡘 WH0[S0 0 R W| 0  pp0 p Q0S _ W{0S0v 0 R p Wl0hS|   Wc0S0^ 0 R X WT0  S| 0  WJ0S0E 0 R ? W;|, K0H" 0  pt0S 0t  R 0"L$HPK 0  WH0[S0 0 R  W #HPK 0  WH0[S0 0 R W0#HPK0  WH0[S0 0 R S@#HPK0 ˗ WH0[S0 0 R S 2HPK2?0c01R" 0 㭗 WH0[S0 0 R S0p"HPK0 㕗 WH0[S0 0 R S W 0  W  ʅ0 S|00Ř W|0S0w 0 R q Sm| 0  pB`tKtK*4!HPK E WMH0[S0I 0 R B S> W< 0  W  ʅ30 SHPK0  W(H0[S0$ 0+T QK ] @M L < ; ml *k ,k 8 j L8 i di F LF $g dU U T 0T 4e R ` Q `_ ln`$IųN _ $N  R S|0X00p0 0 HPK0 Ԗ WH0[S0 0 R S|, K0H" 0  pt0S 0t  R 00 H00p pQ1 00@pV\E g\ 0p 1 b0/C1b@p00 p00 vd00"Ϡ <"lH P"n"bl!A #l"HPK TH0[S00X R T WP"HPK @ WHH0[S0D 0 R > S: `ꐲ -@pLM$K!`0` (0耟SPV0d0$KP 0 簀[Q ἖0# ^(0Q Q \ S BQ< K, EhM M M M M M -L M @@KL -`pPL M0@,@0   K -@P` MLpp0 p K`0R@-0 P@0P R 0@0@0T cp,A-P^` @T@0S^ p \ 0T0US@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0 ^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S   @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R 0 R   S0 @ R @ 0Q Pv Q 0Q  S  0 @ Q @ ^_0 j00@-S  R 0 Rp  R| @P QJ  @0 PS0 0S0 0R 0S R S \ ^ @ @0 S 0 00\ ^ Q)  @^ P 0S0 0R \0\ S0 00Q0Q  S00 0 00 A-P^` @T@0S ^p   \ 0T 0US@  U@@ S @ @\ 0 0SW@% @Q   R 0 \00 00 R QmQ ^ 0 ^ 0S\0^- 0S  R0 R(  R QQ  R  000S0  0S 0 0\  0 S  @Q   R 0 \00 00 ^p \{ 0Uv p0000S0  0S 0+ 0 \0 R P R  0 R  S0@ R@0Q PvQ 0 Q   S  0@ Q@ ^_0 j0p@-S :Q:y  R 0 R R| 0  @P\J @0PS0  0S 0 0R 0S  R \ \ ^@@ 0S0p^ `V- ^ 0. @^P  \ 0 R00 0\ 0 \  ^0  0p@@`Q 0 Q  `V0  0 000 0A-P^` @T@0S^ p \ 0T0US@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0 ^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S   @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R 0 R   S0 @ R @ 0Q Pv Q 0Q  S  0 @ Q @ ^_0 j0p@-S R 0SQp  R| @P QJ  @0 PS0 0S0 0R 0S R S \ ^ @ @0 S0 p^ `V- ^ 0.  @^ P \0 R00 0\0\ S0 0p @ @ `Q0Q `S0 0 000 0 -LM@< P A  pjpG002 Z :z/`000 P00 2ie14 80  E liA002 \ :0  UU 4  R8  X P 1`1p1:<0 p`(K} -L@`Pp H{ B{ <{ Kh4{ -0@P@`L^$0$P0Kh^{ R 0S/0S PQ 0Q  0-0( ,0<à 1Qa 1 $  Q 0^ 0 01 $ $ 0{ -L$M4$d0P`0 Q0 0 0R'(KDt@p0 8/$0@ 4/10dS@T4T$020 S@4030S040,4/$$$4 4 0R@ 4050S3#060 S# 3070S305`K4/@ 308pß4K7?A1c1pG0q0Bt3t#t0 8/ ``30X<0ß04pK8?A1cx1H0硁0Bsp  09/4  0p5K4K7/ 20pŸ@4K9?A1c1I 0硑0B2"0 7/ tt20lpDŸ4K8?A1c10H0硁0B(2("(0 7/20 Hp`4K7?A1c10G0q0B10 6/!1 0ఁ`((4pK /C1b10@00DlAl!l@0 6/X0 @D4/810 0! ( 10&ꌪ넦 `zM x34 r 4 4 l yd4 ye 4 |y24 4 Pyg 3 0y o y3 82xP gfffL @q 3 1dx K p 3 @13 w0 J p 2 0Dw lJ o 82 ,0v@ I 1 // I pj p1 @/T1 4% `0 $F \0 -LXM@Pp `@,:0p @P P0" TT  QKzp`@K@ H0PK@0@0 5/00010S 0p -pl H/ s 0-0L LrP$ P(0pppP\ `p 8z(@H0@@dU@/zXLP@j\p@lPd\U <@@t0PP0P PpPl0Xs(sr 0-tP?@PLE\l?@p 0R@!:D  l0<7\0Pl0@ @@rrr -@PRLPx!\HX] T:(L0sS `P\PpJ y(`PppyXLP[00W7 100S( PP0S  R$ 0SU 0W@S*D0W SP *7`[ Vx[PP[pPUP0S ` p90S0S pPVPD00Hz800 pPtqqqpHpooxo -L M1a0,p00 S`P16  YE @ Y@ Y@00ST% 0P80P$ ~Y-X1\\00P0S PU 0 000`G0(K@0PG0(KlppH@P `0!0fP`0 0$0~P,p o omm -L MQ0 P0 0`$pPN Z0@0T 0 $P `* ZP10``T*@ QdQ,$($@V P@  ഐ T*QdD`fQ "$(, $@ TP:d00 00q(KL0@CD0D0 4/10S0(Kmxllk$? H' -MLM0x08p,H0@$XP4 @0P00 wZ`V C>K 0CC` 0CD$ @ 8 `` H 0p0800`0?oP'0c ,07倧0T4 x7x0X4 p7@0\4 0ESt  S@70@T 0S 7`$000 S70 $P$6 0,D 2! `!AQ@@ B2.   @4N.2 @t@013<00B0H (DP H0P0꘤뼋 _L_8_^^|V  ^ -L(@,@ Pd0325Pa pQ0i0$5H100U0s; ,100W*q$0s) ` 0R0U0P5S4003 R( P H2 @p$ 00D  t    $0偑0Pc p 0ₑaბH,Ko |],] ]\ -rLp(P@0PT , c1$P`U eR20Sp  ZV 0GebWk W020't0W00P20 PSR  ZoV K1WR_0BT@5!0@0 0S0) SF $KkOVxMVPU 0SPU Rt0@牡l0l0 4/!R~TR 4P/0$0  00` KDKPU`g!P %P P EP` P 0D @0 4ZP ?HP WP0 !IP VP9  0 K0&Pr )Pm 'P (P 0D @0 .P] P P P 0D @0 0\ K00DKd0K⼒p \0S0yP 4ڤ8PV ?CP 0P 0D @0 0\ K00DKd0K✒p \0K0=P :P 0;P <P0$ 00` KDKSP`\P ]P ^P7@P?P B0D @0  0D @0 0$t 00` KDK-P 0$D 00` KDK P>  0D @0 R <0 D @ ` z 0D @0 uEPn FP GPH0J.P2 +0P;D?Po hP` P8 0D @0 xP Pd00 P* 0D @0 j P P P0D0 @0 _ #Pq j$Pb %P ,0D @0 Q 0 P P 0D @0 EP\ P 0D @0 l5P 0P0$P 00` KDKP XP YP<*P +P D0D @0 P P &0D @0 6P 7P0$ 00` KDKvP 00AP# BP P0D @0   0D @0  0D @0  0D @0 DK`PD0 0D @0  0D @0  <0D @0  0D @0  0D @0  0D @0 0D0 @  E0D @0  @0 D  (0D @0 S`0X0$ 00` KDKP y 0D @0 0$ 00` KDKP f2P{  0KP #\ KDKD @ @2p\0h C0D @0 = F0D @0 7 G0D @0 20$ 00` KDKPj 10$ 00` KDKP $0$ 00` KDKP  %0D @0 DK_PJ  0D @0  0D @0  0D @0 0 @00\ Kd0KDKd@ D @ 奐p EK? $0 +0D @0  )0D @0  *0D @0 i \ |  l h))  -`LpAV^ A@0S @PF W`U l 0SC PPA XpL @ 0S? P" V ! 00S1@0@W 0 0 P PX 0 0 [AT T 00UU |JA PT T  W@XP&t&D&t%0 0-L%A0@T 03/@T_PP |00@T 03/@TX A0H00@T 03/@T$@0|8@ -LMX@@P K 0K # K  嫏pK#0c/ 0-P8LP@04 02P*T 00S84 0`@2T:;0800 -LM2Ÿ0 P@R0p`00 Y 00Sx80S 00 Q(K4P  P8 `0 㔐K! 40 0 Ġ0`☠K8 0 0 C R( P28XH 21,à40 0` m4`V 08P@  R88PX`08A@ `8 `08 8 81"# Q00 0 R  0 vP8 ` 0 0P  8v 0 0l0 n`8j0`8bm/ ,` -LM@,ʟ, DB 82 @ 0T`H <" 0 02 : @T4 0 4SS90T, 01K1KMP.00 1KRK V 0S?KwK$2 (20SC0!QP<PPU= Z| oK c/Kc/ 2!^KX 1l Z`k V 0S [P PfU> 0 ,0KP01E $ Z?K0/KS  00SAP80S(2 1 40S,2 W @(24 ,b B X``G U T   P@,24T 5*(2@ZoKBCU 0"Rc/ Ⴭ0!^KX 1 ZI820"SRg0BT *<"R0 00"00@20 0 R(K 820"SR0BT  <2Se00 c/KE I Pl820"SRc0BT 820"SR$0bV <2S H"R  !<2D2S D2PU @@ `  c/KoK` 0S% 80S 04@oK@B ` 2 B 4`ㅯK1 !^K p 0Zp "R4"0 ` lh4@04@Y@T8   0RZ @PYX 20S"8\f PP 20S @820"SRc0BT wKJ<2S?00  !Kp 80S(2 820"SRr0BT +<2S00<2S0<"0{00( (0R Y``B@+@ T" ~"@`[0 Sh ((\J P 20SX P@ wK6YP 2 `0 R(PXPR @X`PU 00SxA @408p=@ `D2P` ` 8PPPS44000080\S80 \P `0=Y P@ >820"SR 0BT |<2SV@ ֊-  ܻ$L, -P`pT@L@M`@ O=0 00LPD=(K萶 -@LMQP4 @$ 0嘀嘠 p@4`0 0 Y`P` T00 0   &nP030#?@ 04 0(K(Kd X -LM @#^K` <0 IP  Xp0 0RE(K :P 0@0S# S/ 03^K  mP 0V:0%  0| 3^K0 mP 00S3^KP0 P 00SH! t  -IML4Mdğd @`P Pp0 P 0S SJK  P0 0R(K JKR JKRU# JK A  0J-K0K B,J0: J=K#J0C0 ? s0]m X0S*PSU S0S0S  0S0s S0S 00 0WXP 0PJ=K0C0@ 0Pi PJ-K<0J B08 8 0|tI-KJ=KJ K, B 0C@ B0P 0S*J=K 0C  QJ=K 0C0S 083?"R   #<1J-K 0 :K,0C  J=K I=K,0C 0C0 k0@S03K41Ky0MKϿH1  0K{N/KO?K  L1 ZP81Z!0 0R8(KV  P p EP 0X41K31K<L A QH/r QX  R H1 ҥPH1 t  -@P`p 0L0 u 0P 0-LMPK@NP"P 00S R Q RP "/PK0@PP@@ 0-PLp@p@00. AASq0C .S .RQ P _SQ P-S /S /p@-0 SV RR @\Q ^@ S@@Tc RL DPD0UPQ Uc 0S8 DPD U! R' @ @0R-"\\(^\ʔ 0 0 0R0b?o20S 0RpT R DPD@U pR 00- pR ^S PU 0S0S U 0S D`D V PU R0S 0SA-`d1 M#2`  P 000  0S  RplA ᶀhq( R  d1`#VP0000 Ѝ 00-SLP0 0@O0@ T @K0hD p-L M0PS `@K`$` $@0S  0S 0STKpKp -MLDMD3Dß0PQ KHLK08L@00 0(KL B0(KD B02(K0P BhK00`F(Kp1< B0"1K0@A020S? 0PT p20Sq K<A1!j 01h(0000 `   (K8 B  P8K80C FI0(K8 B 08KH0C000Qc(K 8D P0 K@A0 08 z P 0?s0S 0(KD B0PU8KL0C0S8KD0C0S S S# H0 0 8KP0C(KL B 0(KL B0L0C H8KD0C0 0H0 0H0 01  @ -AMLM ` pQ 0 P @P+BK @@0p Ph 0 0R(Kp0 RP @@ .RBK JJ  ,0K Pt@H00  ` -0LS S0S2  R  R R R0 S 0/ 0 0S S S S S00 00S0 S000S00 00 p-LMPQ@`  R R Kp RRR Kp Kp00 NP00PpV0S S p  0`  R R8, K| P 00 < H 0-@LᧄP0 -L$M1!0P P@0 G P6 0LK `V( pD[,<0P@*,0S$  Q DK;S  S0S P 0S @Q `V 0 0R(K Rp`V `L < 8 H D @ 4 K`KLK:K9K Rpԃp P/ 00/<  0-@LPP U@0 0-@L |Pt  0 @ 00 -L@`pPP  00 0   0  -LLM@p`828"0 h 0 @0 D@ l PPP0S S! A@@@S P@h00 0Rc(KT S@ K p Pp 0 @@PA@@@@0K p0 APp0 RQ P@D 2 0 pP(0 lpP 00SP0SQ dP@D  0 jpP0 lpP 3PP00S| | -LMp烟K 8  _K2 0 OK  |ZW20 0R.(KX' 0S ` QpP 0"00S0S0S0;0SU^ >.0S` 0K hb0?K2 V 0 `P`R P`H=崢 02 <=尢02 0= 02 $=r 02 Ă 帒 ?K 0f0 0F1  "Vpp1Lh2S    "S RBd"R ; RQ8` PO 1 P\,/oShb Q" Rd P2P` S 2 wPhQ Q 2 @0Q  R0" 0S" `Vp2崢SrĂ帒 p2"0V0h2 WZ l20`:*02 W? 2 ?KԢ ̢P̂ " b r ЀPUU 0e8ec 0E9c0 0 h2Sd2 S  RS`P  QP?oR20Sd" 00P0PS` 2 ,R PR  2S  R 0S" "0h RPP2 Pdh"Ra R 2@R 0SVST 0"S`\ %b0P2 V r᪁0P2 A "0 g"p0P2 82`V4 2K p/K  R `V" 0S @R9  R- R9 0 0P R(,"R% R"P긒`B @R2S `Ḓ7200"e RPP 帒`  R`bp2  S R̂@ S| X " P@PTU 122 0P2 ; ,0K @@hB"\f?K`"  2 P,P(p2 R"  2S B50 㰒`0'K 0 P004p2]P @@2 ΁P@,rH`pW *H HF`ۼ2W@0吢 :P>Ph4b02 2@U?K2 Q?Kp2 尒 S  U@ [pD|p(2Sp0uK $ 2 r 0"ғ 2 t$ "(PP"MOP50D, Kl" 2 PP2pD)2 2|0T S# SpP*0030 03P(2S O0SWDpqW0S:Q lrp  `P 20P2 Ḓb `P  22` "2 "c? 0!1@0 KM@PPM KJI02 ,P 02 02 ,RU0 7S "0 R PU* 0S0020P2 ``r.>"  OPkD1x00x0e2@0,2"002 V?  1  Z D(( D~ H @ Ii  0db 0V-l2 c Kp ,P R B 0@P R   Bq bPD 0p  Rp0S R R R0 T @>PLK p0KL KL Ppp pZ 000 Zp0S 0PP0SX T P(Kf f -L\MPpK@gP0(Kpl`K @00tKxK Žp0 gP P0S00A 0 x`Px)᧽p tKxK0 zgP xLKLKxH >P P ``0SЇ < -0MLM K@0Ÿ K0,NSp0 PK*K, B$A K*K0 BA `"K A P"KLb (A `* K@b Pq 0#S] =K 0C=PW =K(0CP=PO PL 0SI @ P]P Z> 0S; S S  =T @0P ]P+ K$L$L=K$0C(0L$ L $ {P(X1X) 000  P =K$0C0(=K0C00a-K B P0n=K,0C00 0R(K=K$0C0(.} ` pP=K0C00 O  PP5pP &0-K$ B =K40C$&,K0 B S $P $YM=K@ 40C R 4Y=K$0C0S 4S p=K(0C03/Px> 0 =K<0C@.RD@ⷾ 0$$ 4(p@ %K=K&,Kp@,A00C B(A0 %c&K `1 /8W00T1 lP X0 tP 4 @@0SW X0   `Pj h4\10 0R(K0h1 @;@<000Sk  .S 0SY@Q5@!.@D2Oo1B1R\ d10R:0  P<0p1 x0< 0t1 ]0<0p1 0t1 } DD@Q 0l1 d1 0 P0=S; <0S S" S t1Se p1sMd1SNl1S' h100Sl10l1 0  Qd10d1 <.K 0P  PO`A^c<00d!8   0 P;Q<00ZK<0 0Sp1s C<p10?<00xDD@Qt1 0p1 0 l1 p! d1 0 YPʑl d 0 OP<0 p! DD@Q0t1 d0l1 d1 x  -LM@`TpP 30 S* f@P 0 K0 0 00 00000 |0 x0 t0 p0 l0 0KSl S S b;00;0S S S (Kp7P d0K8 ㄠK0 λ ʻ0"̠  " K K K  R/ 0 i?0&P& 0 p\P ! 0  HP 0S0S X/ 00p 0 0 0 ,PdpK tUHP  d1!H0S 0(K0p  p 0 |0 x0 0p  0 d1  ǻh0SD( $co -LM`Ÿ @Pp0 7 "p1 P ᅸP QQ yPW  rP0@S W 0@S0S@2 p 0 0Rb(K@ #>KD2  l1/K0KD2 ᫳@"?KD0 ?K P42@"D2 0S82Z@2 +0@"D0Z: 0S ppZ "H" % *Z 0S   Z:pYH"LPD2@"*@20 SH2 @2 :PH2 v  -@P`p 0L[0 : 0PR-0A0 .C RCCG-0HMp @0AP0 T8 40@ <Q0 h0'` 00#` `(l0.P 0%PP(eZ@.@ 0$@@t8G & 0"  Tȟb%% `0!08`<$ P, haP"`P@%$Wǁ@#P @ $(PGi !@ 0`",@`'l 0, 0 0#aZ00))+A0O B @# @t4G0&0  #8 P7b%%0`0!0<0<$  P,@gaP"`P@%D`Vǁ@#P @@$  b PF ,@  "00m @&0) 0 0#[&40& 00# lIl&0% 00# b&L6$0!`0=0`," ,PD` ƟP# PP%@lɁ`U @!P@@$  b,PE ,@  "00m@@%0) 0 0#[%0& 00# lI(l%0% 00# b&`@,@$``4@暃P" P% lD@T@ #,  $P),00Pdc>`!, 8T jP",aXD0ğ@#!  <D  & "0䓟0c΄ 0% 0#``暌` 0$ 0#PPe# P3 P,P%@@$,@c0@)@$ l>8D@`!, `jLS"PP,P8CeX#@ @,@ß D  )0l̈́ 0  `!ܢ@`a  ` "PP帒X 0 0#@@E08吒` `& |`l̈́ ` " \0b+ 0 0#PPX0 0` `&@@(`E ` ! Da 00#  b+0 Б` `&PP༡<`X `@,@Ņ 0 @0#a04p` `&  \`b+ @@$PP@a,@X0`0# 0p pHЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ0-$$$$  00䉫#EgܺvT2 -p`!0Ra00?`0@@f>WLP0*` a$Kkr l`f ;W 40@W@ -LM@p0 0P(`K0 0  p!? 7R8 bx b   0RX Kh_s ` -LM<"<2 04Ÿ80 0 0p 4K 1K$ 0S` P( U 5,00L`s@T @%UW U A a  00b ƒ08 CR800 0RQ(K0 XR0`P`PSV 0j0S% S S Q' <Ͽ,,(,< 0T00@\*40[̌\3 [40[(2[<4\*30[4 [8<.S\ X*0s   -LMKaP K -LsM@$$ p` 0 |Kg?K1 @ @ s%On%1 }_KTAXA\A P    0  [pP 1@8P 0 0R (KP 00帶 0P0r B- 0   T -- LM 0  K --L M 0 0  K p-L$MP@tt0l $ ,K00 4 ( 8 ,@ P @X@:8Kᚥ`=V Kp4 | R-L Q0P:Q:0Q: Kh%Xr r-LRϠ#\ Kh2Hr -LM414!0p`0 !(0 Bp@ PK ׵  Bp gA0( Q( K^AKP0X @@T PU 0SP@LT 0F 0 ql i 00-PL@ P0 000(0P(P,P 0h0PP 0P 00 00,,3VP 00 0P Y L2 X 00-L@  嗄 0 00 00 0 0 0 0-LM 0@P 0 00P 0   3P0K06& 00 0K0 0-@PL U 0 0-@PLy0PPu0P(r(P,P0 -p0LP`h 1Pb 0 S S @@PS0 S S@@ 10PM @P@pTp PC |@n1P2 P@PH 0SE H@T 0S S S@ 0AU 0AM1PP@Q0000\P  0P310P` P@ԴPnд`P@Pɴ@cŴ `@|1 V 0 0 U -LM p@V,0Sf:( /T( N0@T2K[qqD 00T@: 0Q:@c@T0P5 00T1:000@cP@D `C TH 00T :P  010P@c@T0` 00S0AU00P  SY@pT@$KQ00$K(0 0P (0,@0  0(0)PP 0-LM 0@P   p P K0 0 0$ $0K KP K0%p 0$00$00 ?K0 -@@eLLM`PpK ` @@0TqP=PPP9 @@0 GqP.P \" 0p`0\LQQ2 QR Y   `^ Q@A@@@R  R@ Ap R ^ QRp   pQAp 0\`0S bi0P\0 0 X0 '\0@`0d0 L0Kh0 0P @ T* R RI RXQ R   DHpp^ P@Q  QplP Wf Wk p Wp R' 0S0C0PPW `  ᜫ ` R4    X  l0 0 hX0 弲dp D Hp 傫   0@` d0 v l0RB l0 4 `fl0x\0 JS`  0(K@`0\@(K ` H``Q q ` lP 0L@`0@(KꅡQ F? -'QLMP[< PU<@P0 00SP0 00 $0p0 0 0 $p( ,PĕS #P3P!,P5, %W`-`ĕ!(   `80 兯QaU%`PYY80`PPYU ZAW(KW #`3`!-`5- %D00@^(K;@00(KPWG %8`X `T`FR`FQ`FU 0GPFg mU`4M 0:0PFuP;P(KPZ* %8`X `T`FR`FQ`FU 0(PFjlU`0% 080PFuP9P 0gl4:P 0jl08Pgl4jl08P:PL -LM<p@& Ku>p dK!0R0 0 @nP<u 00p0 0@P0  K<0 K<뎱 0 ,>0 / -L \!,\ \ \: ^ : a^00Y00 -LM$@\PK 80K( Y4480`:g;`0 i pa$07x2(02&7f- ba 0cP8 4 00  P   0 80 a92# 20 0 a0(K  0  0 00-SL@ 3/K0h A-pMP@6 Q $`  P`Pf@F$bd. d n&"@n@b"F$bd. d n""@n@bA$bd. L d n \P'" \ _\\e L @] Q,`p Lp p`@F$bd. d n&"@n@b"F$bd. d n""@n@bA$bd. d n \ P'"\  \ \ , (P $@\6\J \F \H  @ 0 L a$ @@n@bF$bd. dn  n ` &"`b!ba  a `!"`b!ba  Ѝ\ \ \ \ @`L  @LHDy7E C B M6 -L`͢00s !R !p`F@T-V(V.P  РP Pj@e  a0 0㲢0@e  S`Vp0 0㡢P P @꽯 0 @00 ㎢W -,1,!0@L P000s0S 010 00Cd.R   P : R` P p@l0|`0  ~^@ 0B 0A@@P@ ʚ;0@ A-@@@$0 PuPU P0B QP@pP:  @|\pP/ 0`B @pP  @`v`VpP 0B app`pP.R @ @  pp@`E B2R񏐒}#~}|{zyxwvutsrfponmlkji]gfedba`Re l a`f2RQEONMLKJIH(FEDC#A@?3=<;:987654321%/.-,+*)(&%$#!   0 @ @  @0 Re l a `d ppP0M d0 Bpp0D  0Hppp0 Bp0p05 0-@LMd0 $B@, Q Pd#1  B!00DD  Â"0a ,0@0 K0gfff ; Q; -AMLMP`BNKp@D@Dp  0( --pP,4[S ( 0R K.iܟ 0, -@LMPP `-pPuP0U K00S.SK0000l -LAMh0h0 PANK\ @D@Dp0 `P  0RKi넞  0-SL@P` @0S IPV 00V00 p-L M@P`P 0U0 R PL0@0P V00KpV 00Kp 8 p-@L MP`0S 0U0S @0SL0@0P V00KpV00Kpl7 -@`LM KQ@T:K,@@ 0 0K訉6 6 Q 0 0z0 0u, -@lLM KhQDT:K000@@0 ~K6 6 -IML M` ş0@@P@@ T4 5l 0T4 0L P00  40 0RV(KX50PP4 0 Ld 050h4 5d 04 504 40\4 404 C>K 0CX4 =K0CH4 D4[XdSD?@HDU?P0  LH4 LP?oT$2R0S `40  d4 S44 h LY YX4/0)S* 0\$L PHLP P  010SPK\$P;00PP4 L 0 &f <@X4!(?q0r  pLT2x 0t4 | 20 p 各 p| XL `fFY34P0 `$0Rd@, V t EL  @LT@ 0 x42l$P0@00  .T `f 0 pFʚY唔Ḱ 0 㾚V 0 කꩫ0S9 GPx  L40 0RAP(Ko 0 㛚010T P@  KU@ 0 T凚0l$P0@00  .lTT4SX`40   _Pl  K^g렚 .@5 T.85 H 4 3 x3 |3 l3 L3 _ 2 1 L1 1 P1 0 -LlM\@Kp `묅P^0 0LKLPKU  h  J%[`1l $[S` $[ᰥ[ᾔ[d  %P  5%0A>h0 l0 YK`1S   ;`1S   0    P  P  P  P  P  P  P Px`1Sjh0SS RP_ 0J 밂 0J `0 J dd0 J`1S   ~0 `u 0 `o@0 `i0 `c`  00d 0 (K QP_ 0ᄁJ   h0S  (K<0 `1S 0 F0 K0 P0 U0  00 ܘϩqNd +J(KdX/ `/ (- - \- }x, d, , + + + + `+ H+ $+ * 0-@LM$ Tk TE Th 'TV TF5Ta T2 +TL T9p( T1  TE  T/L@T$ T>  T%(T+ T  T TTK030P@0( |tld\T(+ p* * P* * 0* ) ) ) * ) ) * ) ) 4) ) T) X) ) ) 0-LMP@ PK0 0P0( K0" 00A }@y M-L@M0 0` PPpKP @ .0G$T @D 000 0R K$00. wdl ,( -LMp8 4 0 ^8PK4K@\0K`X400($Q S PS (KP0`8-\080 0@ @0 +\080 30D0 0pP 08  ^10 B0d.\ 80 @Tࠓࠃ@ r R@Z  0Tࠓࠃ80 @ r RPR  R 0T80 "#T & (8( (Ġ), `0&)8&d)  ` 0(Kl80D T0T80 @ r R\R  R 0T80 "#T @80DT 0T80 @qQ ^Q Q 0T80 !T@ @ 080  |\J 080   0L ? 080  0 B 6\ -LlM0Q00 0 S 0( p< x| p@ 0t 4 8  Sq< "Ÿ 4 QS0N0/RaT0 11ES2@n@n"`ďbh0o2f2c1@WH0 B:nL0 W0E0edPbh@ D,Bpg'P0 2' "D DCnC7no"bf ᙧ̯@dpj_ReRe jQCI:n\0 X pgc8c<cbfZaHX \0 N Y H XB 0T0$ 04 @0, 0P D00 0@`PH0L 04(p-Z Y X 0(K  4 cj0  00 0(K`  ( 0 ,P H@, igMbsEYJQ | T u 0-L@JP 0 .RS0*S 0Q.S0P@0 0-LMP0OK0 P @ 0v. 0 0  -K0( -PL M@( K(0`Sp` T(0w0 K \Px 0000 I ,KpB0S,0W0?o20#S0(0 n$ -P@L M( K(0`Sp` T(0w0 K Px 0000 ,Kp0S,0W0?o20#S0(0 m( -@ BT"RLM 4 8 0 P4`U ` P-YU +Y0- cP`"p 0 00Is Ra0ISW0IA0IS70IT| P  S  R p 0Y% T @`P80\00S00`S \400J(K芥000 R400(K080 XQ0A P@`R A@PT@`R ꙙ 0 0 0i}f -@L` 00CS0 vP0 ` SvP U-FP00CS0p 0/ Sp RF 0-LM@( 彠0 0 (0K 0 $  00s !R ! K;PޗK0 -@L`ɗ00CS0 vP0 `Ɨ SvP UEP 0-LA 0R0( @0S  0R ' 0004Sw'P)00S 0R S00(@ 0S0 0{ -P0LL0 @P`pp 0 KhI z 0 0 X y -LM P` pp@ 000 0 0 000000_@$K$py -LMxx P` pZp@ 00 0@$K#x0 00/0x0 00/x0 0Cw -L MTT @P `pp 0 + Kw 0 0ѵ\w -LMxx P` pp@ 00 0@$Kz#0w -LM P` pp@ 000 00@@$KR#v -LM(( 00  L Ku 0-L0L 0@L0pP K0h+ꌣ(#0u0 0 0 f\uh -`P@0LS U P 0S .S 0@S \S0S@f0@fT@ -L M0`p  0X"P? 0S0Q4.0   c (KP 0S@00 0W 0S .S 0S 0S00S.S000 -P0LS@` X 00d0 ɢ00 -LM84 @p`0 P)Y2*0T-:SP+ 0䠟08 @ TP,  ^PP@ 0  P0 P00 400000(K P<0 Pi (K8 L < R-LP0AS0@`|`@Dp`A0 rP@D t8 0eP0p  -ML MjK@K $N@,`F HKD]K@PE K@K A KA0K0NK@0A0@K0A^0@ p0 P> =K0C=K 0CP0@SP -K=K,0C B00C =K80C K 0P0pP` H@PYH+ 0KA 0dH+ 0P-K+P0d k-K=K8 BP0 P3=K =K 80C 0AP'WV f-Wf 3W2W*/Wo :0W 1W'-K B D =`!?C0 S-K` =K8 B0 P=K0C00 0R (K K @P=K0C R 0S .S 0S 0S=K 0C000S.S -K =K8 B0 nPP=K00=K80C0 P^W` wW] ZW W W0S KAD;+ 0c 0-K0-K=K,0C B0-K=K40C8 B0%W d!We #W20SKAD;l+ 0cWm -7WD; D+D @ (+1#PD+ K00 @0S0D;-K =K8 B0 P\W 7WY-KK=K8 BA0 D  PKKAD;t* 0cI W WW*WU %WR WH=K 0C0 K@C=KP=KP80Cp@p=KK0CA 0 jP 0 P=KKPp0CA0  UP 0 P=K0CD 0X)0`S Q <0490d -K=K8 B0 P=K0CD[0S8-K0 B08-K0 B08-K0 B08-Kx0 Bp0=K0C0PeUP=K0C0U0#(0=K<0C0 C0C @D;  &@U=K @h-K8 B 0 >PU7 -K K8 B@ 0 1P=K80C0 0P=K0C0U0#(0=K<0C0 CC =K<0C0CD;0.08 .0 U0ʭ=K<0C0CU-K=K8 Bh0 PQD;P=K0C0D[SH =K$0C0cD-K=K,0C B00C =K80Cp K 00P/)W C&W90SD%=K0C0&0a & W6 W+0StKAD;% 0cWMK,@D4@D D(-K=K8 B0 P0S5D 4D`50d D-K=K8 BPp0 P=K 0C0K@C K=KPp0CA@ 0 P0 cPPp 0 PmW=K=K80C0-K0 B =KK K0CA@0 BP-K BD; PcQUK@p @UC D;1 W2  0d -K8 B 0 PvD D;@0D;D+T3D @ K @@0( -K=K8 B0 PU-K B D |2`!?C0 S-K=K8 B0 P= W? WJ=K 0C0K@C=KP=KP80Cp K=Kp0CA@ 0 jP 0 PUW$0S KAD;! 0c0SKAD;! 0cW KA@-K=K8 B0 D PD;d!0c +W:P1W+W0`S)KAD;,! 0ccW=K0CP=K80CAp=K@D U~ 0 PD;v UD r 0 XPXp  $ VUUU l   \  4  4   | lD P x P  , 9 \   t 4 \ h HT d 0  @   T\\l@) XW}0SPKAD;  0ch=K 0C00#(0=K<0C0 C_WL=K@=K@80CP-KP B =KK K0CA@0 BP:L0 P2D;0D;mD;0D;gD;HK0D;a B$D;HK0D;:=Kp=Kp80C-K B =KK K0CA@0 BIP80 PD 7D;`B0D;@0d 0 PD "D;0D;0d 0 pPD  D;@0D;D;P0D;D,30d @PD 0 OPb=K0-K0=K80C0 B0 =KK K0CA@0 BP=K0CD0SDp3-K0< B0 0D;D+Z( P 0S @@T 0W4 =K<0C0d  -K=K8 B0 P_@TD+PZ=K0C0 SDD+40d s -K=K8 BP 0 P:D;4E D+ @0 d [ 0 P'D;0D;bD0d DF 0 PD+0D;@T -K8 BU-KPD;@T0D; 0 d % 0 P'W KAD;d& 0c=K00=K80C0-K0 B =KK K0CA@0 BPMK,@D4@DD -K=K8 B0 _Pr0SD;O RgQFN RD\G0@0d 0 -K=K8 BpP0 :PD+0Dd  0 )PD+0Dd  0 PuD;D 0SSr` R-K B 0c|( g R$Wk0SD D80d Dx -K=K8 B@P0 P?@0[=K0C0d 0$90_ -K=K8 B0 z0SJKAD;d) 0c(WI W --K =K8 B0 P3W -K =K8 B0 PD;@DKpWA YP0GSn: 0!=+F !  # +F   +F "  " +F   # +F "!  +F F! 0;F-K=K8 B0 bPDK@DK=K0C0Sm;-K0< B0 0D;D+pWv P 0Sm @@Th 0Y4 =K<0C0d  -K=K8 B0 +PD+; 0=!+F !  # +F   +F "  " +F F  0F;FF=T,0 1;F010 30;F0000;F0F200F;FFF~=0 !+F ;F!  ;F+F;F;F;F;FlPW=K0C0@SDKy =K-KF 8 BF0 F FF!F F FPW1DKpW@DK.-K, B4B 2@PTP~Tp =K80C=KPe0Q0 0 pP0PT 0 dPKAD;. 0c>d 0@ -K=K8 B0 JPZ 8@D;pD;@0ZD; 0 d -K=K8 B0 ,PKAD;/ 0cS;D;O @0 d  -K=K8 B0  PjD+0Dd  -K=K8 B0 PV-KD; B 0RD;-K B-K8 BNP-K@pD;0YD; 0 d d 0 P/-K, B4B v@PTP~Tp =K80C=KPe0Q0 0 P0PT0 0 P=W D+=0d $ -K=K8 B0 PD@TD% -K B 0R0-K, B4pBP`4000 0 ڑ 0H+H{0D 0cTH D 0w =K0C0S-K=K8 B@P 0 QPnD D;P0D;MKD,@DP<4@DP02 D -K=K8 BpP0 .PKA0 D BP D;-K8 B=KKpP@0 DPpKA0 D 'Pg D;-K 8 B=KP@0 DPWKA0 D PN D+=K-K8 B@P 0 DP=-K@P B =KK K0CA@0 BwP*D hD+p:DD 0d G -K=K8 B0 P=K-K0C0, BD 4B` 9Q@PTyTp =KPe-K0Q8 B0 0 P0PT -K8 B 0 PD D;p0D;D;P0D;MKD,@D94@DpP02 D-K=K8 BPp0 XP-KPp B =KK K0CA@0 BPY 0H+DHKᾓD 0088`0d H D-K=K8 B0 #Pp@D;ܗܧ0D; -K B R D+P W -K=K8 B0  Pa p 0d @-K=K8 B0 PPpG@PD;KA ' 0cID+=K-K8 B0 DP4WD =K0C0S -KK=K8 BA0 P!KAD;l& 0cD VD; D+ PD+@PD;p0 D;f60d P@ p)-K=K8 B0 P=K 0CTD .D;E0D;@0d  -K=K8 BPp0 uPD D;0D;0d 0 bPD D40d D0 OP@-K@p B =KK K0CA@0 BP=K-K0C0, BD 4B` 4P@P> $tp=K80C=KPe0Q0 0 Pu0PTᔒ 0  Ph=K0-K0=K80C0 B0 =KK K0CA@0 BPQD =K0C0S`43!?C0 S-K=K8 B0 P7 0H+DHKS-K=K8 B0 P"rp@KAD;" 0cTڭ-Kl=K8 B0 P-K@=K8 B0 PMK,@D=K4@D 0C0 D ?PR-K=K8 Bp0 PD;-K B0 Q@BD;P0 xP=KK K0CA@0 PD;-K B R-K,=K8 B0 YPlD D00d D-K=K8 B0 BP KAD;  0c 0H+D]8Tx*hxlT8\PVUUUH0D(08Hx4x|@ Hd-K=K8 BDPp@0 DP@0@0d f0@ P1P0 CP( 0 PpD aHQDP@0 DP H<P H 0 Hlp0  P0 PD 7D@0 DP HPH 0 Hlp0  P`0 pPD RDP@0 DaP HPH 0 Hlp0  P0 FPD D@0 D9P H@PH  H x d0  %PPP0 Py0 P'pT$ڭ-K=K8 B0 Pb-K=K8 B0 PWK 0C0Cx5 0l5 9-K0p5 9 B0|5 98t% 0M.K$ \% wp T% L h5 0 A @ PV#:M ( J G @V:Z6 pGW *T# 2Z| 5  c$ PPL505 0圩 <0 m80@5 t5P`5 P8% P@53/P(5P%0C?o2,% R00SH5 ,%(5R PC'SUPP RP,(0`%h%0HB>K 0C'C 0 $Y Pp0  PT †5 % cXXPPӕ 5D5  yX5 S P0%dPT%P d SQ850S 0  850SN 0%LU0e u0@0`T 8e cT%\ a  0`R T <0 ,5 Sx S S y@53/P> @53/P=@385&P85 0X,5SN X5S4 50 %0R t5T%0R* 5 T%  X50X5 B>K 0C%C 0 $ P0  PTl50%L50R055*U P0% PP U  5 eXX00(5 G58%( 0De&P5 `%p% /H P 0L5 LZ: <0 (`UЅ5 %@ cTTѧ%05 85 &.~$ @K I`I( \^M !l0 4 ȃ̌h1 S p ?t1p 0P3  ^$5/oT" R0 PVWPP@XU( X5S @Ip\5@`EQ 0SQCL|C@W`Pr0p0p0p  c$P0 = PT/X5S*U85PIPPU 85 0SQK % A8\8%5 |%m.LU(l5P 0l5 J 0%L 0e0l50%L50R*05U0P05 P 85 0LU(ԥl5P 0l5 " 0%L 0e005 0x D4S@Z<4sQE4 tdX@ -LM0S`@0< S/0p 0PP- AP( 80P0 5P+   0`1<V  0P P K  0 K0p 0 K -BML M2p0`  8 R 0 - R B.K B0B3K@ሒ<4 P0u #0dh(P @ T *V@@"<E42P  0 840 0R|(K 0 B.K B B<$ ! >(㈢@P% PP' 8<0@ 0 OP! 0P00<$ 0 0PᛦX>  0 @d0S 0 ቦᆦᑈ 0 00 ڀ00S0  0@Tv  # 0 0l 0 e 0P P}7D0  (H -LM`p3PP00 0  `0 @8(K`0 @P -LM@`p PP 0000 0@ K0 0 RQp-L$M``@ P>0SH 0S0S0s S 04   0S 000  Kp 0 00 00( 0 ,K,@ $ P ;P 00 KpR R /0  Kp0 0  0T ȝ -LLM|ğ| `P p`0 0P \ 0 T0  (UPP 0@0K H0 {0 dP @P 0 0H P0ö RS QR d0 R Rh @0 S S xP 0  R `DXp pL @``iP0 PL0[`0V R R R`  U:(oP Z 0hPP@Xp`h d0Q 0L0hX0 C1`AL0 \ 1V@:`cV;:PH ] 0 P`cq0V+: H0 LL0SH0H @`c0 X 0T 0פդ 4 L0PS`i 1 AF V*H ῤὤ띆 0p T 0P00 0R9(KH  P*ڝ P, 0 0X L0 婆L0X3@XpH|ᐤ0T  p0\L E0L 0T p0_00^Bt y(yx p-LM@P`ɠ,00 0]Kp< -L M@  9K 0-LM@P9$  00 K0 p-L M0 0@PU 0p``0 0000@ 9~PKp'PU00 D@-!1 @0MpP` 0^$ 00 s0S 0 N RM0100 N.^$U 00 0Ѝ R0XS 00 s0S 9^0 s0S ^ gB!R  P(,0Q 4 3? 0"0@00< -L4M2Ÿ0 P0H `00 Z PL @@PK:T@   t D20 K0P0 T0LP \P pT X P` hAP C PU>b @TpW\P0K L0Q0:*ĠL T0S& LP c% R 0rR0a 0/00H00 0 RB(K#L0S PAPP :TU 0S L0X Q:*40PL p@:T`T0SL0pT0 .T\PL0 @TPL@ 0Kš@t  -L(M P0p| 8`K@ ( X$P030#PP |( 0R$K@  -L|Mß  P 0 0 PK ;0 B1T0  b!,@K"PT  ` p  R 0S p v00 \0S  R` p v00 Y0S `Y00` `0K0 <2堐 00 0@2K0  0S V:0@0T] V00 STH PUZ*:0VT0A0S Sb 0S9l0!S50. 0 e ⠐<P?  `VC 0S6* 0a\ /:@ {0/ 0 0 Q0(Ky 0Ppe1 x#WP @Tv㠐 `V ƃ 0 v0 z t0S*: ?d0S < p-LM10 P R@ ) ^0* KP\*`K \\ `K`1@"F|0^ R KQSKQQ  R 0R Kp 0QKph?k?<  -LMe`,K0@SPM v(XT U U U F00v`(K 0Q  Q 1X ˌes`P,KP8/0 QP 00P @ P 400 0 00 u(K6DLU Kpp-KPeK,K 0Y-K-K  %0`RpZ  0 < V?`p0 8``lR0mKV060#00S  0V0mKL00c` 08/0 QP 00  P  @ P à00 0  0`R0 QPl0Vi 0f`0`eu`Ir . %= 0 R?Q < R? KP KP4&,KR0 0,Y K Ku 0 Z^ <ἐ} 0P8/0 SRu` Q ` ?-Ks-K `bZP @0Z I00弐0 0 0 t`-Kp pK-KP Q 0 008/0 SR 弐`%0 p -SL,M\0p` PL0 `0@ P @80 <0 L #Pt00KH0 W0 00H@P> 0@UT  XB*H 0R0: \V X VH @h800@ TST'80S @@T<080Pt <  80 D0 < z D0 Y@ft0=P08S<  (K0D  R LP RV  AX QVo S00 @ C Y \ V L00 S\  D P@V0 S @8@VT _=P 08S  LpV V 00S080|< @<0 s8A<0(K R R@@R V R@T00 0 0SV @@ AHQ  Q V P -@00LG`F0p 001P0P@ ݀0TS 0ր 0 -L M@P0.S00K -L0K M#@pdK R ..Q AA S.S Q0B Q-R  .R0S/Q0B Q/0*S 0.S S/ R !0B]S.R 0.BoQ 0#\R00 !B]Q//]R0S! C//$0 0 / 0 0 /  / 0(<0/ 40/ ̠ ( 4 0/0 R @R /AS0S01!// -P@D4L0M80 4440<0 ,40 0`@0 Q pW 00T T*.0@0DP0V@Wp P\dpP 0" C!C:RC9A7?>=32:987-543210/.-,+* ('&%#"!  VP 0@P]X VDh"#ਂaq暑!!0Cs0 0 0@V-0@AQu0 S40 + cS0C1  R  00Vp14 0RP@ڜ104PXp PHQ( 0 (KI0V80p<P40 0@FX PX 0h 8@""PPp4 <Pp@dT@40S4 0h(00T T*00000cT*.0@0D 0 ꘒ̀Q؏ -L,M<0 080 4T0D0 4@ `@0PH0 Qp+ PE [Q` :P d0eQk :Pg eQp` :P\ epWXVVpQ@p80 c B0G8VD8R  V>@ 0bS9< R00<0(K\Q .Q80 0c0C'8V$80Q S.Q 8@ @]:PF 0phX00 0xS @i~0@(Kc~( 0 (K|"D0    VW& 0 L /R4 ]R9\W PP0 0K0 P0 ]RSL020 VWZ(@,~ 0 VWppp A080 0@S .S8 /W VH \  P0R 00WS V@0 cR<0S0 0  x H L Y"L 0nSL0[0J 0P00 Sb 0`L 0c3\ P W V P ،0 -PqQL`p:*0@S0 R2 0zP0, U)P`   R00N |`00`h``RN`0 S@0at}(00h , R-P3P#RP3LM U0`80 0 p@40 0`00  Q6 0@S S S H}(00(KV40S h040 0?@D00T00PS@< 0P< 8 ^@V Ppu0Sppjp40Sh4 -LMP K -L4M`S@H P 0Z <0 ` 0S `0S PXW p0S|(00(K|00(KH0Xp  p04  T0 00 0CL` P0 D` PU 40PS` 1uV@ pP00U00S <0D S"*80 80`80 V 1jY 0. P? $ R``VD08 S{|00w|(000S L PR*,0jST0S 0T0 0pX 0 L0 @0 0@0 0PP P  AB\ AL^ \ R0SY4 0RD`)4=#=0H0cW<` >ZD`M 00J<`6H0cI? -LMp@xx Pp`~K 00@ p@  p 0RK@8  -LMpp @J_K`p0 ( p 0 ( 0R$K7h Q/!0S/P0\*R/\/00/ 0-PLP*0@S @R R R {( 0 0QxP Q0@SP00P0 Q- AL 0S R: cR B 0S  r{00`i{(00 -L@pTP2 0#0W&0X" QP @TP0  WX TP` 0/{ 0 ){( 0 000 Q-L`@S 0RP@`V  0PR@ P0  -@LTA`pQTPdPW1Q@z?00z(00z00 Q-AL% 0S" Q*0S  Q :cQ0A z0 0z(0 0 --LM00  K -LM@$K p KTKR-0S0 \ R \00 -@L M BT"R4 0 `4PY P {uP-Yr +Yk U 7pT`P" P-SQ&c0Iq ^0aIQW0IAIQ70IS| VPSQ0 zz00S \400J(Kz000 R400(Ko0Y' P @7 Q 6pTP`pgo0 6poTWPpdP X\ 0L ^ @ AN^P@Qg 0 0 0F| C -LuM@ `  0 g/K|KP! @ @ O}K0 TAXA\A a a 徐p 10 @10R(K5H - 0   l -- LM 0  K --L M 0 0  K QP-LMP4 0 h 000S000s !R !0p 00 q X0d@0@6pS* 4@jP@i@` # 3?/ RR  "!"""$"( 008 pP8 ! 00 IHP0 0@`V 000S  (KxT 0 @00(K0x 0 -@P`pLk0 wPk 0-P@Lx K0h -Lp`P5t0t0l@ W  -@0 g7 $KkD `EY( -L@pP` V  %d000ٔPP 0-@LP00S  3/000S0K0h}x^ -PQL`0 @0@P ^0UY00 0-L@PIuP0K0h@ -BMLM@q1pCnK`FPF0@@ @@(0 0@0C0,0K<#0  0@d -P@p 0!Rp0 P:, K<" d0 \XU(pTpThTSSSRG-ld(2@Bn P_ 0Sl q:SdP 1 @0n0ADd0\a@Җrhc^@1@DC1`00IAhphp1N0C1`1c0^0B@0P0BT`L`L, ^Ad@D0P8S@@Vڅ aaF ŽL ^0# Π3nP 0S :S 00\PD0;P@:=0$0C0Q*gfff$IgQfQ-`@Q@T?PT P 0 /` ?PV 0R /0 0S 0 0S 0 0S0 0S0`/// -LM@K  0 0S0@0S/b a1CR0 10bQ00S2 0AtEA@C1a@A`UQ2PA`P0!BP 10`Q00S\  蟵?0c0? 0cLR bSZ tT0@P0(K0J! cRv΃P hGdpddgd@c^ 00/<7 bS#b(7S 00P@\LT Vp`P l6  @d a ^p`zRTo0011ScZp ` \vL L;Z s`q@Q㈀KĐK?Ϡ 00b ` 0RjLK0   00:S U00c0Kp;0 P 0 2c100:S<0 P 0 00 0-0LJS@( MS 00C S!0 0[?P 0/S 0000 0 0P 0.S 0 uP 0.S 00 040hK0h0 ] m -L M@P`p0S@0  K -LMŸ PP 8 H <2 0 0#NKS0 0Dq0D @2 08P2 <2 1"[`Rv ^bXw QA@2@ T0SO`=0M0@ s,KQP,K bA!@T\: K0ILL2   Z1 prF|l0SD Lb@0@BFLl R ?ohh  ` 2 0 <2 8q12[S h0oh  b0 0b0YD Z`pT00H20 0R(K8 < p<"P2`088 pP280p`00, ?P0 S-LϠ^Q\ 2FFF. 02VVz@&p@TK@pP0 0 004  `  d  h l $ p ( t ,  |  x  # ' +00 = 0 0 `0|  S$0X 0 1X0 xd0 \$0\ 0 1\0 h0 \$0@ 0 1 @0 l0 \$0T 0 1$T0 p0 \$0D 0 1(D0 t0 \$01P P0 D0@ 0C1RSPT D R1\DXPQ\P^@@,00@1#02#H  0L  0S40Q   P080 00 3Yf 0\ r t"|d \ 0bTO 4DP@R]E4 8!Q  D0QNTD4P XC@T ST P40T F̃DP@ p0P P$0!S $ ^0T0LPX 40P V<0 g0 ^ P 400@ V<R h D K0 jKP0 80 Z  0p^ r P@" X 0 @ p PXt8@HPqT @D4R؆X`8P@P8P R4`ǟPPpMB[@`p&H0VPp  KjK 84 0XD"F,Qt  @"TF,t @@0P0\D4"F,Qu  @"TF,u @@0P00S L  0`0cL0  |4Z0剐0S0 n<0L 4R00S 000 S T`V] : @40 8 ~ P TP  P  R0SR000F0=8 p@0PA U@DZ  uyP R0SR0040PJ =0-0 QA S0*;@@0\ S$!? 1m@(KR `/@mP0@P8@8P P# 0P^ @S$!? 1V:40 "F,l 0R0  R 0C"F,sl 0"F,l  R  0S@0B0  RJD RG @0 ֬P@P 00 :80 6S `5V,h 00< G;h Jo pR?@ 40 P<0 V hU jP# P i01S @ p@eP40`ST p`F 0V-= 0R P@ Y`H2TT80F 0\@P@k=0 0Xp1E VP- 0` T``P`00 BFLʂ.Ph@ΌxP -RLM@ 0d0 0 h l0 d PP00h0`V <V 00F S+`FVh RQ0S0 C+Ch00cp0 p R l000 St0 R,R00;R00S `KP 0PPSPU;S,S S}pWd8:2 F,l-^}  } `P`F̌l\ UPppd2F lFu0Q`eF<h0^PcW `l9hahx|l&p&t&u&&&:+t V< l h0@  dPp` Ph dP0<S S 0 C R+0CS RQ0S0 C+CiZ/(K0>SS  0>SS>SiPd 9 b`PV|h&lfpftfufxf|ffffl0hpʄk  0d `(KdK0Ph0 0 Sl0 h 0 >SS 0>SS>S0bp0 h d0>C`0 %T0K0 /P 0,S@0K0 %P R,0KP`9adhln`ppt&u&|&&&&lx0ccʄ 0 +TsTcTSx@ 8d0aXaN(3X$C@PX pG BF hPPeB x@>P`0 堠 pᤀ 娐 Kd"%/bUy#btUp x |RJx |P2 V{܅K1 0 x0| SP0 =܅K P`< W x0| SӜ0刋0PE0PSp@d0 0 `x  | 0 4! |x0j0 aR W ܅K ˁePx0| S >-0`0 ܅K NPV㠠夀娐`00ꠠ夀娐`0hS000~x@ SGXCQ{3 0-@L@]0S xK0hUh庄PP T@ @`@HP 000  (([(>P -`QLPV 0Sl!  ʅ000 000h6l6p6t6u6h; @P 0:S;  qP5 0S_pVl̀g`VL`g@&PpT`V pp 2F== -PPLq e\2P0 @@R NgP,rp aVj {P`T , P!1 0d0Q00QQV 0S2F̃F,ll `0VV"F,l02PhVD|S0C#/PEQbQev.D0e BT`P J0/02B@1#b0w?C0C0#/A!b!b S0 B .0 c.0 c< 0 c< 0 cH0Z 0 d0T"aT>aao0 "0 0V  `c0 S0 4` 0 `$0>^GTS0DKH0 `B͆  GP &܃K2;f`pYXUT 0C`CWV C`WV0C\H DKp0DKH0 l8^x0 R lR `l0!dR40@-2%R000DKH0 I QQQnm$IL3 0-LMp@@0 0PP U0S V␃ⓑ)!9# 0#KKRP0w0g 0 (K0S 1P0!V#K0"> VPb>␃ⓑ)!9# V0#K^$:∛ Fh 0P: F 2l V0lQ SP3`!倐K 0  "n _@!P #0pK  PH_WP@@ \( 0R%$K  P0PPPꌀ0 dT00d0`0  0y %%&%X%$$$L-D0D 00@ P000^ c0w , -P0L0,MH0 "140 0D0 08 @0 D0U80SC80S0ᕃ'H0@Z  `@0<0 000 00peTa*0p`< 0b hR <0 80R㕃#00 00@d g0eS0!S<0S*UD*U6:00d`0D0 0@0 D08  80S8 @0啂"S8 **@0`e00 KPETAXA\A 1 1  0Q Q Q Q q q  1 ( 0R$Ks`T00vTj  -LM 00 K8i -- LM$ 0   0 Kh 0--LM0 K -0 0@L`XS`00CS`0 vPX0 X `XRp SvP UXPh X0X 0`00CS`0p X0X/p Sp RXg  --LM$0 0 X< Ktg  --L M( 0$ 0  XB K,g  -WL`PR@T0@0  AX000 /P d`@Z 1X 0 j  ~RyR j1\ --L M0 0  K -- LM 0   K 0-LM` K9.PpPP @P  P&0P ʠ0p@ 0$  0,  0( 0 0KK 0TKI_00e Lp 0-PLR@$C@ R0 -LP`@Z RT0U :T:0T:KhW# R-L KhJ 00-sL@P !R ! 00 0S 0cSu`0AP R 0 V00SOP0@OP `:OP0  ^ 0`0 -P@T@1UL` &{pP  e!e^p@xpP  0 0| -LL0KDM@d  `X0 =^,0K0 P$0"T0KT` \ `0 0Sy0Sv %S`@0@ CZR  ~*e$"yj_utsZ gF`  uP0U* T0X!01SP XX d0X0 T Td 1S񏐕}|{zwv` uP0U* `  uP0U * `v uP0U* `? `= uP0U0* ! 00 B0C Q$S,P(uP0U* 0p*S 0 C R@00 C R 00B S0pqp 0pG0B Q$R uyP0U* T0X1!Pkkj@@`j@` Q u_P0U* N` ``SO  uNP0Uu* =uEP0Ue* T0X1!P  P u4P0U@* #u-P0U[*   u$P0U*  . uP0U* \ `Fp  u P0U* uP0Up* TX0P {(K  uP0U*  uP0U* n uP0U* \ ` p\ `p\ `p\ `p\ `p\ `p\ `pwP R@0T X11(\ `p!\ `px\ `p\ `p&\ `pZ\ `pyurP0Ub* T0X1!P ( ucP0U* R 0 T Xa*X0PW kz(K T00@@TP u8P0Uc* 'u1P0U* vd0P00+T%\ `Qp<\ `Jp,\ `Cp\ `<p \ `h0 4ph0V$R~0pM\ `'p\ ` p@ Z uP0UN* uP0Ue* T0X1!PP\ `p 00B S&010 00C0B P$RU uP0UI* T0X1!@P7\ `px\ `p?$R0P RT X1@\ `puP0U * w\ `h0 ph0\ `px\ `pq\ `pjscp R-LP P@ R R -J00 0a 0  a0RS 00A0A P$P%`X P00 X00S PAA\@0@r /C1b10@00^0ApA0AA(0 1!@0  AAgfff 0-L@2J0000 -qMLMp@? <00 | ' 0 v  1S0106K &0    R 0 S '0&  & K ` ' .6 $7 7 6  6 6 6 0,7 0v 否 (7 V0Ss %S @Tk %T60U &p J& R &  `tTv X 0 5K@6 6K0P &  g~Ki>K pG 0CpG 0C BZQ    *;=<;:98765R2T$}_Q$ `V0sJ @GKY>K 0C @5 D D OTAXA\A.Y0 pE @BK^nK L `FL@ @ D,PF'E @POJP@0@&0@000'0 Q(KFJP, 0V2Ԇ ʟ \ :K \[ &Qp6K &XR &  6[6 06 T@ʟԆ :&0SQ   R  &     pR EKF&KTN S =6 P &0SR 0 QP YNK @Dd0 2>!R00bd@&  bl0@Ԇ 7 &0R06 66 S &1{06 j.K BkK0B 00i.K BQ{&pW 6&0gR7  Zw0P6 x6vS-06KwL @K 0C0C& PP@& u FtGiKP `6[S 6j.K0 B BS  6 `P ` 5[S 0 6&K0S,K  6 `P ` 7S 6@cT.T,PKȄ`&5PE  `@DT0S 6 P[@DT  `050Q0  `P ` 6 X6&0S 6 P6 1 `6&@bTT,PK`&5upPE `@DT0S 6 P@DT  `L60Q  eP]76 dnP6& ` dP,& ` 7S6S'6& @bW@T ڌ60S 6 `P ` T@@dTUTNPh,0K`&30C ` @DT9\P P iKP7P6 0 `6 U6&PbUU0,KH`8 H`PEU R0 & PPEU `ʴ80\0( `P[ `7 P `7,'Q0$ 6 `S0$' `6 _>K 0C<& & @6 `6 66SV&05K 7\@0EKYNK @D@P 6 `S `7@V 0C<6 `PlUNUpiNK( `PEU0Pp6  S  ` gP/& `6P= 6[ `AWP&(6& 0 R6 & ` S iK;P `6$'Q_>K 0C 0  yP~ iK&P `pS &1{06 j.K BiK0BP L00BG { <&pR16 iKP `6'QB P&  uRi0 `biKP `7S606 } &R\t<|00p6 k>Kp0C6 0 p `V70C7 60C6 6`F00Q0   P  7 @jTPPUڌQP   U@@eT(T,K`8PH @DT0SP 6 Pp@DT 6^ ~7 6 VSӟ` 6 S 0!6 6S6  7,@K6pd0S@  6 `P{ ` &6@bS@T ڌ60S 6 `P ` 6T0dS@{SWp,K_`&8PHP `@DTH0S 6 P  ` P wP7  ^iKP `\UP^7  |iKP `iKP `60NSh `T6[]/ & @ &  & F F pC6S p6S &傡06 ZF 6S^FT!B~K pGDpG _K2K@V f 0HfVP @6 0 0@sVfl0Pp6 F B>K 0C0C ࠦ K&0 jK pX 0&0& E0@  \, &Q & pp6KV  C0&  0 F6S &1 & ,@K p5diKJP;  R q & M   S  &q06 W6S06 00 0/ 6&So R&q0K 6 0& 0 Q0S60R00Sp 0YNK[\ @Dd@  @  `dRB& ciKP `0`,<0Q0  `P `iKP ` 7[W5K-0C+0SaB Q5K/ 700ES00_K_K L L5K@&0l$7 R06 S@6&06 ?6 F F p6[& #& ; 00R0 & `P ` 6S  6 0S 6 `Pm ` 6@cTzTkp,KtZ`&8PHP `@DT\0S 6 P7  `6&S R&q0K 6 0& 0 :6S &1 & @N R  & pp@M S &06 pp\ @6&S1pFK&0SR 06 0&  0 QPUv YNK @Dd!.000 0l0S00S00 Ld@d@&  l  b0L p@ $ \c &Q & pp6KV 0&  0 FTi 6& S1pK&0SR06 v /S6&006 =K 0CpS &1{06 j.K BiK0B L0G 0B{p  R. 偁 & B~K pGG61?B!c10A00 R0`00 r pG cW?_K L0 W p`0p& & 6 70g?6 PiKdP, `   B>K 0C0C ࠦ H 0jKp@&0@00 ;P& `\p50STV 00  'P& ` 6 V 00iKP `06 400Q  6`&06 '607 K 6KSp =6 o6KS =6 iKP7 ?@6[F F G &/& && M300Q  6S &1 & & S &傁=K 0Cp> 06 &0SR6V 0C?o2I8ßp ZiS606 6pK V riKPU7 iKPK& `60 iKvP> `x206 ?`TSd206 06K06 &6[/& && '@& & ' x05Kp0 7 N06 -0&pgR6K06 0 )-0&pR6K0 Q06 6[P6 v 0 K AP 0#YNK @Dd0P6 9&R !&  s;6  \ 6&RpFKT&0SR06 6 0 Q6[^6 06   R% q &   S &06 ppqPq  ` gfff(h   dT 6\' S6q0&K6 0 0 K FT 6&RpKC&0SR 00& q & 0B: 6\ S6q0&K66 0 0 t  R/ 偁 & 6606 0{6 W6606 0{6 d@f  hk66 ?@6[F F p6 V  6P 6 `J6&06  0R& 06 IN 0 0& H206 606 6 0& 6 6& 0& 6 606 606 M606 606 \206 iKP6 `\ 6&S16[p6KM&0SR06 / 0 Q6[P6 06 \ 6&S1pFKx&0SR 00& 4 R& & &p6K 0&  0 0 Q6[P6 06 hiKP{ `R& & &p6K 0&  0 M 0 && &  & & & &p & F6[6 0v6 /iKzPB `B6&06  0& &6&0R&0 0& 6 FK&0SR06 0 Q6[P6 & 0v6 6&00R&0p6 K&0SR 00& 0 QP6[6 06 606 6p06 6606 0{6 eiKP `6606 0{6 iKP@ 00 9%K0 YNK=K 0C @Dc06 P6[6 06 6[6 0v 6 6&06  0& iKP `}S606 6pK V  6&06 =K 0CpiKPq `66Q06 0&Kp6 6 XQ - 6S606 6pK06 0 0 e606 6p06 ?&  & & & &p & &6R& & 0K&XR & 6 v F 0p6 _K L6S606 6pKx06 0 0 0 Q^@  S. !0[6 iSM !06 `&6R& & @K&0SR06 F i 0 Q6[^6 F 0v6 6&00R&0p6 K&0SR 00& ; 0 Q6[P6 0ࠑ6 606 6p06 & & &p & &0@006[6 06 d6 0p6 &6R0&FKp 6 &0SR 00&  0 Q6[^6 0 6 w96&R&0 0& 6 K2&0SR06 0 Q6[P6 ? 0v6  6 v p &6R?&  & ;&  & &R3  ܦ 6-K0 B&0p6 9 0B Q@0L Q$\, Q   Bi 06 @ 6 v {p  ܦ 6   z&R: !&  r6 0 0 Q6[P6 6 S S S+v V 0v6 (v V ]v V V 6 0 6 0 w 6 v 'pq &6R&  & -LP@`y=44 0 Pv=@ -@P`pL_=0 P`= -kWLMϠP0 JpP} m H00 (Ko10 0 (Ko10 0 (Ko|0:?C0 0C0Yp Y pp\`P; 0G0 S  CS0 S  V #R   C S  V #R$B$V&*C$V"&0 Y Y @' p X0GpV F   CS(Ke{kG{&{ 8P0 0:0 S@0cA.C0< < 0 0c233ѐ:g{+ST A6C0@0 P 00VSXp T R4@CNP0@6@dp@0PT0  0X0 P RW0R0 c@cP pcL0SC X R T0PT0 \PP \ 0PL0 d0SX 0PL0 X0@ R0S <0S|K46S0\0 1::S0@p\0 d0S@ j?aCoc?`(?yPD?p k'h$|0X0 0Y p0 P Y@@T {V{ x`0 &2!k | K {[0S  {k&0 {`0S k{J[kk+SY#K 5C80 y 0 XQw [xk+;F{7KkFK4K0q@+Gk2kJSd ;0Gk2kJT[ {'[kK$F{7{0qZ`0X0 Xep  T 0PT0 $ p0S@00C0 pP0ST0PT0  \0S\ Tp@P   ! I@PMh[k[+S#K 5C80 gk[F{7{*E[{J&K#K00V / R= Y  P1/01[{kkKE{@{:000@ Y{7{E{:  T0D S s9Q@ `\ T  00QD0 0@(KX RX0P@T0 kF{`F[ ?@?$@@$|X0@ R0S+d0\0 V 0`S`P0@0P0 pTPPk WL0PL0 c `0STYtX0S? @Lp PPR \00 jS0S RpL\ /P T0DZ  s9R@  LQT0Su Y Sn Ik0fS ! k!{C2{& ! k{'0 Y{[%{[L T ?L#T0`S @A\ @00 0@B[kF{7@{k;;# S0@K {'[kF{7@{:000@k[3[JCk6k@0TD0S 0L0 T0 10`0@LT0S T0X0 zTI 0\0 <0 @0d X0 `` T*X0ST09 WP X0S Q\0`S @  PP Xl P  P| @L` fp{`P0 l 0ST0 P W< @0<SQ PP  0\0 L 01 `0{0@1[kkKE{@{:000 );{'kkKE{@{:0000jy S_{0L0 T0 " @I0jQ<F P  @$@?$LP zPP`F X0Sp0S@00C0 pL\PP0X0 ;@00C0YU LWL P\P < @0< S-p "Y p0Sr[{'kp[[ QK A F8 J0 T\P10`0}\P 0T Sp``d0S Q NPP LP79W$ 1pTpT @\P ]\P  L@0T D0S Q9RT ``d ppT@T \P E p``dT ,9 T \P T @.9RT 0``pd S pr<` <0S $@@H-M@ 0Ѝ:p # R \46S /R /P/46S// P0-L@00 R@P@0 0-L@PP00S0 0 R U0 0@! -L4M0P U@ tPE@p5A1D0 P`08 H0 8 KK<` Lp PP @P08 C R0CK@R P0<@ T #K*LpD0 @0<`SPPH 0BW *0S0B 0CRWPE:@0P @P& 088 P P0V  0*!1 R CW *  R0C 0CRWPE:@0P8(K -LM 0 0NK0P.0 C 0 KL!0!   , T P L 0 :X 0 R?K H D @ < 8 4 B4L  -L8 -L@ -L  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP// Q-LP @T0 ]`P  ,<00@Q  R@ -L`2?@~]PP   <q- Q< S 0CQ€ : Q0SQ0 0Sn 0-@L00p- 0S P0S 0CP*P01*S0n-M Ѝ@- p@ P` !LNL@ !@A-p@-@P` VP:p0-P@  P 0S RP0/P 0?c0 3??oPP0/0/ -LM K 0-PLM0 L0P ?@P$K0 BK0K0B 0 ?B0 00/ T -L @M0K #K@  p`K -- LM 0  lC K -LM8ß8 P@T0 p@`SQ @B@0 0R(K@qk q 0SV``2 0 Qz `V`0-@V 0 4S`R#08K !- K q A Q d @p P` Z& `@ AV  R < Q0@ 0 @ @ :=  @U  :VP ?oV20AOKSQDT WY9:V~ 0 4S`Rx0 ``~S _X` p:`H`0``Z~@c0`0b `   R RU0@Y 1 !W Q:@0A 00G@B @ 8 00-L@Q r  00 S 1 0 PP   ! : @00 -LMP 4K0Ki40 j Q@4 0 /5ZS 0S SS  Q0S 00080  4P`pp 80St0P R" 0 0 NA" p0 0SP Qz`p0P0aZ0 pP  0p P  00p 0p (K0S'P080 QoPCUPS RQPU  0UKV0Pp pDW4Q` `P47 p'p@ pg W V ` 0 p0  2 0080 ^a` p@cP0 p{80 ) o`80j pR`p@0v !R0S 0C0// 00-PRUL@B0!S@ *S:P   `2 0@0!S@:  P --LM` 0 D<p00 ; 0 Kx`  0 t0 0-S,     0 x` 0 0Qx000S000 R c tk `K(K00 x 0S 0S  0 C R P@ !T 0PBTЁ00Cx 0@0 C R S p ERD00 x`0x0 0+S -S  00 0x0 00 C Rx` .0Sx  x 00S 1 CR"x  0 C 0x 00C Xx ! 00 B0C X h8R\ \ bx B00 WI  00Sl  S ?o20 ZT@W``g{ V{ ڐ8 fk01[kF{k 05SWӈX_ X%0gXʜX(0g c1k{!{'k0{' dK{  00K0 0 P pK e Y# 0x` 0 t ! 0S ;0XSs xSq x 00S S -  R \ p < Y9 \ x T 0 p 0 C R,R0x0 S00  p0GS1PWЁWPpWx0x0Ձ x 0 pK`f`VI  86{01k{'{ `9 &"R50kh4656h0 {{'AAL \{ 0 h !joF`FR`h   H50{  0Q   |Ky Pt n | p0a`Yp`  > p` `| p` 0`0Q +0Q0 `cVJt\ |0t `|` 0 Sp 9 00Rs0 0 00 06X0@۟˟0h0 ? 0 ̠ P\ P"   ! 6t0Q pP t   !6|0dpP0 - PP U00`e0P a଀`PP `PcP`PU  X 0RPb`bbS k P  P ^ pdQn pP 0S S P V  P X  P $ `P 0Sl@ P  @ 0R0P0SD 0030  U !0e0 0H0 0| 0#Q00pS00 KKH PP Qy PXtS 01 t Pt v 0S0 CQ0 SS |0 0C|0 0S| p0T0  b/o" R (J{9Hk{Zțʜ0S0@0 =    ?@?AV瞯<$ N|ԀLDf$Up 夀 p̠W!0X0 ʜ0 @0S@T# `P ` P0@ 0 p0t0b| p0 Pt  I0C%Si2I0S x 00S 1 CRpp 00 x@K!P  0 0x 00(S00  00t 00S 0SP0 0Q0000  @00 <"0t 0|x@KPe x00Cx0 Px00x0 00 00 x 2[0 1Ck{0dK{ 7 a>P8 0  0UZP @0S@@TM֋0H0 0Sp p̠0S p0 0  p0Rt Pt & 0 CQ0S* |0 0|0 0R00 t# Pt  p00Cp0 00C0 t0@0 0 0 R 0tS@ PU@0  R @DTPT6@DPp t p̠0@C0p@ |0 [Pt  ͛U   Z{狸0JSH9 S%X@J狸000c0 00 00 GNj_ZH>ț[Z0 p 0 p0 ̠[0 00 0xKt0KPP s0x` t 0 0tPbPt p 0 e|0 p 00c0 000  ?$ `f  $0[01k{{ ` &2ST  khp$&%&h {{'ALA\ { 0h  "j&oF%`F&S`h    { 0 00 00 t0  B;"00q010 %0 0  R@I0 pa00 00  R| ft@0  0H0 Wtp0 0 p0 @0 00K 0 0 lKpP010 0 0 R]e0Pt  0002l 0Rp  h0dK6 0) c0`"{ 0!k5S00{'dK{ 00 00K0 0.Pq yʛ 00S S Sc t  0t  00 R05 3* Q00    0c230 Up 夀 p̠{ 0S t |0S *0| |S: 0Q!0 00C| p0 |0 @cT stHt 00 p00dp0 X{ q8pK 50`t0@ x0QPWrO0t |0 00U!PPp P p̠0S|0S x ?$0p t p̠0 P0 0 0 p0  0 0 =X!00 & 0 0#R00St0 U7X  !R0S 0C000 dt00 0 倀 S! t0  Rr0 S  lp p̠`x 0C00 0pPt 0|@@d@T|00|0 !00 L -L00D 0 -RPP0L``@PE 0pa ry"()(8#80ᴀ8V#8 pgaP *q0(!"( 0(V"8S 0\ 0  0vPP   ! 1@ -LM3ß0< 0@00 00S 0"0@0 1 80 080 <080 @ AR 0AP0Q ` @4 \p# 0 QJ \4R\T#3PQ `Q e<V TA0\pRT T0#03P0S  0`1 c΁0V TB 0 X *  X*800Yd 08S (KP  T@D 0`D@4  \0 \0\ XQ \0(K@0S 8@0  0c1300)LoRQ )\  pR R )R<0pp 7 XRM \0JH00(K< 00n P -LMp< 00 4 8(0`00S 00 0 0Qt @00Q PWPU Q  R\  \PQ pQ P8 @ S0D 0Y^L @0S40 0S| S~ S, 40P@R``0 000U` 0 0UV 0@dSD40< @0 y 0\P \Q R8   e!8 PQh pQf YP[0d0CSڣ0SpP ^ 0 0QUV  0UEY Pn R 0U P0 0 UjAB40`PP~`408 0R48 0R@bU 0S: S4 S* w7" P0 (K0(KP 8 +Q -Q @ ( AP ࠃ7A LP  >LQ@@P8a8  R a @ Sq S0S D0p000 400p< 0!7" b0 0Q@0Q oᩒ0,@eP` `D21 2 Q rP``80080 eaF PeP408 0 R8 D6" 0 (K @ u`=P`KPK

BD0!̠ [SC[C[C!ĠK[BpW AP*1 R&00CS" 1 3/@0P(r01/P6 !D0 10C 3"!0!NpRO`mRR  *00*@``*0S MO00S 0\000*0P0P*`*`u*`H PhaPR -L M@(`10f0pVP(p V!ء9FP0 !1 0(!1 0P1D 1D ,0 U ,  00(KoSꂑ 3D0P  00 00 h)UH001(K 0-@ 1L3/,0( P000 0-@LQ 00 210 * 0 -fLMS`) p0 )00(KX 10C0s00C S 0!{/Ⱀ1Pf 2 c 0 fp[ d000 P| 0S* !1 0Rf1Y01đa RY` {0!Y P$ 0㸑h0 h 0  N0B0s00CQ q P0h 0s000 o!00t  -L$M(p  QP@`^ q0GM0 p aQ 1wv0@1Px 0p \ÁS 1CpP @q0\0s00R10C1(0 0S (K0 R1V*0C1  p 0 0  p 0RX 2 0(W X;10C0s0S4K% 0 4@ 3K P(00(040#[0!0v4@ cK 0 4K 4 P(00(0dXQ410C0s00CX Y4@ 尃K4K0H 4@ 3K P3(00(0Q P 04 K3K80 4 P807(00(0   P 14 K0C00C4 3Kh P (00(01 C r  BX*  ap000 4K4@ 尃K Pi W N 0-@LQPQ0 P 00 50 P 00 (0 -L MP,p10C0s0S10Sv P%A P aV0FW S1T f@P `V0ഠ 0  p0  000(K1 p a 1w扐0pFVwp1 0 P Á^p `0L0v0s0S 0Cs000 P |RL  R ZP0 00(K 1 10 -LM@`pQ 00 RP)W4 W+(0( *  `P 10C0s0S 1 1p0C0s0SP  YW p 20 2(K0p0(K0K [PP 0 R p 2 1D0C 0s0R* $ P0 P p !(K1 0C0s0coᨂ  P 0 p% RR B 10C0s0SP$p0C0s0Spp X8  80p_oRyPy p s0p 0K80  P `0 RV ,0p @0   r1p`p0wp@Ut@0s0L<! P0  s0L 01(K0 01 0  r0   r`Fv` 00s0YP 1Z0s01‘WL P 0P 0g01 S$[@dXt@ QAA XP  @ t0 P0 t0 @ @pt0  h[dqp ht0  t0 S 0S 2; D H0 pP  AT0T @DTA H D50A0$[s0S  bL 0D0H  p SRP  X    !@  P  < 0 4 8 lp3/ 00TX  @X  P  @ T  D0H  p(  * -L P`4@P^ PU7 2 MP0'  pW&Q1 0R   aP> P10C0s00C0 P00 RpW 0 10C0s0R  0R  PpPp WP 0R P P P  -L,M@P`Qp 00W- &W W W 00(KWDW Wk WD0S 0S 4K 80KJX7 (K W :0GS(0oW,0p1! B r R  1p H P(KW W& W$ 4K40P 尣[ @ 6@  p(0r00 (0帡= ` 2 ]400(K,0p110C0s0SCG  g1p \P 4K 80Kp 80Ss 43[  1  ?P W W W8(07X:WW p WE6 1 4,W(0!1 B 0r s0S 4 3K4Kj4 尃K4Ke0C3K4 4K_00!(04 #KU0Hs0W4 p W  P: 0 P2 10C00Cs0갃K4 ,꼑 gY  P 0WS=qWG U4 3K,p꼑 LY  P 1 X0C 0r s0RWH p0p1  & P  0Cs0 q1 0C00Cs0i !p0  fP -@LP`P k50 00(0`00Q(0 -p@L,0$MH D0 1 ?0P80 A0@D@t@T5 @ < ` @Ѥ@s`T! PuPP @DP0t@80 008!01P0  @80 0~VPFuP0P80 0 2 < @ `|80Q`l P4 14@K0C00C 3KmPP 8r0@ AD RH 07 @DTA2TA `P0 RT1D PR@C08` 801@ C P 1!0C00Cs0PU0@8 8 ,80<0 <(K0H <0(K 2  V 8010C0s0V80Q0H <0`(K mP4 @4K  CKPPS 80@ AD RH 0 @DTATAB GP !0 B r  BS% 1D PR@C@8 8!1 @@崀  P@ PU@*8 !@t@0@8 1 48 4`}0Bs0 U08` !A\ -L MPRa@p  b 0SA  0Sh*;20P_  0 v 0 0S6 06 0S  0QJ 20PD  0000 X 0 0(K 2  0 0 0 (K 2  0 00 S(K  00 0 P 0 0(K  tP00 0-LM@\P0 R  ! Q s?0 Kr?JP 10 0 0  1K3/K00@-$@0U1!^ \0 \Se0 a0 0@-(U@1@!T  \@0 ^SU000 -LMP, `( (@@0T"p؁,H(@X`1`! @f ~T(@ p, PP$K$K21P p@ -LMؑ00K< D `PI@0 0<0 NPU  @<@P Up1 p! 00 0``aa 80 AX80D PU0<0 )(K(K -LM` $ $ }P 0 q @pG pP @ P$P 7W@g:KK KP/0@ 0A0S *Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@- "A @ " @ 10-SL@P  P 10 2 0! 20K0h -LM 4PS@  $3/pd0 P0Q P p{4P4S $ 3/ 000$K0 0 4-dLVP:@T@T 00S    00 S   0m.P`0d0p0 0C01 0 -PLMK`p6P$0: SE.@P +@ 0 0S t K0 dT KY00 K K( $$4/ 4-s0L@`P0# |P4U040 $000C0!0Q  10 00  0% 00 T -L0AS0 0C 01  0 00 S   00 -LM4PS@`A`q0S/0S,  T BP e !P 000  R     0    0(KPL 4 00 4 0  0QP4400 z$P P52E00@0000S0  010 4 S  $ 3/0i 0 d 0 0]O 0 A0 000/ 0-@LP 0 S   0a/P\/0 0-@LTP @T 0 /p0j0 0-LM @K $ 0 0 0 =h h0 0QP00S 3/ %㪝u+  -LMT`PpK00 $0 00K(0 ,@ @ (K P `h PK -L M0SPJ 0  R pzZ`@p* 0AT B,B R   T11 %  h 0`0`S@`0 T0`@p`@pT  T 1+#,03/P0`0`S@`00(K0`@pT S  PP00f T1 !  PX\00     P00rZ  ` hR@h .Pp0xX6  h Z 00PP 00S *T  000~P?u T4*  0 d0 0gT Q,8/P#0000` Z:00 W,P  00 b 0 -,03/P70 @ (K 0 O 0 J 0-L` PU 0@0@eTP0@TP ,0 3/Pʼ0@00D0S Kh/ 00-PPL0 \0 @]0 0@0, P~ @}0% 0-L4M @D x>R@0 <0 80 40 00 @T00 13"000 , KDKP,KJ00% -@0 DL4M>RD 0 @0 <0 80 40 2K1, ", , KDKmP,K#00 0-@LЛK0hϛR q0\/ R/ 0-0 00L0@S 0  R* 0    0#   0000c00/0 P @P ,0 0 $0s0 :0#  -LM@Pp`pP pKtP04 :CoR  S  L K; 0K ; 0K (0S  " p -LlMR"P0 @0 C 00  0 0R(Kx K|K00T) |Y(P" 8"82x 0Q0P pp;PP0PP 10000Z 00S!pK @ݭPHP? F0B/S8265432(0/.-,+*)'&%$#"!   x  xYPfp ``pt0K0`3t0SP| ! l p-L M@0Pd|00Ta|V K|0T1S OS|0T1S |0`|00UT\1\X1P A|Kp0U\X10\PX1|00|Kp 0-P@0L&|U0 \AQ\ X10CSX1 K0h|T1O|0K0h |`|00 000S/T \ -0 00PLP0{00TAv|T0` TAT@ {X1@0X1e|0T0`X1  \0 000S/ \0 000S/TX \0 000S/0 \ -L4M<0< 0@DK00  0RK  t,@ -L M@PQ4PKT0@K 0 00ip`  QXW QV  V0"00(K V0 R0 0S"0 0(K R0(K(K (K 0-LM@,0,0 @@@K0< 0-0 0-L@PP P \@00 -Lp@P`P }P FP  ^T@0f "0@0a 0@00Z  0 Q:// BQ:// -(A(!@0 000 0L0Q9 P`RP 0 PQ  p$@P   0`R I1*@Vd@0@S (*000 !B e!$Kk Pdb aa 0-@PLP 8P0U0 =S0=S00| 0-8@@@LPP0K0h)` 0-LP%@P 0$ P0400T` 400-0L@P0 P3#0 ` -L M10 000 @pT4 ^ `P rP0=SD @PT40SD  448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/ \ -L -D0D 0@L0P Qp`@`8 //////~ // -L,MdqPp@`T T@K]( f410@0 (T@ L KP0 5/(K.0S& p S$ Sp0S S S0STY^p00Qd00p T00 @000$00d000h/X/D// //// -LT0P DS42  $ 0-@L@@ 0P. -LMdΟd `Q 0 0 00 00K0 ,>00 >00 >00 >00 0%SSpp0S 0P@ 0  0DZS`Y    I[ $K3U(tP0 0 p0R ,K,K0 [SR) p,KS0 Rp p@ Ԁ LK 0f0  g0 _Q P@PLKP@pԀ00  A 0Ac RWh  `,X^ a0  V 03L05`2\ʼ0Wr Vp5`2 ^aw V03 B5`2RP: V 502 5`2P*0a V 30C 5`2SPl 0 p0R QP[ 0 0l0QQ0 0 Ll 0 0Lc R  `tP(   0   0,KR0#0SO K 00 0S[F0 00KkhP@ V03L5`2\ʉ0pH  } 000 E 00V S[ţP\@ 00X0 @ P@ WB@ p@ +p@lT P @P P@ ,0K  c ppp 000 0Ss00 0S[l 00K@P@ W00D@00D SO[@ J@ *T 00D S00 A @! 00D S?0 7 T R N@L 0 +[ \ 0pS# R0 P0H cRp ` P@  0Rp00 0[Sp x@P 0p0 ".!  c cTb ,0K@c c 0   V 05 `2 V*0p Zp@ƅ ``0 R,K0 ,K r0,K0S-p[ţ-p$  Y 0Q p0QPp [ 00K,)  Ppp Kp K p RQ[! p V0 F  0 Q(K0 00 ? ]<K 0Pp K K0p SQ[ pS_ @P X 0p0pS00 8Q[1 00K }0@000 0 w e>@<  ?,K = 9 p pR K K [RQ p~0p Ppx@0 p `0p 10.@, 0S0  0P\ [u@ (  0S0 K0 pI K 0 RQ[j p?p `J0Q p0Qp [S0Pp Kp p K000Sp [E<@0?0 00 T 0 ꔷ4 ث̫ -`d0d 0pL0@TZ tXP 0@DS 8/t`XPpW  - 0LS S S 0R o 0R0 8`o -@L`p60@@P@ ҟ( 0$ ≛%Ph d -MLMA@P X 0 0p X40 0pR0(K  0BnK]K `F PE`FPE0  P0.P  ᒟt 0d PGL0+0\4 |j\4 4Kvj5Kڶ hHO -0LS0 S,QU) Y&p`@ V@ 0`S00 P R R R R0S  P PU 1S3 ^ \ 0S 0^@T0 0@8^ -BMLM00 P_uPU0C~KD @ 8 <$ PE00 @`pG'PU%:0 00wyP@ V:yy84<$ @ZP@jPD40 0R(K08  -BMLMp`@@ @8$ TP@ _<4 0 uP7 0Q4:0x0(S2 840?s0U @40 0R,(KUPE% CKH@V: yy<4 0 84sP PU:H0 00yP0x0(SԵ  -LtϟoM M `ϟ&    6 0 + @T0 !R  R# `  \?@ X@00& UN @ 0 & z n R R4 k 00 @0T pu_pp0SAC 0Sʰ00 9 S^ 0S <& & - @ & -唦  ' Tb06 = 06 =06 v?6 06 60S21S/ &3t6 0S. S006 -K1 B& &021=K6 g>K0C6 g>K0C6 ATO *Pfvp 0&4/P񏐮A;1&n R  & R ~  6 @06 T606 606 0& S& 6S]6Sx <00x60 0RR(KPUm A0#6S60z&S6& 7  VP` P``60s 6 0;G ȵT6 S6 BP  0iK?A =K 0C6 0C`pe^K PE@E6 c>K 0C6 i>K 0CA&  ` C f >l:fnK07 `: `F0 7 T:06 2ob^K6 PE FPE0  0P p pP W6 0R0 `1  : PXP0SY0  M06 n66 6iK CAR 0/@L6l ?A9c1"RP0 0S  6t6 0S06 q PWPE, BNK @D@DbK  J~0J6 01U6 06 *@PV u Pp  pd2v01@0@6 S P @PpqVW CNK@D C6 ‰6vP160JQU 6S0 BNK @D@D00t 7*PD'0& X 6 P6 `1 C 6 P XP02Qj   0 JP0`1 & p6 PXP06 00iK6A C 'c>K 0CBK0C Hf `HuP@ Q PL ` VPI R P> p 0 D6 P40S G`0 幃Th  0`   &4@X@" 0 Y0  K10106 ff@f0S}e006 X4$@ X006 bK J0J6 01U6 06  !]&P 0 ^  3 X0l0& & 0 d3 @4X(06 06 00 u6S<06  60000 AQR A > 06 6 SEl=00 JD`1Su 0 ᥁P0 S6 6 6& 6 h1Se &36 60Ss S006 06 1cnK06 1`F06 |106 P1i 6 彂P00&eP101eNK6 @DPDsuc>K]K 0C PEpC 6 &6 60Py06 y06 0 P0D ( \Еx`8ԒC,X @Dpt(Dh\0Ԃ`0TP `r R D0D Pʸ0@6  r6T,6S)06 u 6 ]uYpX0[0&6 D P0TP `r R D0D 彀Pʇ06 4 Ab06 x&R  ir R  0T `r R D  R,#喀Pʤ6 0R 0`1 i 1 0XP0XY0  JX6 Wp 82 0X0B xv & C`!!,! R? `!  2&@x&X0Y I0&R AT3 *`g^KPE&tP 04/P񏐟%"`V A 0+0CSq 3m t 3@ X0066 3 X@0Y0  Ii06 4 X0,J0bNK @D-K@D B BT6 冁PKP1011S~1x0 4 @Xz(06  0`imꎰ @W  xv 0& Bu06 ro06 l60 6DHa0+0CS  3 X RQ  0M Ѝ/ /M0@- !$<@ 0 Q1 e060@ Ѝ/ɚ;M0@- !$@ T0\l  Rl00@ Ѝ/ʚ;M  R0 R0Ѝ/0 0bSЍ/ 0-L M$PK@sPK04KrPK?, 0K000 0-@L0M-   Ѝ/M- $ 1 La Ѝ/Mb -AML Mq1p0<4 0@ 00 P$ \PP `CNK1`K+0A=P 04[S ! 8$ 00@ 00@ 0Sg<40 0R)(K`cP840 @S 0S0S 00@ @@dJ  @b @9J4 <) -CML Mp38   #0 @ D$ @`PH 0 CK00,; 0 ```p 0 PC10<4 20S 0008PM0P" R7 !8!2  0!R S00 0 @00 ; P0 <0 0;  P048$ yr8$ p X6<mrD40 0RD(Kp 0Q Q1 Q* TrHK 0C0C @80;,0K TJq {0,z - L@P`~P KhB -CMLMß ` p84 0 P@ Pq@T 0.TP@TW@S5.@D2Oo1B1U d! U 1 #R 0084 0 0MPZ @40 0R(K0L$ H4 @$@9 @L6 D DR1 @DD p ?p8p 0S   0< d0p 0 hC4CL 0 ST U00Ë000 pgX s -LMpP@`-@h T@3)oVpo0fo o0 ?0s0e?0$K  o o0 ,}9 ( x9(rr -L@`Pp帐ἀ@0 dQ WS! oPo@ YgpGofF9r0PM0PЍ/ -LM0P4 8  @$dt唄唔 0`p 0 S-0 S S  |P%  vP2 pPV  jP40[ 80  SR 0  SRS(Kc?d1P00d10d dx`P?P000 DR 0/P  (P  !P"0:0060 &?P000 (8  "000xgl P T P090090 P  P010q090m P020c  0P<0 40SX @?P01?0# @0 40j^4 @00< ["D4 0P<0 40S9 @?P01?0# @0 40K^4 @00< [(#% P @ {P010  qP010 TrqqqBqppAA pptoppo@T@`on<|ndnHn -LMAT $Kz$ 0K( 3( $  ( {0Kc00K@@ p-L|M0 0`A T  Kz[ 0K "'c0xPK06 "6@R6 0KR[Kp@@%븠 H -@LPcy 1!01n0SPpuOPp Ryp0S 0-@L1S xp Ay1|p K 0C6  v|P1|xp Z>Kό 0Caw@0P%x!x|#0 & "    P&5 A   rv`0S= D&R&`0`SH DH@ ` .S`0SPPU00V0S .,`FV00U0S 0 7hP !  =L&00 0Q0J(KCNK1P.P `ZD 0 C0SQ PD 8 0!x3!|3P@4DPQD@ ŠQ34P  H fjiD6 ,6@2 @Ps@- -ꭦ HF@ii3 hhhh,+Cf0e cc _``__t_ -L(M 1P 7؀@aYX@ T& 000 $K pQxp  \000 D0KuPT 0000 $Kt\A-P PR0@p` ` 0PR@^Î P pP` ` $0$00-@L削0(  -@L,0KSMA#T P! HQU P1p0P d1 `0PhA XA \! ` PT  fbP `P Pi `Pd P0S] X1SH@0T1 c 0`Vh1 \A <0pf`ZXA&  00a@peZ` #T APWQK*HP 0H1 P1d 0P 00(KP!`d0 aQ*TQ\a\1 W:\0 X 0,K!pc0 X! \1 X1"S P1H0zX P1dQ 0 HP M0H1 X1Sj P0 1PhR\1 0 :X` Q00:TA p@0 jRK  pWb: 0 0 pXTA: T`gp% \1@CQ?KT1   0`hp@ Tp T1 V*`HP P1 0 c 0\d0  [ P1d 0 XQS 0-(0( 0@LP0ʷ000 00/" 0S Y 0 0갊  0-@LP00000 0-@LP  0 0 0-LM@ 0K    }P0 P  aPP u  0 K0P l 0 -LM`1`0\!XQ Pp QpGR`, `0qp5 K A@gP! 0aP 0S@0S0SP@  `0 K| | t 0 KX X P `0 L |TT4]]T3`],]$3]<]2 0-00LS# S#P0SP1q@@0``c[0P  $ 0S P 0E`1(`$ P 02~P'' -L,Mhh' `7@ 0 LG00 @D7 R 0P  g$ ( '  8 ' 4 ` < SK0S&1 @T @TA !Q & 0H6S 0S1!Q3) 000SO SFH&H0@ 0( 0CPQ| AW Q ^ B:\a(K4 Q FT-ڬ%(dp0CSJ\^ciuz0S 000$@00 0 p y 4 0( A@dP(7 P@( @0P(0P 0PS\$\4 0 P 0D L H0 Jpp D( 400 (  40 ( 30( D0 \D0( 30( Q 3 0(  3 0(  t3 0(  `3 0(  L3 0( 8#83 0  (  30( D0 D0( yRP0 St*" @(SP0(0"0 0 S c 001|20( U1P P QS <0W80 0T *<20P1(?p* 80@( \CQP R! @(SPl1(1  P&p  dp0HP p 01g!LH0 Q0C   ՊD0( 0(  0(P TPtTS|DS SRtRY0`H4t X4 NNMMUPUT*G-0100,! M X5* 10@ < 0 ? o_^00S 0 0S :Pŀ 000P X0SYЍ40 0 $0 0 ~ TS -(0(0 L⾅ㆃ,} `E -@L@`V 0 CQ𨝈PqP pG P P 0`0\XV 0-L@  0 S ^0^ P PQ1 @P0 0D  $  0T0(| D 0-@PL0T  0S  T0SK0hK0h@-P0@ 00h  0Q,0@0AP@, @10$000z L -L@`PD ` 0S (1S0 $00 0P -L`0P}@P PxP 00S - 0@SLP@  P 00 !   $  D``$p0S hy l -LTM;+0 H ( R *P @ :H Ԋ0P0 :僯0T0 <00 X T0:DP 0L0 `L0X 0< 80 ^O4` 00 0S`8P 4` < :Pŀ 000 P:P4ZcVf9y)0p` P<40 p -LPjP ` @P  K -P`LQ@ ;00T T(0 2S $AP$00C$0~0@00Q 2Q@AP@ 2:0 2@ -L4M@`PQ 00 Vz 2+ R (K 6 0 %0+0 "@0  P0KD0 $- ?L`KDpK0 40  08/P: @R F@cYt@0F"  bDV0ձFF i 0J 00P BBCQ0 00`0008@@0A@B80000 @Tt@ @,KoH -LM `PV@q wQ0v` F 00`$KwQb `S1 <0Rm 0 @ `30 0:Cpj P+0SI 1 R ,  0#, ##$\0AA A0$K<@P 0 墴@00  0*:P50SQ  0R 0 ! !\C0 0 0t` 0 Ss0 C  00$Kj@  0 O 0 t0r p-L M1@SP aP8 0P,000BP8KpKp -MLMPDDŸ p K8L$ŸW py@0 n 2 R! hK(K,`F0F< B0  8,0SE , 0 """\  CCC8K<0CT*0<0`@P` @@@ᨊ@? D42 d82  0 HBp0 W/8K80C00 0R,(K<@X@0V F0#\0F0BB8K<0Cⳳ@H]pO00M ' -L M @ pPP 0H2`a 00 f 000 0Npⴜ0Q(K(K -LM40@S 000 P1D40 0$p@1D<0PU7 U 2 Y 0S* ",, ( D, K8 08 PO0U 2 U04 KEP0VP V$P 0  50 K 0  K0PU U0(0 $P0PUP`P,  ( c013/p0 K0P "!1 h, -L$Mq`@TP  ppp/0S@P0: S ]P v0S 4KkA pW :+@[0 T@@ :4 KA0 pP00CS0ၟ@0 @t` Pp 00CS0Po0 @Y@DOoB K'fx%t% -LAOOUpX@ -LyM@`yQp)0pY唉唙唩0000)DpC aP01 NP' HP LP>000#PP RP60lP% fP )  iP+00 rP vP pP"00000(0000000000(((0x80@cT2 ջT80S 0SH 0S0S0S 㼑001 0S 0S101 0S1001 0!S ! 2@DV7V7V7' 1  P tM1P/X  1!08001皻0S }KAW  S/R C C10S}KWp$0S & T|F0Sy 2WKWp2!xUT1: Sz 02 2/XS D&H=1: SY02 @IPU `P0@ /Q  D0P2 '2S@X5K0S VpX : S  S  S  P 5 QP (% ,j,@P 50CS)()(()(()$ Po u 1`00 a00 S\ ”eL0 S2S, /Ph PeP,0 0j2 0/S 0V/S/00`2i  Y̓ !%":*"O2#0020#Sz S/Rwx C CVwX K QP! KQP  <`)X00: S 0: S 0: S  xR Sf SX1U L0SP !߹N0eS P20S V  CVp2 P 1X2X"X)Q UP*0: S9 0!0Vx10S !00C0S! 1!㷷P 2P X0T7U P0S !׹0S !⯹Py0S 0κgT 0S X00S~L00Sz2WKUy0S0S~ 0}ꢑ&&&&&p&&&&&&H%}&&=% =%pOU;lQ]=%~؍%a6 i? +X -LM@PCwm&oAp$6v@Fm$PPp6($08p 8p;TP($ 8c0F),6 80 R 0^Ff$P0(058p$0!0 5%8pTP( 80 0%$3/ 0(0 0(0tS$ <(Tu h50S 0@P6,5Ѐ QPP P 0000#0 ļ#0 0; S 040 !"08(1/0xtpWph Ud\"P4Ppp p g8080 CS s p4 #K0 4Ѐ  0 KQP W  80 $0(3/? 0$ 0! P0$ $ h $$M룻 0  80 (!1/0 $yM0   "!SRŸ ! 0  ! 0  0!  0  ် 0 ~ !  RT80 00103/f1!0Sι!Sѹ!Sڹ0 SRQ* b_! 0P@ p0`  O!`Vp ` 0 +(PU x08003/p0S80(03/pe뢑eH%Ȑ(&ӛA%}h& &Ǔp&&D$H$&!&&&4(\&Γ -LMM`pkukJЊ*?pZv iP/ aP GP0! PPd$0gP hP^000mP kP lPS00nP tP K0 0001000;00 0006000SPU 0SbnS0oSP0 00,P PD2 0P,1 P1PQ0 )gd0S $0S 0S $0S 8 0S8BK崅P`hA1SBK  ChxP @D0P 1 P6 K:SP嚻P)0: SP 1P0S1   '``ᗻP7  10xKP`AKN@ 1SNUP`@ U0 0@1 0V$1 1$!S$1fq0@KS 0 000f!)f#x"f|0 f%xf}(00S(0B0S,0 S  S$4&46P50546 600 040 0S5000⪅0h5$0S ,0KP 0X/S / ,0K0$C`pPU' ڼ@0/S P@/ P  ȼ0 S@: L=p ͬCK DPp@_뢑&H% -LDMP@(o8$84 TdKzMP%KdK&KLdKpMP%KdK&KLdKfMP%KdK&KLdK\MP%KdK&KL<3C|3 TK 0}PKT3< KTKT0 P< KTKP <P< KP"Y<0S < KTKP < KߋP<0S < KTKՋP < K΋P<0S < KTKċP < K㽋P<0S @< KTK T@ 屋P< K㪋P< KTK㣋P"P KaPR!>1Tp x害@PpA d1R@ݻPPd 0p/S P!(1P q0U  ᦸ 000/00E㩰00CSlSStSSF00S 〆0s P0 JeP00 Kx%''h'Plh0F%'5/''w'Tw' -LP`mjd@ '8p LP PP@T00U TЕP2P - ]뢑 mH% -LMP@G`m07dP PP ' 7p) fP0 RP PP( 0WP dP"0rP iP  vP xP0000 0$000 `6`jV0S q<P`V. t{@`P/P`.Q/Q00@Q .QQ U`W   Q`P 1S<  85R`  R 0P?o20S$0 S0S@ᝯP `p㰤 ᫰PP 50C SKXXXWXXWXXX0S! $0S$ @c 0LS0S $ ?RR00R0SX5S+ S, S5& $ mc 0SX  (P  űa!SR0SX  P JIP 0S 0S 0SCKPiP0S 0S} 0?Sy ~0Sty0S  ίKJP$0 S`20 !0SHC00PUkY0S U0?S Q0SS b b 0: S RW00  S/o" R0: S I KP  SJ 0SJP KP0SfC00 0S 0?S 0S 000X0S h\ lGC00 0S0S 0 0U(K'H%TOUXp -LP@kWbp 6p pPp 0 U1P0C@)IPCPPW` /<P 0S 0S0yIP B0P[뢑VH%p p-LKM@ D 0I8 0I < HP Ә3 bҰ|30GK41 ڍPP `30S S S J 4303 (3 041 3 3 20S 41S 260S 20S ck20S KpD 2 20S B00CS00 _ 0 d _41S$D2G/K I 22 jxK0D@DI1n0S, @10S 0-S 041 PC041 LC41S041 t16 R !41S BM0S 0 41 h1 (1@T. #I81S 8H<,Hcc(I<1StH@ITqH@ITc0P 0S 041 C00S@0P  `P@C\T000S000S (0^'$G% ''''4'4'''H%$H%' ̪'4 -LM@ Pj`3@ @0S+`q,Y!"4p a@Pbbbbbbb@b{GP x㵂@@L2\ 010 0K HP80K8 P㛂0Kd HPvA0K$ HPmAT *00S 0KKK@0l d8[r0K8o0a`0 d0 0Q6 KKYqP-KK'oP(KKqP#0@0 000K8P  @\+\+ ᰳPo0d0 t000 d0S 0K8 pP|`0S 0Kd dhHPTAY뢑L%H% l.pBt @ht@&t@1%<'BgtL -LiFY -LMpi`x@0o0C?oPc2胟0@ @ @ @ 0#03 M1p( PP# HP LP P&@fP RP00 hP vP00 P00 00 P P3Z ZTAt0S UPPY 0SPP 㓁0SPP T  1 R* !: *wP . 0P0  hp0@FtA0S #St1 Sp2tKGp W 0R 0  epPP|P u@PG 50C S+h@i@ih@i@i i@i@i i@i,ilh0S $ PR_ P0 $ PH_ 0S00 3/00#PP |?P0S ꂺ0S HX뢑'l.PH%H%IF'>OOU4pX -MMLM`oJpu_o1001 p1001oy9p 00孭PT t t 妭PY Q PPsP H 0S1 4 ? 9! ㎀P)n2p A@6P񟗁HllTl`llmlllmlmxllmlmlml@llmlmlmpmlmlmlmlmxmlmlmlmlmlmlmlmlmlmlmlmlmlmlllmlmllmlmlllmlmlmlm mlmmlm$m4m0N01.00G01(01%01"p߶P ٶPts/8t,0+^p& 0$01 10#10101 00 00U6QUPP70`cV>s000USPh4\ x6QQ00SP& vpY pW pW!\Q008&S00111S 8zon!R UU0U0%;xupP%&1hS KAEP4: S011PEUr0stslsslroV01v9V8z(}$5P050BK% @XBK @l2pPBK A_>9@P D$t4 4`T0M.KNK BAd d d 4 DNPݸ0#S MK AC@1>}%MK ACD-D|DD+PC@B>KNK 0C @!4S #~pP#]NK@e0`?o2? MK AC4SCBKd @Y@PBK A=8f/>PvxX y@PBK @+E\zXߨ0异0CS0᥇@0 @ Pp 00CS0d唇0 @NTgBK @EmVly0S*1 0S*|1 }V11Xy1PQS1S ;s|! D1  htsPd=VxXP 4~uP +00V,4 yB.K B0yPy~`FVlP@~P  f/t 墷T  'sPPy V'' n `   l.'0 Y- H%G { 'pH%'5 /p'%L    .<L  %md q(' p-PL M 0P @` @ QW$K$P 啄h`00CS`0X XX0 X @T@Kp'% -P@p`0L\MhP dP `P \P XP pP %t0 /pt0 lP aP$P Q @R"dPpP nP p rP tP0p0 `$@hTlVV!Yt grVdV 8x0 lBPx0$$$YdV0 RV SV QV0X0 pV\ rV. lVT p  S hKh K Cp  hKh Kx Cpht} TKPT K Cp@( TK⟶ TK֮U  T0KϮT@D`PtpP L}PT4@ 0` T K CpP` xs L  Xj C  Dd= l0K0" `5 V >[ lPU 0 Q 1[ |l0Px0 S T`+p0@SxVuV= xE d1P% \1P* PP) 0YS p r`Vt0,pK1('|0 r xP0 X V_Tl |(K l.H% 4~D D {D!!|D(!!.!=!L!X!}Di!{!!!!!pyaratcid!x%$ 0-.ЎLeM22222222220N_  1 1 1 |.A.pV bP !EPI 2PA 0P< 1P0;3P; AP SPM FP0F IP2TP aP02sPS iP< cP fP02lP5 rP=0dvP: tPb uP02wPX zPb 0000` Kb11000? < T,20202@\l0 @wUT,202~0`/2qpP000pS KPp& 01 Wh /nq`P000`S K=p 01 VU /[qP000SL K+p01 E02_?K0;00C eP |10S h{2 S;2)L+_?K 0 B<NP : |10S:|"QQ"p/qPj WKAPT1: S00 `P /pP0 xx EBqzPTL{ @`P8 ):V|KAp %KcK *0R0 1 S *?1P  :9)1!4)S  ?1 )?0?0202`9@1PPd\"8R]2Sj"8Rl2iSpUsʠ1X10ox2S "x8R~"R{"RxBTu2Sx0 8pP9 pS0Sh{diX02XzpT<!02O1 P 0SE z0zP"R"R"R"R2S 72S "R 2St0s`"BT00 0@0 @>K K_qp `pP{ @@>K KRqppqWK@PpT1: S02j ?p  7/9P zPdB f/lID52S* K y@pD4 %K8p` %Kpe`p$ <C247207<(72,7% P@p85% G@p8 >0 030(uT,4ǘ0<'He?Q Fˆ…cK c?K  P T$>p$E`8 >  00@ Td#㵂P 1$ނ`FV$ق2CSX 222222|C|2S o?PQ00%  PR<3"R"$3R "R 3t"R !XR2SBT "2R:" 72S4Q?>2@SP  Xy",2 R" R2?S 0? B2"<t1 xA ^1PB`>K0]/K>K^KрP`V%`1p!p0b`1 0K0Z/KY?K[K῀P/d1@`th@c$ R0cK lx11 #P0P!00 00S@ @ cK 0vm0cK 0omp@ pW"2"|21S !14!8!4$"Z4c4'44'44'.p44'U4H%'5555Q5^555'6rdA86edA 'F6>n3P'667!777o77%R5'7I%778O708'M889')9'H9a66''  `  $ ( , 0bC20LP PT  ?p@ H1  1 SR \  R\!R!RS r/q?080s/ 8!R00\00} u?v_0 (0X2Ss 2 H20SPlS2So h)Pj `pP"0`Pn "0`Pd?"0PXP A㬒`R冏P Q0s5DDGQH#dD9PX XܬPRppĀ ! 0R0 * ER00  KP Ġ` !00 0SUVPQV 0  \0s "R2SP4嗋2Sl4zX2S唂P P`p0 0?`ր倂P Z P1Z011%01101101 2׃<ѣ< 2׻2SD1(52S N8SL59S |"OP 包劅 凅Pڬ偅Pڼ‚52S\1`ᓐ!pPO6<  Xpp>K0]/K>K^K~P x1 St!&#p!##`!S.X W+6"rBR#(K -0-P`M`uLMXE9KP5YKP@P0<%(p nP, dP! PP/ TP1 ~fP lPy4tPC pP qPu lxPd yPp vPf$00Z$00V000bl$0 0\$000YH$00<40S : lP 00 Y ) P)?  ,0S HvS0S9  RnR#oQ09 0 0 0' Kh@➩P X#XԌPw0u34#4ʌol(3 $$ PM K'K Aa000 2 20`V'Ki pJ2"5@K  @cP/ PBKl2l" @OBK Iq`Pvq`/oY" R mq @`V K  @c@P.K B `iPJ dPE _P@  0U9s:pP |ut!t;P}:`Q& X;p H q:ᾪ0P(`CQ , K2/SR }u0!TPU0 su00 ^9Wp0S9 j(K((( Jx'l.I( I%v((GIx%H%<J8ypwI JAJ'zd@0'edARJpJJJ -L MP@`qā!'p% pP fP nP PPxP yP qP(0000  X1 00000000!0(1`V 10S 10S `00PUAP  0 R pPUJV 00K EP`30P 9JWp(K ( (JM (l.SMH%dlM -$L,M4P<K :P#K<K#K:@N90`H$Ht00@$@4@@@@@H L0 ,$ x&p0 cSO US FSY PSv BS%aS 5XS nSd fSL mSM dS#iqSd pS}#bxSe ySwx#000 h3Z0L  0TP0 PP0<3H 00P\ 300 0bҴ3%0 0 0ǴP2՜200000 峴2 >0S t|M~8"000 2  T2 sL"H"00 k`iV00S 10S 10S10ZQ q@T@@`h10S 1 P 410S xpZ00S,iP<V00S @0K F0P2@H0   H0Wp8  Wp IPJ0P(K0((((L((l.g( (8(T(Y- 5(Sgwg(gT@J%gg (h((H%ghlM -LM`@p` [.j PT@Da) 0-K P.K.K02 K3P0K0SP"%pM qP mP nP TP ^sP vPPPPKp2K PN9p(K-K ]0 QP K0 S KF0 KX pI0S|0S L1 R V0aS !1Q0S  ' 0 uP0 0 KPrZ0-S -K!00.K PP  @P Xr0 3/p U (KHl.U:H%` tL% 0-@LK0h((  -@p(`L0P,8`@PDH@84Kh0((L%@ -@8PLM -pKHC 勫8 K⇫6F``D^ 0  R 0,Kr @ 3!?! ѯK0S4F"p, "prh "pH@ T _"@W5U@5@5@50X3 %#p0 dS) NS, AS CSj ]aS| bS WSWAuS# `lS sS hSL `wS zS5`g Br000 04`^ 4 `Z0 04`5>KPe!00 0 ጤ 傞P3SI h5>K0!0 0 8d mP3S q\3 EpG \3#lS@lSLS aS #CSxsS mSwS zS n㌣k3Z(gxeX3Zb `3Z@^X\T30S0cX3 00P%R Y mP" R" R 1  P%R LP P5 0XL3 X?K0?K0 ?K` PPP\"\+ L#K pD L3S  0C,K#P b @P!@ p``"p! x P!pP!T 0S1t!. 3/ K/KlP \PP1P!P Y  R #K̢/K,"p/PP P 0 Ν< 0K 0S/K"p} KHM%(N%]((((0N%(l.+(N%HN%N%N%H%b<I$ey?gizui  m-LP cp Khꈾ( 0-L@LHP@,(K0h(S%l0X0 0-L@LHoPt@,l(k}K0h(XT%D<: -LdMs5P.PiP.|-6P0 p) P5P5@P @6<24P00"@ (2((N  DK⿐p DQ .6P 6. @ p 1a 0#0 @#0 @# x#0T0 P0 L0 H0 0 0000P0 0 00TK$@P $ TKU4 DK@@ <@ 8@ 4@ 0@ DP et DKatl4j4h4 0 X0 ,0K4 #@@d K\K\P tfpPPUPh0PP 0/(K,{e".< >X=l=`( -Pp @6LMfP 0 t&+!pl lPe RPd gP FPrP uP8 mP-0W%0P0 5 ! @0#S JPP K.00SP K.0P0S p5x oWPL5X 0#S K|P K.0 0S K.0 0S 4 00 4Z0 ca) T0SA$p@@0WP iP`LHq PGHq @BH Gp @P 0SpBW$  3 3030P cQ pQ bQJJ BR 00 00 TxJ0W0 a \sn0S00W0 B 0 0 00 0K 0K00S 0WS(00 20S#2 0S! 0 P0 0!  Q00s0  T2000@% 08 !W`p- 0, K0"K03/ pR` Y`p]  FV@[30S  3PB0 0C?oR20S  PmY A3 0o3K3P0S)KSR 00 0 #  R' S 3 40S 2 0E3Pqu  2pl, 3`p(KCl.`s$H%h(p%&9 -@Pp'ML M✆ I & np@ oP" aP AP pdP fPGuP& rP tP vP wP@p 5 50S K?$@Y Qme]'H%0005`19 9fPg P POWPF h`PA p@أP 0ӣP ΣP 'P $PpᾣP#P  W Kp K[P.K00 00*0 0090 0$PP' K @ePPZ0.N^-K B0^-K0>^-K B00^-K B0]-K< B0]-K0 Bn0 .p B@4P񟗾H```d`8```````<`H```t``````x`8h @```pT``d]-K0< B ᮡP |= x ᧡P wdd b \=  P= = r 0 00 0 2>0(00 0,2>0@ < \00|0 00 0 2D<0!00 x  02d0(00 L *02X0!00 02 L0!00 0 2<0(00  024T;0S +FP ;000 plj^-K0 B ^=K0C0!0 4 0 [2< 0!00  0 N2;0!00 0 A2;z0c 00 0 52l; 0!00 x 0 (2h:a90S 0P*PWPD W4 ὠP00  ᶠP :* ᫠P00  ᤠP000  )^-K0P B09 u]=K$0C0 1 x 1 1$: GGP0^-KT8000 $W I^=Ku: f_P/ a_P 0S 0$0`8]-K4 B 1049h0S('0s70S000[ Kx @עJK B0 P^=K0C0r04KP0$pBP n`J0 H3 ?V=K,0C 3 R0:K,0C4SS V=K,0C 2 QP*tgpp]=K00C0 b20 !#0pp   g^=K0C0 KApؘ& 1]-K0P0 B0 o1!` 01#bp800S 0TCA ]K?<A f!($!(#l.!(Y!(- x%(!(!(ZgN}%#!(!(U%2 IF)9iH%OU!("GZJi!(};tMw 3Ga!(U%=Z!(!(!(!(!(!(p$`VV0]=KC<0CV 0]=K00C +p:g00Cܾ`0S!0S 01S0$0S;00 R<} R;R0;:01 0R0!0 <1R$ R* ! $0S l1 Q+$0S 1 Q*0qS {P!q0S010 0S 0S 0"z $2 (2 R R "!Ѣ! ^=K0C0 0^=K00^=K 0C0*5Uu +t +20SO ]=K40C0KA@p@ P +D m,0 K"d(@?+j+h+f+4-,83K0A(6 H3< P30$6 x0 0[=K0C@ +pE0 K#d(@?>K0CK^]KKA@X~PX.K B^fK(AP KZ AK⽗PKP ]K Ap<  T:K,0C4   bD0.Kx B(f %f= -:*ML M @Y* * * : *mK)p ZP NPZ FP IP= DP=SP0Y VPj OP0 0 h 0 @X9mP} fP0a iPk bP0*0  0+@9sPt vP~ nP0!00 0 ?8U0: >K 0C C%8p :0S  0B0s0S  `8 :0s  8 0(0 00,? 80@ 7  e0 0 0 ?:0*0 0+?7e0!0 0 ?7Y0c 00 p0 ?47L 1 `1 8?47@0& 40S:60: 36P:e0s 6 X ?) K~K  @pGx tYAhf# h6 R, 0Sd6l R0\&)p  H )K A\+p 0 0S:U; Z0P: %)K AB+p 0S; )P * K@~]`P  |Z OPPZ `VJJ K>PD: AP:Pr04oP0$ 4fP N@J >Kp 0C \FpP$ d$0St:S0d$9[S K @*0#p :S `9P P4#LdC:S 3 0z`V0S)=K 0C0 3 0k>K 0C `p` R0$9[S >K 0C QP*@xQd00 :  2  0# mlp20   Ed00*? KA 1|pؘ# ㋹PP ,dD2` 0br':0S 0= K? A V0>K 0CV0* (p4d`V᥻tQ4S4S4`p1  V0; V0:4$0R$$`0S#Ѐ 1 R 0 Ø0$p0!ຘPޙX0Q֙X0%QPP @ (:* R00S ~(X;X*)l. Z(&(T*)[%n \*)P*)gNh*)`*) H%GZJij }5 3Ga --P`LM P `K)DP<< )P$C(p :"((pOcp`J #  !p# C@4Pm PPPPPPPPP|PPPPPPPPPPPPPlPxPPPXP PpL09S K"0P 00R0S L0;L0x;0NL00d2``FRKH2 00S  $b +S b0R K"0000? | vL0 D0DPL0:L0L0 !BR )# (#d!wX pR 8  R8L000 W!Qcq6eO+$@w   _0 DPU =7 A0 DPH Q $DH&7PTX7Ah30 DP) @P@  7u0 DP Z0 |DP Q0 sDP Q Q $60 `DPH 0 VDPh +0 MDP "0 DDP 0 ;DP 0 2DP 0 )DP 60 DP 46L0 {@00 0P0S0Sr :S$ Sr 0PBU0C X7pv6 00 PERA0U000C#!0P0CQ1Cj 0 pA0 Q 0PBU0C ^X% +0 U  pPX0 0 B60 PRPBP0e0 P@ p[嵎XUA\.6P*600C0 0ePEAU0 0C#1P BQ1B $AX6XT3?0 00H 0 C500 00C0 PdX @dSB2#SSJ L0 G 0` Sʤ0K<0400K80000K40,00K00(00K,0$00K(0 00K$000K 000K000K000K0 00K000K 000K000K0 Klbp0 \SdK@`WD`0 =\<*ETSY^ %I0)zCL``5W 0 00P5` <50SP1 -LMPR@0D-S@P @$4 pd qP@ 3C p# p. d@P'4444444844h44444$4,L@0S K@HGG(C3`ZP a`F 0PS 0 媐0 00 P000Q he JK!P 9x \[W Y XRY*2T`P 8P`0b 2 R 9 0 S 9  ~9U 0 9 9!90!009X852/, )p, [p0SŁX py0S  Z匵 fP|0pP@@9 0`Z,L<*H%pLM:+Ah8y -BMLMP@PI圇P< 喇P7'` 0-SU P ᾏ PZ @ `Fp@ 孏P -00@P@\ bLpP 0Q Q  BZ-00 p pZ@0S0@iDA@D P 6 &" p D0B5Sl\(p (L(((`ux5 CK`l5040S XGPHY $5$eU(5P % 4 40<4 410S Y 4  4 d3t4Pw Y\d CK`4040S  PYPbD <4 \ 3 X 3 Tc0SYt0C?o#2p R0S 3 P㚃㗃P㒃Z 3@gA2<UTp3Q00PE@rSs RS` iS^L;SBtSc xS^L0Sp^2B R00S SLtG0S  0@N=IIS pSL0S H\@ 0@M0IJN$K 0S 10S  j2 00M R\MIJN KRDJ^zLR`qBK AABK @` 0 BKp @M`T*SR$Q CKBK A @ aC>K 0C BK @MpT BK AABK @_ 0 ImJzN 0S J`0M%5s+/<*p l.s+w+xa%Q% 3 M Dx+ H%"x%s+XIa%$s+4( %    !+!6# -PLLMPp PHP W0O0o0/F p5 fP SP# LP >(TP! dP >!sP nP qP >tP vP >00 >  >00 t> l> d>x\>PhH>A R 8"@$>>0SXaV=0ShP P P)P /P  P`=0S f0X0 G`H BD h =@ d 8< 3` 8 .4 )h d0RV``S00Z`00 SY P Q\1`0 <`  p0 gR d<k`e~,l.1LDLH%RLVONqLL@,%L,Lx , ,%LLLLMIL,LLL%MIMSMkMMM&LLMoMKM{r\rMM -LHMPp`I!p mP hP lP HPHsP tP nP`HII00`10PcU eQ @P P,1,! (* QFpP Q LH@ @PPKP@ D@ L@ 0K/@K}P KVP  P0S  PxV TP XOQ0`0 \0 X0 T0 `Kl.Xk%#NH%J8yH,pByt -NCt 6NAN -LLM0Pp`0 8Cc#p6 eP$ aP AP MP7"&bP! dP1" qP fP nP("wP xP" rP p" l" ``2 \2 T"P"L"000<22Pi0S 20S Wea0S1 R ! R0S! R^! RZUS! R  SL@1*@1@1PpPZ `0K00\K0 Ym9aP *pP P @10@ (PP 0S ` Kp/Y U q U` KpPE0t 0 U(K`k%Z,,,,l,,l.,,,,H%p,t,'ZLph,, % -LMp`GP@C&"p aP tP0p6 Rd&  @P6T0K 0C C8 8Pڈ40Sj l8 G>K 0C CP8 l8Pڈ40SW 8L L t78PL $8 ~7dt 5@  K @P 0S76 @T نp- &%0 4 6 D7`00h&0x&0G囵H7P <յ8707?Q(t 7l 0@p| "S6$U a$ 414 6@6@6p6  K  @j5-K0 BH4 p6Dt Lt ľ0P SG*ֽ0 40,&,F,00x0P 0S DPA)@P j)@P U0S P 0S 剸5dD0S5Q +Y}lUP X5?@* L{ 4 +4=BP50Sa4 ;P 6} )Bxt Qx00PC000 p!00000000/xbs2"Q"^2p` P] xB1s0S $p1Rp00CS0|Rp0 `"0S00p1KlW0`?o20S )pP1K 0S/P 0P=?o20 P& 0P1 1[\ 2=ppS 1 0 010010K@1 1K1s0S 1[N" HI P0 1K1s0Sp00CS0Qp0 0S001K-p-P--ъD--L-ΘH%%%--_ Ӗ % -`v%-lv%!2-0-<4-t-l--4--H6 pH-%-%ҏ#M -_MLM`pj?PCP 6 F嬆8P 3P t6 VP 10@S0@X&^pdP0 lP cP 000&&T" P" 50W50S b`16 ^>K 0C0C6 K>K 0C0Ct6 6P0-S0S @p0S l@> Bz  >z@bP 000W0S 0S H}d ⑛pP-p5: S   S0XS  `Ppv B^K PE+ly}4 Y i  6 ~P 6  0S0S ^>K 0C C P pm0 000y 0S 0S 0S UK A P0S-Do P  yC0S U>K 0C'PW  KK0C A QP 0p% G SgP pPl 0S%$aBK0x!00 @[  P: B>Kb 0C 0y 0SBK- @ p`BK AO`& 0S  p 9 !W ᢞ&0S& 0 ڊ(-x%ՊԊIx%fH% ֟% ɞ   6[ٛ8y% 0-sc00L@@P0P 0S00=|^}P p3 !sdsJH `{0S s/RC}P0 c0F 3#PQP NT 0+0C 0S %}P@D (P%P (0S \P `2 \(XbP 0S @P 0S$20 2P R" 2`V `PET P`@D0SPHPKI|PFq\10S P10S0Q4Bw)1 @R1|PP+UP P@0QP  P7P\rlQ-Q-T8-pQ-D-Onf8R-_Q-  fhQ-otQ-~l-R-C-`%xQ-$R- -L M`dBp\Rd-XX#`L"pd fP7 IP* EP$ SaP0* ePN"000 z8 00 nP- iP lP 4rP uP& /000l!S000 d!0`00!S00000 ?LP 000 3LP 7<0 5$ 0 0 QQ \PPPE P cad0^!<MP H&E d-l.m-xm-dKm- %x%H%m-Ǔ -L$MqPEğ N@x4/h4P@ 0X00H0 P 84 L"0, @@T -R R -R i^eR^iR kR eR`PsD@ @@ <@ 8@ # p] eP+ QPL EP IPP -PVaP dP8 SPLnP kP' mP0 iPBrP1 sP2 pP; 0P^U0S ?SPP0`^V0S ?S``0@^T0S ?S@@0<0 0D0 0@0 080 20 cYM##Z;졟q0葟0 1 4 K0 #[3[R S 0S0S  Rڴ3K04 Kt3Kk  !H0"80S9", WP SI@0S p@P .y@z P00 0 D0S  <0S " " |"n-n-T.%rn-՚%l. H%d.(o-$o-ht@gtec"!x%7=B -@`PLTMrp@ "p gP uP GP0p0 0P0S@01p`gV"U  P lK"pl l|CTx@  #x p`V `4pKv0P 0S YcC"l0K  p!.p V lKp T x=p U pECPU Y X)pPP@@L 0B 8/Cl.H%ve.<p  -4LEM4 " 8 24@3#3@3c@3S 3@3@u#7|C0S P B dt@ N]tx3x#@4p#pS40h@0oP0Q KKLL5pPh rPj,3 $ #84pc fP2@P1 dCPA DPJ 2EC8P\R  P# w  @ uVP PZ@4 =R@@ u s NsJ1 C+I 1 a1p\2+P %+Ad`d0@ Fk`1P`L~P 2~01Q*0KlHlElWx20S W\0Q 5u0+ 0 (Kظ-`-X-BD--,-$---L-po--4--ex%cl.-cLT-5[c-c-@.h-c\/ h3 H/ -d lo- -LqM `)0 @ 8pT@1 A $p, fP# bP eP+101 pP zP lP! 1  0!0 \ 0 p00@(410hSTW UPP ~P0 qKP1: So?K& 00Y0S$ W  sKe,@Px  KKpP KKKcu _uZ-P([AT H@P ,,"(  0r  2Q "X00"p0pK/KypP J/K B 2 塔P| sKPlP` AeW!(A "k! `Pz0S  P  ?`V P`|q0 K&1 RRSQ#4s p! YQPz0ST ȋ j bUla@KKWP\R(JG,(}0 $@PxT ?--l.D9pH%pOLZy-- %ht@--Ċڊ@  -L]M?P0p00 0`1 1 @ wP wP_[OKN/y> @1 00 0 0 0 h0 ´0ll^l1 1 1 # 30=K0  @>p\ VPM NPA 6PR ?PH 4PTP; =PP#3#kP' gP( jP fP=0@1 pP ʘ=nP! 1! 0 qP〠 p=xP! 10! 1 4塗<=54 4=1 00 =1 00001 # 30  Ȍ)4.0[OK c11 0!  ,a 0q PP# 30P`0 P # 30 (,0G ScP@ =1S7 0GSA0 ᳱPP `0 ooA0s0Sb 8d&`[KYY hP vl&h{< pt&p #0 Q# Q(!#[K#)*#[K#0 0 @㡞# 0 0 6[?K#0(01X btPxX000H ZY@: <*Y8:00,:,*+M :*00+E#(#[K# 30 ; p CP  , @9 Qp # `pp  #[K_ ip4  W 1aK bo RP0 0P9 0eP%&P 80W + 8p 1@Q  Y0 l1[S s,0KAP6YOo,!0 ᗓ0s0SB` p``Y@Tf hp$PQ Q- 0(0X70k 0se 0s p僝 `VH`<w0S $呝1SE !Z1SS Y Pw0S }Zw0S h1SST p<0 d`_K X6t1 !pC `V ,YGY#0(0(pw0S %6p}w0S %`)!P q@  *z1S#0(0 fpH DϜ @0#0(0 40ş00 % 04 0d%4ph1S#$#0$1!aK-P  x1 'P  0S !Y14 ʜ10S Q 0R# 20#303/#0&0宜1Y 0S   {a/K#0%01p`Pt 0S`V ሏ08,0&0p D0sp0%090(0180 0S R 08W+W 0!pf pd X"0D2P03/אP, R   @rᗮ<1aPU 0S P` 0^PPkP [OK|pd1SY 0ST  R 9X{.GN#O l.ewH%`s@!D̅xʦ ٦AIZk˧ԧ);09@c"d Q tH п ҨX{. q 3#@ 00^볛4# 00 x00 0 R 1l%Zg(K  -P L00 xp  ^0@Al Kh 00$ 0 10 sT H|r/ 0-LMh @T0PKLL0%@ 00s,, @0(sK0茌 4<l $<0@-S#* p @`P 0Q R P` 0Q p @T W000`\$00P00p\ -L M@Kt0 0K  -LMx  Q K 0K#Tp 0 S  00   Kprk< /$/'/y*/*/*/&*/%*/*/:*/*/*/*/*/%*/*/_*/\*/;}*/bz*/w*/t*/cq*/n*/k*/9h*/e*/b*/_*/8\*/Y*/V*/S*/P*/ M*/J*/G*/0D*/QA*/>*/);*/{8*/|5*/#2*//*/),*/=)*/&*/#*/" */*/*/*/////*/ */<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4*/=*/*/d*/(*/e*/*/*/ */f*/~*/{*/x*/2u*/Kr*/$  0j*/tC +/ja*/O^*/[*/hX*/iU*/R*/vO*/L*/I*/F*Q/A*/>*/;*/ 8*/5*/!2*//*/,*/)*/&*/I#*/ */*/1/ *//7*/>*/ */6 */*///*/@-@1s@*/ps_strings missing NULL Obj_Entry pointer in GOT Corrupt Obj_Entry pointer in GOT Dynamic linker version mismatch ֊` $zK /l6K4B GJJ8MxO+xO7r,TTx\"]!]`a7ohe%e+e!j1t u7{w`=xwHLU d[@hhwuȾj` PP3L,LG MX&D(Ɋ8,J`3h4ޒCъCJԊJڊJ ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosgptifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory xp((@@E @@Œ˒ep Ғؒ@@P@@ޒunblock and -DNO_CONV?̀43x0oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file& no previous commandunexpected end-of-fileinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sInvalid type in GNU longlink %dFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ...  #/<g/<gRfzEZ# _^F<>?(;PATH= t 2fͬFdMFscZFmSFlah r97ppnxF v b   EOF reading here (<<) documentR,>  }-+?=Ezrٜh&PG6o@7o @9E<?BabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'̩'0'1'1'8d'0d'0'0 x'0ć'0`Fqd  Q#^"Z|ON ,5g$V L ؊ QM?r-  !^ZzP"u%B&               9<%npE$0ilddMlOF 0\99v8_l_D`PY7rн2s PdUDLw{IXZL  z'>,t8alias %s=alias: %s not found arithmetic: unexpected '%c' (%#x) in expressionarithmetic: ++ operator unsupportedarithmetic: -- operator unsupportedarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ')'expecting primaryexpecting ':'expecting end of expressiongetcwd() failed: %sOLDPWDHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumenterror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failedusing redirections: do Node type = %d do subshell done subshell Cannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)DoneSignal %d (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sYou have stopped jobs. ${LINENO${#LINENO${#${(($(...)"(...)>|>>>&<&<> && || ! | &if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT.profile/etc/profileENVOut of spacestunalloc p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: EOF in backquote substitutionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Illegal eof marker for << redirectionBad function nameBad for loop variable2nd "!" unexpected%d: Here document (<<%s) expected but not present-o promptcmds not set: thenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncdirectnosigpipecloexecEXITEXIT trap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PScPS1-xnpxefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range%s: bad number!=closing paren expectedargument expectedmissing ]unexpected operatoreqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreadonlyreturnshifttrapbgchdirletfcinputrcgetoptshashjobidfdflagssetvarumaskunaliasulimittestwordexpPPID20160401 BUILD:20240418164555Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'missing format character%s: invalid directiveprint failedHP VZeJ^_ei nv =w Q FB:Is`&<%Cd&d&H%o9%O,&z&Z''(-T%V('a(*)T(h&\%e((( (#3#3233#6 '@@.>GO @ |C${CC$C [ !C)1@@:  NV@^f nnmvu @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.    $ 8 H [ }       JRZ@0 @`@h@o@w@@@@@  @@@@@<B @'@,1;DJU\b)hnv~>p u  x|.BE&MI#FFFE~oC  ='FC,5@&MEIMFW[cg#Fm( 0 6 ; B I P W ` g p u z                    ).6<B x|.BE&MI#FFFE~oC  ='FC,5@&MEIMFW[cg#Fm x|.BE&MI#FFFE~oC  ='FC,5@&MEIMFW[cg#Fmchanging %s byteorder to %sreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk usage:%s %s %s %s %s: unknown machine typeDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown archgetlabelusesmbr() failed%s: not be or leAB:CDFIM:NRWef:ilmrtvwunknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbarm64evbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn26acorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s successfully scanned %s. forceWedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:unhandled type %d QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMAND: %sdrvctl-errorget-properties: %sdrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': select neither dict nor array with '%s' /~999999:E: : : : ; ';7;N;:c;;;;;<<3<K<g< <!#$<&12<345<68<9<9<:<;=< ==8=@G=A[=B=C=D=E>F>G>H>J+>LH>MY>N`>Op>P>Q>R>S>T>U>V>W?\?a)?c3?dn?e?f?g?h?i?p?qstu?vw?x? @@E@d@q@@@@@@A$A%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]JwB/uw~oC  ='FC,5@&MEIMFW[cg#Fmreturning to single-user after filesystem check -ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %srqInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directorysize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for todo listNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  \\\[        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledDIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkINTERNAL ERROR: expandfile() failed to allocate a new block bad filesize %llu to expandfileusage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-y3:MX~FTg|PJ%K%lJ%J%J%J%J%J%K%K%4K%LK%K%dK%K%K%K%(~oC  ='FC,5@&MEIMFW[cg#Fm/~999999:E: : : : ; ';7;N;:c;;;;;<<3<K<g< <!#$<&12<345<68<9<9<:<;=< ==8=@G=A[=B=C=D=E>F>G>H>J+>LH>MY>N`>Op>P>Q>R>S>T>U>V>W?\?a)?c3?dn?e?f?g?h?i?p?qstu?vw?x? @@E@d@q@@@@@@A$A;ثܫ|nQn- q+|nQn- q+ |nQn- q+"|nQn- q+3>|nQn- q+LU=rGy=iG}al;Mt?wmWC 3KOOyD<#*=(3Dh&Ƿ\ M}-Ҭ-чHE-чH#F ZIчHw#IчH/u6IчH}A2IчHoC\a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerdestroy[-rf]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize-i index [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:i:l-a attribute -i index (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %lsUnknown %#x[partition not found?]Type: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:lua%5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrtsL%PN%hM%N%M%l* N%9MM%L%L%N%'8M%'* N%L%L%,eePSS8setifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapszi8O%yiN%:R%CrN%R%R%2,R%PR%R%xN%eTQ%8N%  ,8@DP\d m0v@y1^ @kinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstN' Y'`dl@dlN'media_statusmedia_constructor2;S%;S%;; %s netmask %#xTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sVLAN_MTUVLAN_HWTAGGINGJUMBO_MTU ec_capabilities=%s ec_enabled=%s NONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x>af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstrbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@Hoo@ooo  '8M` o@{@ffsJwB/uaw %s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup.8wodoC  z@JQV_imry bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead..8wodoC  6o@7oz@o@mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload.8wodoC  6o@7ozo@t@Hsoftdep.8wodoC  @usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s.8wodoC  6o@7oz@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s.8wodoC  z@v{^ @ r@Ԋ @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %sz.8wodoC  @usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o  D|  Sp5\0Ww%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()K:XXXO:XXXT:XXXusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Checksum error %o, inode %llu file %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%llumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGFFFFG-GWGGGGG H=HeHHHHIUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtudfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanZXZZZZZZZZ[[#[)[L8[(F[<^[q[v[[LL[[[[[[[[[\\!\-\\:\L\T\l\s\\\\\\\\]$],]$]T]$]o]$]]]]]]]]](^%^0^7^<^qN4Z;Z@ZGZ%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %ld.%06ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_url3UsendrequestrecvrequestJNRVZ^***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPASV%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbvbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)usage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D'%%%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-id;d--cc.-cP-cT- dd$-!d)d#-FdQd0-edtd--dh"-d@-d?-d-dd0-d-ddt-d-dw-dd/-de- ee`-e(epo-/ed4-8e@e3-[efe/-}eh2-eP-eO-ed-e-eeh-eh-e-e-g ng6n~oC  ='FC,5@&MEIMFW[cg#Fmhw.disknamesoC2IчHwZIчH/u IчH=rGy=iG}s3Dh&sSFH0eC SFU0eCE-чH}IчH#F-чHث (s*K>;ɫ Hah!IdontNeedEFI      !"#$%&  Zh-[D-] -^-/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfWhat kind of system do you have?Raspberry PIOtherrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 8.2_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-8.2_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-8.2_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-8.2_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-8.2_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.AddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sCreate new image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named %s) seems to exist on %s. Do you want to use that?If you booted from a floppy, you may now remove the disk. Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-8.2_STABLEftp prefix/evbarm/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/evbarm/8.2_STABLE/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%cdisklabel -w -r%s -f /tmp/disktab %s '%s' -i /sbin/newfs -V2 -O2 /dev/r%s/sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbrdevice %s %s (%s@%s)%s (%s, %s)%s (%s, %s %s)gpt -qr header %sCannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0adk:no_partwindows,hfs/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-ADI_BRHkern-INTEGRATORkern-IQ80310kern-IQ80321kern-MINI2440kern-TEAMASA_NPWRkern-TS7200kern-RPIkern-KUROBOX_PROgamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%scCan't open %s Can't read disklabel on %s. %s/netbsd.bin/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgin/usr/pkg/bin/pkgin -y install %ss,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %seject -t disk /dev/%sdraidctlvnconfigcgdconfig-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedgesmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.old/etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d) %*s (%s)Extended partition, LBAFreeBSD/386BSDDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld /bootdisk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'***************************************************************************************************************************************************************************************************************************************JNRVZ^usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipesetvarcontrol_handle_datacontrol_writeonedhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1m ndhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionb"c1^d%ef)gchijdk5lm?noFpqxrQsXetu=^v`wxgzLywA}BCDEDFGHI:JKLMNŰOΰP۰QAS'TUVWX ZΞ14#6|~,}75>N`nluszaսNdo/HDZѱ-I%6%default_configread_configrt_descrt_headclear0rt_disposert_new0rt_setifrt_newrt_freert_findrt_kfreert_addrt_recvrtrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initmake_varappend_configh]-make_env!K,script_runreason0123456789abcdefdhcp_envoption÷Lu޸+VĹ >e4Igy̻8JbvӼӼ.MӼk۽.Tfvbž#BbԿ-if_copysaif_opensockets_osif_routeif_ifa )arp_tryfreearp_readarp_probe1arp_announce1arp_openarp_probearp_announcearp_new5( HPHHPbpf_arp( PEP HEHH@DCH``Pget_leaseread_leaselog_dhcpEP\Akdhcp_bind*3;C Kdhcp_openbpfdhcp_informdhcp_handledhcpdhcp_readpacketdhcp_readudpdhcp_expiredhcp_lastleasedhcp_start1dhcp_initdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_sendadvertisementipv6nd_expireraipv6nd_handledataipv6nd_handleraipv6nd_advertiseipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1&-  9AUlwdhcp6_checkstatusokdhcp6_validateleasedhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrebinddhcp6_listendhcp6_writeleasedhcp6_recvifdhcp6_startrequestdhcp6_recv '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_envdhcp6_dump%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version7.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 7.2.2 %s Compiled in features: INET ARP INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-7.2.2 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: is a NET/ROM pseudo interfacepicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type %.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %sIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argument%s: IA_PD not compiled inunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactive(null) rejectcmd != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.c%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsifp != NULLrt->rt_ifp->ctx != NULLrts != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL%s_%sTESTSTATIC6ROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid= - %s %s: executing `%s' %sRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbin%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s%s_%s=/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtdst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_USELOOPBACK%s: SIOCGIFALIASnet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6%s: ARP probing %s (%d of %d), next in %0.1f seconds%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: probing for %s%s: ARP announcement of %s cancelled%s: hardware address %s claims %s%s: DAD detected %s/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: waiting for DAD on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: dhcp_read_lease_fd%s: %s: truncated lease%s: extending lease until DaD failure or DHCP%s: extending leaseNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %s0.0.0.0/0MS %s: using %sClassless Static Routesip_addresssubnet_cidrnetwork_numberserver_name%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: waiting for 3rd party to configure IP address3RDPARTY%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s not found%s: if_sendrawFAIL%s: dhcp_makeudppacket%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: cannot add IP address in test mode%s: DAD completed for %s%s: op (%d) is not BOOTREPLY%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is for hwaddr %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: checksum failure from %s%s: invalid UDP packet from %s%s: server %s is not destination%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired%s: timed out contacting a DHCP server, using last lease%s: dhcp_openudp%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %sDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s broadcast %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsip6_address%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: sending NA for %s%s: waiting for Router Advertisement DAD to complete%s: %s is reachable again%s: %s is unreachable, expiring itrtpref: impossible RA flag %x%s: %s: router expired%s: expired address %sIPv6 ICMP packet too short from %s%s: IPv6 NA too short from %sinvalid hoplimit(%d) in NA from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)IPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: reject RA (no option %s) from %sdhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s_nd%zuaddr%zu%s: delaying Router Solicitation for LL address%s: no IPv6 Routers available%s: sending Router Solicitation%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: DHCPv6 DAD completed%s: ignoring unicast option as not masterbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s: dropping DHCPv6 due to no valid routers%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%0 E) 2@0 ,(/etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid*0- ).+(/, '!% #34 !#$:./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmta.m.pmp.m.dstmidnightmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagoyearmonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed Inkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist