'V['f0k0NetBSD/earmv7hf ramdisk 08".f<  ".fx\ <  <".f@@<@T 08".f<  ".fx\ <  <".f@@<@TU ".f <HA".f".f".fA".f".f".fA&".f".f".fHPA".f".f".fA".f".f".feA".f".f".fgA".f".f".fA".f".f".fA".f".f".fA".f".f".fC".f".f".fA".f".f".fA".f".f".f$p ".f".f".fmCd{".f".f".f (08@HPH $".f".f".f8@HPX`hpxE$".f".f".fD$_x".f".f".f=$y".f".f".f (08@}C!".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f4!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f B!".f".f".f B!".f".f".f!".f".f".f"!".f".f".f"!".f".f".f"a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f \!".f".f".f\!".f".f".f \!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f\!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f !".f".f".f!".f".f".f !".f".f".f!".f".f".f!".f".f".f$!".f".f".f4!".f".f".f!".f".f".f!".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f !".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".f!".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".f!".f".f".fa".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f \a".f".f".f\a".f".f".f \a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\a".f".f".f\$!".f".f".fi!".f".f".f!".f".f".f!".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".f!".f".f".f B!".f".f".f B!".f".f".f!".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".fa".f".f".f!".f".f".f!".f".f".fa".f".f".f a".f".f".fa".f".f".f a".f".f".fa".f".f".fa".f".f".f".f".f".fbpf!".f".f".f $".f".f".f$".f".f".fX$".f".f".f$s".f".f".f[$".f".f".f`$".f".f".fbA".f".f".ffm".f".f".fhp$j".f".f".fx $".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".fA".f".f".f%V'2ZIwF 9Xq'd|ażrOv;Xەt N2Mye$TIf} Yi+i K3?t4a q>  DB>A9acyg6q6q=A\oJ`i{=Q,em_^x'ZWF. qlK.7|O@PQ872Wt"gw>-&fVl?`;) < . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2 2003/07/26 17:06:40 salo Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF( 4 y4 (44l L8PtdNetBSD/ NetBSDearmv7hf P L0 -L@P`PU(0`@&a`@03/TP(tPRA @-L Mb !1 P`0SQ 0 0S  /S 0ST10S QH z8 P5MR ,1! 0  0S1 0|R0쀟 X *0 p)p03/ WpgR0pW *0@(@03/T 7Q< \0 00L0 0@0 0Tt Xıpr\`%JIHLT +F5DO- I ^5FT,4 IHI P \gp4:p(18@8% Kn:f*oB² *IG񽾚mQeppGphp-GONNFTO GFkh;k`+s(F TAFrк )3h3 ,/a''shh , /I(F+  (@a'Ф-:j"!(FGiFG0 FGpCO FG1hH F(FG1hH #NFa3hNFa, I B FI0ZЛB FG3h+'puWu·lXIFFHp #pJh3`pG -CF-FK"gFIF@F`A 0F9F'g A I H{{z4ЃY@ p0p FFˍ@iF0Fr H1F  p.h@S-AF@pGF`jiV0FG,4h+% -HG`(5F)I%)H Vh#@c`Fh0FGvh HGN0 I%H < O&K p,9FV0FGZ0,h-+  HGt00#I% H 6!FHu(%(F;E, O-O"FFjGjAF KX`h+KhKh+Kh4$$+\ѦKh+9ХMJI(FXFCh;C`+ jFUK]` oCO2F#"#H&K ]  oCO2F#"#HK ]p #O2F#"#HK]$ #O2F#"#HKK]P p #O2F#"#HJ`];oCO2F##"HKP ]F KFh[ O2#H##"K]h R KFh[ O2#H##"nK]h dp CIOr-C#AN#F@I@O#U+` Fp -OL&hhhiiMKhq"#REs 2C(#RСk'j jG1?nK8FpIZjRF1FkHOy(yFX dKhIZjv+Zh+`K dIZjOO \KP^O#KA#TK#L #KA ##OYA##OIFDHO#C ##KEBE#xCEB#2C#4#2C#,#2CEE#!;jիh+yj#3H`;j[(K0IZj 6 k C#VD C #O#aFF#BB##PyhF 8h&:hhD{`K#RIEiAC" I OF P h l ҏ7sK-CFP"oI F#C"jI F!FOzu )FpbL"&lcl)FgwIylp"d!2Gsi V#&'#######JJd *" F F #R+BICH*#AJF d!H * F F|#R+4I5H*#4JF d!, * F F` #R+&I'H*#'JF d! * F FDkOzsk2F;FOzr#0F9F*L#0F9FOzr*DJd!  * F F'` H ϐF F F-C.L#j%F#k%iiakXC# Dkj jG1??bj(F!IiO$k/F;j<,-Ыk2F)hj[jG( 0[K IZj6ѾiJh+;` I ~yjOH Rp l3h -G?L#j%F#kiiakXCj# Dk jG1?a&'F?#0#k-IjkiG(M8bj #G BB=ҢiPF!hFF#OFBB$ I "80 [j(G(6G #LBB#0kO IijG0bj@FI ml(FqOO FK F!!!FHjR]F!F I %9F@*V5B dpF L%h=UQ "0F)(`h@ p`h0 p ph /KF-OFh FihYhIi+H! OFF%/F@ DFB6 0#h,0#h&0@!F  hF)QFZ" A @!(@iFPF)57(F0F h HK-ABFzFK"FM`#FBBBK"Fh( +h>;IF;HZ;HU;N%i3hB:۵8LophOwD"h9F2"`+h*IF*H8-HZ#h;#`+/*Kh & #h7`;p`#`+!KhԛK*F!phh(ۅB+NhIFHH% #RCs# KXh#CUX p x t p ̋ )ċ  J#FBhB 3KBHo+FX )L)M*Ih.hB+`'Khg h2hB ``.`V5 J'`Rh `BRh;'bO hBh:#+`JF` `Bh3'/ `` Kh   ah ̋ ď X ċ 8FM(hJh#`h\`h`3`+h``3+`8H ď -CF F4F +zh9IF9H.8HQ#xg +B `%BV#@ B ўEȿ3Oؿ# Eȿ3Oؿ#h` Kp$h J KhhBF 3$P (K`p` p oK-OFxF 0`jKjIh*2@)F[F$dNF+S^I*(XF(G(F0`o:FG(tti(F , *к 0#` 0GHFKh@0x+(qF(dFb+7I),5H!F(/LsEC/J3 hOssDhF1`F*h2"IF"HN"Hp0;0+zKh p - h;`+Khԛ$hQF F2(Ja HH f OR̋ p)ċ pp$MN+h0h3+`K`K`K`K`+h4`;+`[ Kh  p̋ ċ -GF'L#hx - -$HFo9#hxBM3#`(h-hF0B" F F(0# #"!i#QFF0F@ B5$h F(  } Џ Kn:f*oB² *IE˽mQeppGphp-OF%FtK,Fh8F{h;{`+8F\F0:;hZ:`x5້`+2dJBx۵0lhOt D3!F0t(R*XhUIFUH UH. : *2z . E\LJ̿ OyDhFIF3`AKhl(7*$hIF>H=H9:h::`*b:Kh Y .K0`;h;;`+0Khԛ1h_ U,K!` \F&(JXFh3`3h" %K2h`O@*hIFH"#`K`B"`&Fi J h Uh FK`opȏ ̋ p)ċ L ITK-OFhFF; +--P; (O30rKhFB!qOdtXh!F:h2:`(N;h4`;p`;`[gKh  =sh*F\FF(f "F[D,xX  RD, *QHG 2h B0JORr9h19`F*JhBIFBHAH!;h;;`L :h::`*6Jhԑ8KRFwhh8( l8F9hP0 "#D,+Ь3hB9#LoOwD"h9F2"`JPhBй)hIFHH#h;#`+Kh?VV#h7`;p`#`; Kh?G?Iph#CUP ̋ ċ fp) -OFFFF'H$/DB:504BI$H(x ^+\(\ .xf1FH84 400(x00(x005(x fhpkt#J8Ih# `jFD( ۽0+;J`0+;JS`]ċ ht@ Kh J K ``hhB*JhBHo  Џ ď !K-OhFFO O#;hB"4,̿4O F8`0(j8Kh+< +6J0 @B#`ZP+x T0Xx +@(+x.+kx ++0\F30(FgFh:`*-Kh 9$ &8h`:h0FFF(BK"`0;0+ KhԛoH pċ -OFQKQJhFQKFhhB F7O B(EBEA%GNh3`ePFF8F~ AK`FYRF9F  h;`cd0!F Bb*F`3Kh O PFR0BF8FJF FFF FAF8F=F;h +`;hB]`00#0p3DK`KhQF(hyK"`h;`[ KhЯo ď Џ ċ H -OF6L6O h5K=`h#hBFܪBU4%O F,I4> @F'N2 ! :hXFFFh;`o%3h  SK"` : * ԓ8h,F%0F  H Џ ċ -G F*MF FF h.F3`xh;`+;+h 3 M7+hB` OF8FKKhFIFh+h4K",``K`h;`[Kho ċ ď H iK-OFhFgL%B̿H FF8FFVEV0F7F(2ih*DhB=ݲrh i1`F$ )huNIFNHMH0;0+@0 x q`h a:`""hԐF2i(D'3i6hD4LjhB)۵hȿ iؿOvD2`1Fh)h)(IF(HD'Hg h`; a`+KhԚ JAF#i8FNZS(%M?h0i3/``0h;`Kh*h F(K"`h;`K0hІo ď ċ p)HH -AF*Mki.F+ݰisiF\>xhiAF2`\F)hIFHHh;`[(h [# h;a`++hԛ:x\*zx7+7 BD", Fċ p)-OL#i #j Hz!NF0`(sejB9۳h3jOsD2`)F)h>IFHZH|h;`+MфKh D =heb;b`+{Khԝԣj!"%pF%+̀cj pJE%3hjxSU3hY1`x\)kI`[x 0 ]F2hx +!+їB*0+UdH)o6hj`̿OrDFv(cbhb;`+NKhԙԸcjJIB!۵h jO{D2`YFR(?eh$;b`;H!0` mx!+00`(5L h0 h[0Hy/O,aJ$(hFn) p)l)@DDD`7I h)[x320XFF(x!+$)J0Hp( D`.h3F n(l(@DD%N4h %H%K h(GHBHA(G/V/J(hFn) p)l)@̄DDD` F3h!F33`u Џ H ċ #6P dď Kh+?R$)h F+n* p*l*@DDD3`Kh+?7$)h F+n* p*l*@DDD3`;h$!KhF;(LN7h!(Kh+6h.򉀑Hp* D3`)h F+n*l*@cDDKhA ($)h F+n* p*l*@WDDD3`8h2`($/h;F+n* p*l*@ODDD3`eKhF("(hFn) p)l)@=BBB3`VKhF(SLSN7h(LKh+@NHyNKhB?rIKE`ܷB$HJHHgp) D`(hFn)l)@DD6KhFp(M"(hFn) p)l)@BBB3`'KhFR(/)I",h#F n( p(l(@BBB `Kh+? )h F+n* p*l*@Ӄ@@@3` Kh+? J(hFn)p)l)@̃`笏 H Џ ď [x320ZۭKhKhK`BF(?ĭJ$(hFn) p)l)@DDD`O$F+hx9*0* *;Dp*r*g*1DDD33`(O "I0h <@80 (h"+H}KJA@1# @1+hxn)p)l)@@A@A@A3@`6h.ɭ'KhB?ĭ&K&J$`(hFn) p)l)@DDD`Kh+?$)h F+n* p*l*@yDDD3` J` x +(Kh Kh(䬏 ď Џ ċ  } ^xQ)3+`+h O4$x320[cF(?SKܒh;0#J`J` a(>J(hFn) p)l)@lDDD`Kh+? J(hFn)p)l)@ `K `KhD-( +hx1;+(RI& "L`h J `@80 (Bh"+уH&`}I",h#F n( p(l(@قBBB `p* D3`)h F+n*l*@тDDdKh+?5($)h F+n* p*l*@ԀDDD3`VK `WKhD(PK"hF( PHoHJ` x +JKh AKhAKhG(lDJ;hhB F:J` x +J(1FBY +[+\+FP5Hkx +3H$XF5/O ,OzD:hQF2:`F'h5%IF%HP$Hs;h;;`"Kh & 4;h(;,;`+Khԛ,A2F F%NK"UPh31F F #GB F  6̋ p)ċ /Jhx (-H (+K0!FZ)HY`[x +ИB0CF(N0(Kh d0X' hIFHHK'!F0M`KhHh@'*F0d00q0 } M p) vJ-OhFtMY`xYx%)љxBБ$F.3`+h+@̀jH8h Y0 B#FcHmx]J)hXN1h)`AF(I'hfUIFUHUH2h:2`oF:h0B[۴+hfOvD31F+`(6'h8>IF>HT>Hv0;0+:Kh?op+h;`+`+2Kh?_`FE\hT3VF K J>`h;`;$Kh?C?E VF0U46;h\BC۴MfOvD*h1F2*`|'8h IF H H+h;+`̋ ` X \ T p)ċ +h>`;+`;Kh??0 F"Uċ -O} FF-(CKh# #"!i#i"# O\FxFOT6Bh 3  EDDJDr8h 1F 'hAIFH\H : *@|Kh @ < 8`: *qKhԙ0+# " FV8h!F(D%NJF F[hKڵ0  E2^KJDr8hh 1`F 'BhNIFNHMHh:` h8`:`*GKhԛ0+# "QF F8hRF!F(DMF% #D!xaD9K hEL!C#"!F  (?#*Nȿ  ؿOyD2hIF22`JhF'hqIFHH3h;3`+?23h;3`;Kh?(?+/ #C Ho, T p)ċ ̋ \ aKh+# "9F Fq K:F!Fh(D%hK Jh# +?@F } T H-O8FOEJELFh%h;#`h@KhB\ h0 `O:FFKXJ5KhF(P4Kؐh0&30(FF : *8)Kh x/ & h`"h0FF:F(B0;0+KhԚ%h3%`Ho :F)F(F#(  H Џ T ċ }̋ VJ-OhULTKh!h1ch3PHoNM+hNK"`MN mhO 3hHF33`(71X)# ShhYhh `hY`ShhYh `Y`hZ`Wh ;+DhYh>hh`>hq`Qh `Y`:`W`8FXPO  wO  B   ^Kh #h`#`ch`c`h;`cKh  H ď |L ̋ ċ -C &M/F+hjh;"YFF; h :,ыhLh8`DE F FLFK"`JKh`JhZ`L H ď -GF#MFFh.F*hlhBd3 ! F`YCF3h %t`HFkC DD8F3hZ2```ph&h9 IF HT Hwhh6l`` FL p)IFFH6 ꌙpK-OFh]F FF¹ZhIK* FGHpCO &V#`)FH uWOb)F $o FA(pCOгh FAعpCO &"?##FJOavVov3hc{KhK+x/+(FA)FzHOb!F $ FOapJ `, `AxlH)F FAF(i3h+f!F(F%("F)FcH/!(FtG/F/! FlFAF8F%(D o? o:ڽB W.#;ZF)F8F$ 0*8FA(F DE.#;RF!F8F$r x8F zAFAx*Z#BB.#ZBB3i+)K[iEi+jйgĀX@F"&"F)IX{h;{`+8F(FXXOsAq$F F8FAF hDKhKh0FK0Fh.KDhCKhKhpCOѨhmD F Б  R]_  ԑ 8Fh|#+**j Fj` h8-CF PKKh(FY.h}OL.#+*;hm+#juH 0+:rKh۱ooS" "CSmJJ!b0jI 2)jhH gKgJh`K)FFeKh>OsAq$FF FHF)j hi*kXH WKh+ kUH  jRH QKh+ ijOH h0C_Ѣj# Ѳ "A1)lFHk j#7Kh#! !3I!0ik0H T /I*HikpF F2Kh 0Kh,Kh+Kh0F)K0Fhl%KhC%KhChpCOѠh=hpC O0F h   R]_    ܑ ԑ Б NK-OFhij3DJKh;IKh ck#j3DFKhFKh1EKMhFEBNi3hB݉8 FOwi2`!h&I#+*@&6h?h)F8F FF8FAF0FAFF0F05 F'B0{O O E jR Jh bk"jBF 7B 2  +DD Б  ԑ ( .K-GFhij3D*Kh;*Kh ck#j3D'Kh&Kh1%K1hA FG۽(Fp&FF(F|F FJ%h#+*FE &0j bk"j(F#FE 76h Gx Б  ԑ -CF#Kh j4!Kh;!Kh sk3j3DKh47h%hl?#+*-, 5B;kbD B %7 30j rk2j8FDh C! Б   FFFhFCF ହ(CD +FK!hF \, F(hpKpFh+ &&$0FXFO0$(*FI x0rF I n2F)F^!FFH  F(Fp l-CðF#"!$0.%^"!"%ZB7)FBFF"B "? r"!5D%> 0E"? `D=D@F"(@F? QD5F FCsJIFH b ̛pJh3`pG 0IFFH H p?F+J,L,IPh+J( F F)I)KB(H!F @"0I"H"/QI" I!?PLJ FKI"0ISIH"" IHF GB<ĆclO[z-O FNF-h)@ F@bF(@hc(F@X)FHR"FIH P3i+r! F@H(l F@lF(e(F@??#"F1F0F<(Ip,MGN%sh+ OBh?J(D9jF?Ih#'0?P9L($9Jh8F_jF4Ih#0?<($0JhOB?$x+JOBh?#O($j%Jh jFIh#&0?($XJh0F~`!F(F !I0F!F(F#0jF Ih?( $8 Jh0F+O0 F M,m 6ĝ_hF;`+ ?3hZ` ppG-GFLhA?JO3O`#`J;`{``F`;ah+h$Kd%JK``Or!(F?(`$+FJh hBaKh)D"#-#J`K`Or@a(F?d(`$+F~Jh #`hC;vKh"-#sJ`oK`Or!(F?>(`$+FlJh jJdK h+hKh\MhXN?&($tZKaJhh f0+jpCOPK XIhh?2O0#``_ QIh?(##O##"#h"1?$2h+#+a#;a;i1J"P * *@**Ko`!``3M.2Kh+&OC.,I*Jh*` ` GPWBOR.*`++h `oOBd.9K3BF"#fC+KV,>!@ |8!!@֞I>!#m8@>!>!XOC+`"#OO O #G/&BI# xI9CO /`.*h K`OsJ+``# c`O0O S+`X KMi+ KZhF* OBiFh?(KX` M@ ,#LcbKi #"#h"( FsF $* Jh O0h(,@ T Ki* I  hHK JIhhO0@ t@!>!FFF$*F1F8F?(-D-D FFFF$*F1F8F?N(-D-D Fp FLch&F+.MFh+i+?XI"j` hB `˱*`?H#k` Mt`D$j Jh j FI#FFp,@ >!-AFTMFhh/F(@ FhF\BF#0Fkb0(h`#k`0+S+3P(+M#"#h"(qBas8Ih(9 x`F76$>h+ x`F$6h+$0hE+($(h +&I $l`?$h+$h+$h+, #{b#0{jM,I,Ѫj FI$jJh KhYi F I  I h F,&Pp!ޠ@ 6K𵅰 *b4Lbh*^3Jh:*1IMXh"`i+I*?**;#"J`  'Ih?R(.#c`+`#K`BݚBOvOv#%"h"((q2F;F#Ihg"(q"Z`ch+ I  I O0@ ,|m?o(O-G FuFFO# F%IHhF(A9)!"(FqF)"E9"BqF F$"(q $ Jh O0 a0+,@ -CFGLF`h%F(DKi+G+.qu@IU.qo#O"h"j(q $6Jh@FO0``Za*sڣj+.I@F-"#!h"H(q?$'Jh KO0X`6(!K.`w)OyFF9FKF0F"CI #BF00FKF9F"Ih?($fJh Z #k`,@ ӡ/T>!_mu-O4m|NF|K L4hX, FFzwI #cR"# #qKhF"3h+̀! ##jJ N iJ 2F"3FeJOq8F < aJ>0^K 0 !HF##VJ &YJOa "F >P3h+PK!(OJh BF0F"^CFEJOq8F GJ3FOa T0 ,8J xh>Kj;9Kh-Rv 4m|hp!p!̭p>!ޢ>!R,>!@!Q!>!-CZLZMh+#0k``VN3hUKh+i+SKTOh8hRKRI8hh 8hhHOh>Fx;jpCO "#CEKh>v CKh+BKh+ h(!>h> h("v3h1Khk+i+ 0O5H9h,K8h"`zO3`kh$Kh+;#k``+KhFj3b3hKhcLN#h#0h{##`+h۱K Hh#訹KOR4hPOI"F F FI 0 ,0h6#0,@ ?!?!?!?!@!6!|?!fp!m>!>!r>!-GMI >(#6Jh *" >(#&Jh ~M0+@|Nsj+{Kh,@yKhF"xKyHh_xOȡ HF#(b HF"([+i3W+( IFkH@jHjH;jH8iKh;+gHgH-fH(eH%eH"dH@A.(I`I"(CН0˱ Y+S+ s+ y+ 8h(wGKSHhSHRH0#OI `jMHJHJH@A(>I"zp#0,KO4@Ht`h?K"`90 PK".IO4t` 8`)HO4 F M?!@ ,!$@!@!! 2S|}HȤ7hIǥ ;?!N8YxKFhC F0O0 x-OOv%I OL !F #HiG(  Y*0+ K!FJHS*0 #J` 5;h+I <,I"FHq I O0h` |lp! Ҧ-OO8O$8H;hFFh95F)FZBиV/I<(Ա5FO$;h(I)H[jGFر0ik!F!HGȱ( 5FH Kh+II ~\KhikHGȹKh+I hI cIJF$H%F0 Jh3`O5(Fp! !|#Fl >!/!MFHNF 1'p)FHfpp/##p(K1FJ K(Fv"1F!*/#X;9F KJo#pO0 M! ԧhF;`+ >hZ` ppG-OLO3F#hi.(( #hjG(ۉK hkzKh#OF (HF(~Hs({HO(Ҁ(O3wKh#tHvrHY(nHV(mKh+ ;+Б"F>( #0cJh $!\H YHXWH0/+ c8VH"UIFHLH>JHNKh+FH[(;h+IKhAH#IhAHCK"`CJ9Hh3`G 4HE0C8M+h+6Kh#+`+H1#h(H[lGF%H0S *'Jh-)(q#K(qa(\(%!}"I =Kh e #h[kG p!?!?!!?!>!9!! @!?!?!>!>!?!?!1!Oa LpjH# Jh O0p"  S>CFн@ֿ#Jh  FpF>60##FJh @0F>FC##h+ +++N+#iFh(F>,0pCO#`O0 '0-C( AL#hlG(#hjG( !!!hpp?!>!-O( L#hlG(#hjG(f( Khs~Kh=8#|Jh yKhxMFU()h +#hIBqHlG@pK#YA@`(jhH(efKS#aH(bKh+aH>2(_O;h_Kh[H>&:hZKhYK#BAVK#BA h+OK#EH( !BH(>H1Kh5H=ع;h9Kh;4K#BA1K#BA+K#-O;h+,KhH#hHH&K"`03h "Kh !Kh+ 5(P0+_ +];+4H72p!?!x?!>!!>!>!?!!?!?!@>!P>!!?!?!?!?!?!?!=!CHFANV#YA7ڦP|;h+?8O;h+?7Kh#;`4N2h¹.H.K,Oh6W#YA PQO"hAF HlG3hFAFH ;hCO;h+Kh#;`K#YA0+?h+?KhI#hjG" I =z /!>!?!?!?!>!x?!-AIM,h:/F( \*hB#h hCI ;hlG(=KhjG(!!>!f?! Kh#(( KhlG( @ ?!p!-OMM)@BO30F)h +F@oFі+/*hI$5h,O/*5/"2UO*p4=(";hJh pCO:hI ~3( Z(w(ۀKh;<F x(yHO3(uH#(S0[rKhCoHnH(?D@bkO2(F/)9Fy l@cB:FeI -0F=R#+p( [Kzhj\K#BAYK#h+TK#BAڷ!KH( "NI =OI @"F1F@Hl(DO;hsCKh[CO;h[BK:HhAK"`"5H=(;h8Kh;2K#BA/K#+K#BA[.J"Hh3`-Kh (v)Kh+ +;+HpHP(cH_"F=(8"0Jh 9?!;b?!!?!!@>!P>!?!?!?!?!?!?!>!?!>!9?!1!!H* iFH;HZFHYF HaiF H*;h+?ЮO;h+?ˮKh1#;` M!?!?!8KLr`F"hKh[h#`"hOOCI3IOs K`K`KhX( K J!)h#h@ D<98 (O08 >!p!֩>!X!>!!Kr`FJh*KhOOCI3IOs Kh (K "h!hDJ<9@9 K(O0 |>!5!>!!>!Kr`OCJ`J`pG X>![K-OFFWI VKxVMh" *``0+`(OL@)<9.hGrO{2FF[F!8 1#gDBw G 0F9F(_#䠲g*F Fw.+h@)D<9.K@ <)B (:@)D@ 0o(+ Kh+hD@iD<9+h@)D<9+h 0KgqgF!FgK(K"`I O8@F?!c>!X! >!>!|>!,K-AZhF*M*Kh+)I D0((<#K !O$N)h(KJIh@9D<9#Cs #zh*4BI N({("#$#O0X|ƪ>! ! FI@9@9FF=!S3-OF[hBBXٰFQ[FCSSS3 12&# #" T[Kh{2HF=( "fAXUJh0FW 8F=(,.ؿOv "P+FMJOvh B< ,"#`#EKHFh< 0#BAZF8FJ ZFCF8FXE#Cs#( "A,JXh 2S3#BBA+FX"I HF=( "AXJh B#BBAIX+F Z#BA ZT(q)F8FY?!!XIn -ALDYNO|1h8h(KFIh@9D<9#Cs#0#D99( I"## K"O5`%(F!X >!?!p!-O#"#P y>M@IF<)BOsq FFDa@IF FT2K^FZF;F F)FFFZF;F jF E 1 D F)F(O0="I#geI {A#y<9@ (Oqq M(qP@EKFq BF F@FDi @ !>!>!-GFX FFF.!<9@I( (ܭ-ȿ(FB@y0FFF9F@F 'D6@yD(F!-OXO0F=4((,ؿOt "~;FCJOth o@DO >M"##{<<9@ ((HE{1IFRF0F@(0(Khc@9"B+D"*@9D@9 k{.J(q9F0Fq{KhP.#CO0Z  BCXE:FI  /!! @!Ϋ-OFNKNO(q% #BqHI _"##(vCKCJhCKBh+D<9 u$-0ܐB!#DȰCs#0*F<F ~F+D@90BB0@9;(#6DCs#02FF ^JF3D@9KhYi0F*"###( 0I BD<)۞ K"O0` F>!>!X! p!?!8 L K@ hB p7p%}iF F<2@pEEO5O5(F'@!-CFhp#x/+ 3M(h(^"1I #+`W9 "@AC<0BCPH!j#h&J3h ]=#M+h V6(`!h'J;F10h 0h('!H0KBF'hYJIF 0Y/`Q SR8Fhk/(O0 !e>!ҭ?!ܭ?!-AF FFFF<(F.Kh S#BB #BB2F$I s;pCO I F ( F<( F!B(C@2XBC-OXY@Z.FM  F=FO0;+X=@WQNIKHh PKh; (F<0pB O@2YF(F<C !j+FJh]{]0]F 01F(F+PFVFF#1F(FF FPB04IDAt)F FP0!B !PO0 Kh, I FO2`$$ F?!B-A F0M!F)`.Ihh.Pgh8x`-( y')H7 q`y%Oh8h 8` 8qO yq;!F0FA;!F0FA;jAFFGFj:/CF"hICx:+ I hBT"02 `+` "hCF I H?'O78F@(@!i}p pG hh;s"Fz2 FA3oABFoB?B<xk*b*i`AQ m*w*ѩAqAQBq 3F F) A1x*+x+{ F)F0aC# DBs FFFp-Cx#I lFX!I#8F`X`ft*hZ+`k`\#xK,! FF=! FFpI@FO0FO M F(I4Fjh` H!IHl ppKhQЂB`| L!F HP!F HL!FHH!FHD Jp5 sFF(J`, *3(F&FK"`=1F*F#cU FpH!-GFFO I@FJI F@F8FCFй /#cU ;FJh NF0F͵-O FF/! h*M(`0(`#h+`(hOAF(J%KF/FFF!``O K!FJ0F KFA z(R y}W[eku U?Y_gw_{z8K(` 6I@` >4J4Khx-*3JYx`#`#".K.J"-K"-K-Kh+,H(Ѐj)K"`"(K`'Kh$K"`%J#`$J`$J"$K Khu(G "K"K "KJ@!l!$@!`>!\@(!@!?!@!|@!H!?!?!?!?!o۹Ji3aKhKX"KU E  (FOF I#𘽒I S;OF hE3KhS`'J 0"K."K+Kh JJJJJJJK"KzKhK"K J uKhS(?K"`J#`OKhKhZ}J+|I|I`* 6V2xKL!3vI `  +sJ`sI h*@D#G?nh5 h(gI(@Հ׀DK4h`I@F0_KO  \I@F(BF"XIXF 2 V O FXFrF^FF;N*0Fb&FI( XFF2 R#0FJ"1FXF(#FO O #+@ڀ.0F*'I@F0+?dBFH!@(>!@!t?!?!f!!?!?!?!i|?!php`p!?!DWup?I&h^I0F(船ch3+"YKXJ4`030SK"0F4h1(W#MKhعLI0FF(.2FIIC.h?hh5.B&hBI0F(``h(a4!(0/ h(V!?IWuH!\!!ζpKOO ;`'KJ!F0F;FAF(z*.,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,{,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,*-7=CIL,}EJ3nHkBOH8h@K(`?a:h>I >K"H`W!?!?!!?!?!?!?!?!@!ٶHhKh(HXK"HX`K"HH`K"HH`H8O"0@q@L=KL#K`H8  IZIH#IHL#IH|IHJK"H(`hO8hK(q:hI #@@@PЌIOr !H(HK"H`BtKHHOQFO3;`3PF(8`-}I egKhP(aHwK"H`uK"Hx`sI Y"qK>nJHh`VKh(>HhQKh(4HXeK"HX`cK"HH`aK"HH`_K"I `]J`"\K=KhZJ[K[K"`0!PxVJVKp`+#/)o#0'##MJ# +?#+#0# )?@̀?J#0# C*h9IH8LO3Zk"3I@H(\pn G 0@(?!?!?!`p!p:pyo?!>! 7?!]\b@!@!!?!@!?!?!?!t!$@!hp?!.۷`|3I0;0+ڰ1 60Z "p.8O X 0+$J%K`0+<&& M+hB3"T#F@( +h3+`KhBI >KT&`C(M  N!T#(+h3+`+hB K"`pp!i?!\Khh`pGH!KhбK IhhQ0 I Hz K HhH!p!&Up@!۹F F":`xD**2h?*.x[*-b+x 1I h)O0/+=`+Q.5 F+JCx*+?+)F5 x+#:F F(+3.А"!!Fx4]((Б-ё м]ІBfEؿ"B"!F!NE,Ѥ)xBР?!p hxD/.5FF(@o3FI O0p`)FB  ;1DB  (pp߹+KpFMh)HG(F 'HA'H>&H;@AJ(6"I!H@oH$0#H .+ѝ@$H F.H )h0F@BF0Fh(`O0 Mp@!,\~NȺغ-O]xK0 EFFF @hF2.'si# ")F0x(|'FB!?!FMKF"F%hF;c^0`v.+@-@ F8FF}(F(xkx !0xF0;33`` Fr@ -eOdDd9d.d d#x d"40<0;3SClssa,090:"Dsa #x 0cx0;3D+d3 Fsa#x !40<31;3a#x !40<0;3`#x !40<0;3`#x !0F0cx0;3s`@0O0 O0uF?L'hB "r  3F @3"  x/+kF J@   L( kFJ@   =(O0kFJ@   ,(kF J@    ]u7?JXF F I c FhFF*F9e-1F@(e"8B8F h"(F"`:`O`!KhO`Op!pG!K0$`D_BO00yhH`Hh 1``h(̿  0 0!$@!8F&x#"IJHhY!`I#`"FOqF(F#O3O3F8ٹO"F8%hI(FHch*FI xKJI fhI0F(:h:* I3F*F cO0K"Z`|*!-CFFOq0F(ހBB! FA PB8C"P0K;BhK@AgJeJ@AdK ` @ "dFB(H"FW7U DlB!3 pG pGpF/xk"I0F,F "I0F&PKh;Kh"I"`"FOqF(F7BF2F I O4 FpٹX$@!!`-CFFOq0F(bBB! F'APB8C"PYQ]@B8FY/"E;/Dp0K;+@aKJ18FJ@A(D ` @K~ "dFYlB(C" !  U P|" !USSS #)FH1)("tF8(`Q#<1(1 ("lF%BO "IF9FF * "AF9F 5 OqC)F#(F A-HXOqA(O5= !n($Nh@BCX +/%+1i'3i`5a(H@(0oPoP0pH(.?!Or5FS !(F }aZ>!^Rd!8FoF"FI )F F8@ܿkFx-+CxI0FF`hz2FIF b M'(FF7o3F:FI N F(KB(F O0 F?IpL h8 z hd@pG!pM-FO0p KZh*)F($ !tU0F p Fp!3S[K"`KhKhCL#h+I ##`KI Hh)F H .I 0@pG?!?!?!?!p@!U8!H7IL `PI(F `` 8 ht(F7 Kh+J IO08!?I?! s FSkK"`KhKhCM+h+I |#+`KIHh1FH , FxIF H I bp@pG?!?!?!?!hp@!Up  XIFHp p̰HnF *x/+I(I F(iF F7 0&H70&#BB*#BB FL7Jh3`pG0@! IFH p IFH  p-C%KFOhF2`W%`G%fphh0FNF5'-#h;#`3KhCLB!A!HB!9/ DF'!HA!FhFLfh(F1Fh0pFN3h33`#h;``hh F4h<4`TKh=%F'F$h%(FLB!HB! H(a(y L#hh3F#h3#`NI!-CFF(FNO3h33`F F(F ``HFF0*FIF`hh "ZUhD;h#`3h<`;3`3KhCGLB!HB!pFFQhtah(F`8Fh F p$h FpF!h(-CF$3O؀9Ԁ%0NX%@ 'ܱah x-H h 0hCh;C`+ 2hhY`hZ`p$h5'-8=!h rFX(FFX*FI$ V_-!)FH  a8hCh;C`+ :hhY`hZ` "p#(F;4 FhdA!-CsKtM,hrN!F#F+WF> " F`jK +` p cK&FhdK`dJ?\tBF!Ft0 p.`+*x!*k *6*3 *, *-.(*%%*a&*O&)*u**(!=*# /*R-*Z:*e<*/^*\>*?*Y |*~*P" Y3h33` FF6HJ  cx=+G>+I F 3cx|+ F x=*D 09cx<+ F =+6 F . ,cx&+ F  $cx=+ F(  bx+* Hbx-* H$  % & #  F 3 F  F  +`u8B!4B!(B!0B!FKHhX@!?KshM.h+` &K.`~0FH("xK*FL"` FPF FhxH F)Fp0B!M!l_p8FFF#- BO>IS _49&-e0b Y/HR.H O(]?)H ,FF88CC3D8YA8a8?88?8BqBA !8BA BqBB B B @@8P@Y@8CC8-GF FFF&'-; -+-=-a7K)"-$-I-W##vBgGEFF@FIF{*Lch#+F F(H@)F``@F<#K3 h/##K##KF!FF@FP O K##KF!FF@FCC H3DX@!(B!-OFFF(O#a#F+FF FW@+F F,ػ <̜E "F@F FMKF0FBFF F+&FhJHw!F0FFGH0FdFHF`0D09hjF>08h(Yh0D FL4F)0F #x-+cx+4Kh /Kh&2K"x*F#x.+cx.+c#Fx*K/+!(H @(F6("!FF(!pCO~+x.+kx/+ѫx!F!F(F0FF(F( )!F Hl[#`@!0< @Ft")hkF(0+:F)F6h+h+h, K ,>*~""! F`-hGI*FF |@!QB! -CF F*Q) >K Ghh3H="1F@FF?ah5H HF193H 1H 1F0H */H 1F,H ,M`h+h3+` FhF:+h;+`#%Kh 1$H  "H 1F HQzL hCh;C`+ 7"hhY`hZ`*"p hCh;C`+ %KhhY`hZ` "p5K!lLB!HB!h8F L hpx+xB%+`h8)F(48`8FL hXx+xB)F`h848 K"0%h LT"0K)(۝rh2*0B!-CFK$\\hF2`(h0ChB +0Bh+`DF4|,3h;3`CLB!B!"K-AFhO4Bu&3Fx+B:*:)2uF5F 5F%*a9FH (4F<:+6 N3h+b4`3h+c%(F4`K!1K-A&XFh2`=hu0++h;`hh c(F/F6|.#h;#`3KhA鸽LB!HB!B!FF F/ D!KS!@D)F 'F$hN(F3h33`0#Or)F8`F`0< ,l3h;3`#Kh K F`B!LB!HB!B!8%L4T 8!T <C`8 L#h3#`Khhh`B#h;#`@LB!B!-O F/!FF 0F4 (zh+vh+pOs#+O35,`7Kh3BD'ՙID !0FIF豰 **b! b   ьI h)ښ *O F J@h20FF(@𶀺к * wJ0hO3ܱOO9"1FF(  :x/*gH00FF(ЁbH(KEܘ 8F4f(h*h* pBOBPKh<8FLK0<h 8FAF0FF *:F1FBH!F8FY?KhF2`+!0FF   *O   1O rC-K!@Fh2F+IF F6&KhF2`+!0FTF   *O   p"h:"`"Jh "  0* j` j`Os+1K!019B!d>LB!dh9HB!-O%,FFF/F.FhHF(>Уb(S AAWAWAAWAWAWAWAWAWAWAWAWAWAWAAAWAAA&'O O$%DJH;C3ChF $O F'Fh&FF[00 (F#h;#`#Kh 0LB!lHB!!@0+@h ( -O'F=FO ;Kh3HF~I![R \^hK!iV"7T-OPNFPMF3hF(h443hO\,؁,/,%:, ,,؄,,m : *p3Cp0L|#h3#`"p0hx[(HFP3 &j O{? 0 +#h;#`++hZ*`@C+`#h;#`++hZ*`p0C+`pF@F d C!I!l-GF/L#h+X.KhFB#,NF8h)K3h33``3h;3`+0+ZhB `#`."#`h2#`$HhB" F#`ONL#hh3h33`.;h3h;3`+0+QhBڝ` C!C!LB!HB!7Fx F!+$Kh0 @@+*+ Khh(7-4;S(0x*+0; +(F# "` F>F<hùx =+Kh KhB Dh zh+x_;F .  ( BF"F ! #D+0;0)sD O 0 9;0+ۄ4~D0+Fc] +04;0#<04;0l (2 \K`CFaK`+h;+`# Kh 9 C!LB!C!HB!XB!d C!C!hI!DK-OFhF+ s?KF%ZhVh;K3@TD0SDBS#x+4+ P c#FF{ 9FLF%9F*HBFLF.%FO #pLFF```VDB#x+Ё+ g'F;xFPHF|'F|&F 3xC F`0` C!L!eC!MLN(h#hh3#`#h/`;#`+3h+K`K`C!LB!HB! C!8F0f)FF _KZhD``X`8$C!)F+NF"3F3*F-h#1F`F(FFahhh(5`.F+h F,`4`&F#h F%`F!1hſ-OO FFG[ غ*`к?>к@-غ\%#8F+#x+cx4#x+'@4#x+4Cx"xKB#x+4"xCxB4#x+4#xbF)䀁)3Y[x]+9!*?0##x+> CxF+?*+Ё+܀+ހ?+ۀ[+؀"xBԀ)Ӏ*@ЀbxBɀ44Bx!*^*у;F Fx-Y^*8F#"+cEx#+pи~и[.+x:+4kMIF4F*؃BF  D6O,0F&0FC.;и\ѕ5+x-+'kx]+$Ё+\+kx] $# (  # (ؿ#E#5Fk]FB?F4#x+4#xSE40+?  LF0  F_F*2 a-OFF F"#x*+K?+I[+>cx!+^+c  ](<[(-Xx:(x/(5Р3x.](/(Ё( ўxc/+ 3FXx^(:(ћx]+3x:+ѳ狱/+" (3{( Ё+4"#x/+"g4QL+F h x. Ё*1xp xF1B hiF h2(}BйB F+(Ё* FYx;7KhFB CBx/+#<0H0HF(S0B/#<#x#&4l&;FF(Ё)F Kh;HF솻/#<,HFr(C{.+Ѻ. "8FYF(FYF(F T*FF F/#!Fp'C!7HB!xF0+)+Fx(F)F23ppG-GF/M0O.F,W`hF;3kh``hl`I[+!;۲+'0300SoO`.ah#00;0#Kh shE"`h Fp`$h$C!@HB!LB!C!8FMx+< 0 +;h;;`++hZ*`"pC+`#p;h;;`++hZ*`QxpC+`Zxp;h;;`++hY)`Qxpx+0SC+`Zxp;h;;`++hZ*`"pC+`#pUKLDZhRJVhRK3xKKPK-FX)[N .LO  x)JY\ )9)HaA9) HCxpHAK xp9)K0Cxpx)Y%AK xp/Q-:óIy\ ) )29)$H p#XG!|B!I! C!I!L!lA!p9)HpFAp?A(;-8 x)?49)H p%Ap0; +|\# "`8FVFRh+mx =+h/4Kh b3KhB^Gh?S'08 .6,K',J-N-L-FFx+E\ +3h;3`+#hZ"`p^C#`p3h;3`+#hZ"`QxpKC#`ZxpMLx+h;+`+#hY!`Qxp/C#`Zxp J!I!I! C!-OBxGK=!x8F\ O O #@r@E НKXh 8F1FXF8FX x+ LF$HF$ FLF$K hԹK~0+;x@+*+𪀸 +:F9}Hi𜀹>л"xJF 9_F!h;`+rKrHhY`p C00p  BF8F hbKh]Kh[_I `\I hD `Z\J[KF ЃFTIF)E h; `+.0X p;+1*\ ++ h; `+0o~Xp  C0o~p  C0<p#F#Q 2 :x@*,Jh*B@O O 2 *ww!!!!OF9h@8`|d ,t(FCK[x+@h,e O4;h;;`+0Z "pPL!dldI! C!I!C0#p(F 0 BFIFVx 0 ;h  KD ;`\BF9F(F(>&Lp$ KhKh'H)F#*x*5)F*Т.,hh`*Jx*3*;$(F C!dC!-O F FЙJQhVhp ~*PF)F8FNO L# ػ𢀻=ػ:ػTػ𓀻 кO F)ЯF * њ *ښ @*њ0=+3h;3`+#hZ"`"pC#`#pO<3h;3`+#hZ"`1C#`*2h:2`*"hP `vB"`3h ;3`+#hY!`aC#` >Jh3`h 8F)@7*F @h h u8FFp2h:2`*"hP `,B"`k]0~+X=+?Q#)F8FI Jh3`3h;3`+#hZ"`C#`?.YFHF (?' J#hh"YHPFL!I! C!M!dC!?K-GF^0F "h':K)F`07LF7J06Kh#`6K`6K`ih`#h~K#h3#`p0p;#`+0Z pC0p0 Ld`F!Fdch"`*d`)F h hh + uchG````ch"`#h#rh` K[hs`lC!I!M!\C! C!$C!d C!K" F`FdK F@hKhRhd C!-OOq5L5M0"h+h3N 3h;3`+F#hZ"`"p C#`#p+hPF @FQ+h h K@FhFFX*h#hRD"`3h D3`+K`!J h/!h F+*ѻ" 3PF+DYk#h8F=+D#`3h]5` C!dI!M!1y-OF1NF0LF3hO11` !!F+KĠhFs!hQ#h3#`p pI3` h0 Dл;x+H*FI 'J9HKFJFHF")FD #h P#`hI!C!dl|I! C!-OFyOFFO1;h9`)sKhFpMı+!!)hQ +h3+`p pbI;` h0 DDLк к'FO 'F 4i2F!FHF(aч77OE 7O B 2F!FHF(C:F~B ) !Fx(11B8F 7B2F9FHF(9y~B ,* "Fx(22B8F2F9FHFv:x*77BӮ:<+hCJD 9Q [+`OE#;? L*hpR:*`*z"`":pOB"`"p +h: 3+` hC!I!d C!-CFFM K!L&t`+h#`Kh0K`0;0B#hZ"`pC#`p+h h"9FFf FdC! C!\ C!I!-CF/LFA.H( hCh;C`+"hhY`hZ`%O"pBW%5|DHAF hCh;C`+fKhhY`hZ`H%O"pBW% hCh;C`+H hY`hZ`5 hьH<H6Kh#hB`pGJh3`Jh;`pG0G!,C!-AFLFMF#h3#`+hi2 :+hi` Maa+hC`Kh`Jh`hB`#h/`;#`3 KhALB!,C!0G!4G!HB!KhKihDh1`I `hI `hI `Fih#`h 2BԔ0 F4#`hh,hF;J?N3h33`(Odp(` 0$`CAF FKF!QE  1B03@FH+h$jh@t@4#FF3B!2j`3h;3`SKh;Y 4M! F+h3+`#000Kh0/ xC@+h;+`#Kh * F@!LB!HB!|G!F=JFFh` F F 8K`/e.=6KF0S00F0h)F 0뎹-K)Fh0 h~@2F&H!F w!F s. !F !F ű0K60[!F [!F W!F SK"`F(0)F H0~( I H.G!|G!l@!dF JF :A * """ FBFO00l-O_LFFIF(FCF h+@#h+Х(@TN%3h33`RKhFF0!#BXҔ0+R0! Op2! FB1?*gE?i  фE ІEbOPO5]`OP%F?  фE"!3q*##BЄ0! F4%0Kh;K60+ """MERP"K)Fh7#0h;`S Kh;E8FXK!LB!@!G!ldHB!-OFF !&F! !(/KF04-L hF0pB$h0lF F0 h~HuhhP-:OO$%O8oIW<+iFW /2EHEW<,W@HyMEDE=Hr W, F)FFF F7H Fc7$%iFh/0h|aF.H;вHE EiFh.(0h|GF"H!EHEoCBO2BH$h F)FF FHH!FO4oE eI!u l:*;;+# ppG8?++B pG pG#Fx0; +!F H "+МBx+BA+*H!F*7Lx0; +?+ pG pG JDq\y,#F3oyBq+lL6*F@l-A FF(l);KHCKNKILOYIM;3JHyy\cHI4,GL hCh;C`+"hhY`hZ`:N$?O "p)YA3F.&>(#|(#+`=&(##4r&v<(>()&()# O8#`F ,;hh,j]`aM0j-("` ##+`;h F`b;h ;h@Fc Zb;h Fa;h Xa%{(  8QJ\40;0$#0j ((HF FK: "F +bhBR@kh:`"#iFG #AF FFF {.2 O+h  O2 0:#(F2}(F0$I0A\J"Kh3  ?}(5HRF!0+F%O "O 0G!,C!%@dI!u@!@^FO yH1\9)ۈ`pL\F 40 (9)ۈ`p/FР0 )  9`F FPHAO= 9)  %%.:.#.FO F 1F@F( O O B   }./H)O chCZ I +&KI@ J h? F~BhFىفOI`h3FS3\3[BSh:` #Cp FS JChF`""ځ~L]dI!-C&N3h[h+EiOF73h]h-<*hGDZ`i3 @0"akhhhhZBZAF #" F3hi'a`[j`kh`h+:F!"I0i`[j`@-CSM+hi"\iai# +ha+h"LO4c4:hZc0;0+0Z xF&.- ."re .h .#.c;.5(.C).\+h$@\.@|.T0e (;h$3;`+hha*&(+h$# $+h|(+h$$+h&(;(+h $ +h $$+h+h$\a)C (*h;hh3;`Sc k+h"Za0F"ICO F@ 0G!,C!-OO (O;h B;hjF*B* .3F ..=h+k[LFFZ ix xB 0naTF+hi!7F`h F*FF F;h :h. CF#b0F@p$L#h&Fj (!O0,+h+(#hkj "*`h:i(FHHix )2a(F2hi`##`Sh T`ph F`p;+#h(F"p@i`p@UKhi3a@-CFO $EM;9N ( fF0i`Zj`[ka(`0Zi *ќj<`'w*+B(#(AF %!O3h:hch/!h<FH##`2h;hk#a/3h``ci1a2#FO0vO #`F`3h`[ka F@ -OM"+hb#F= (+hj3`*hi3a(jj '!F`Ft``y(! :!FFFf`k( ! FFUx`Z(!FFK`+hZi*!FA " i2a>(u! e+h![i+ # #F`F ``%!( F`(Q!  (+hOOkiLH 3 #`F;hi` (';hk"DIiO ( +hi`Zj`[ka8`#;`c`+h[i;+! #`0K`#`C`+hZka``Zi:*i2a+h"b((@''!F`Bހ!8Fg #`F*hSkk` (! U #``` Khi`Zj`[ka#C`}(/h{i +IiRHI@D#;`#;bb F*hSi+g F0[i+LFO #J; tO *hQkai`Qj` 0( )O 0Zi*! [kYFXF;a 0` (Р +@KYF h (O #;`+h`"b #`03Kh$ !#F`F#```h(й!F'K0F(! +h"b*h0Fi3alF++*h$i3a#!O0p (+hj3`*hi3a#3`c#h+ #F` F@l-A%(N"(L3hbx(є0#H52hi3aFd( "#F  FD` F``<`'FH(##`DF2hi3a] l## F@lpF"(( %%F F`D``K Fhi3ap@-O";MFF+hb &ఱF#5KD0+8F^#hZ*#c`^(>/N+h"&FbXD0+CF(F+O#` F> `FF`S(oߵߵ*hi3aY W !O0**hi3a F@Kp$hFa` +h$ Nay(2h!F i3af3h[h;hiHH0Fp Fp@9Kްh6K@"!02Kh#d(0+K!,L`#`4'I"r!hKj"J i" K  " F gKhKJh3`K`K K K`SJh;`kKhS Kh {^PB!l@dLB!HB!TB! ChBhpGpF FFch```F``psFhF,(%H#h+hh0FFF1F;/%!"FF8,T! ! !F ! 1F ~#h+h*Fhh] ,,,pKh0 pG@! FF:)O]K, FF]K,>-CF{OhF;h -;`ܿ#KUh;+$RXcc1FHF,."!,!  F,{iOr@!8`KN0Ki!0F,CFOr@!'iF,0 h F,`_pCOO F,#`Q&iOr@aiOr@ !0F,f7@h( - ( \#KU)F ""a(hhz9*F!FF2H(F,n;h;;`+S.Kh+OaLF 8-&##K0۱#K"`t!h1FFHpK$`f!FhIFFHB"B")F F( Nh F,$0Fz)FF H F"! F,'LB!lHB!|@!!BpF FF+!F(F,B h(F+0Fz!FFH(F+ Fp6-AFDhF Nah3h;3`Gh(F+ FDFl`@!p! N L5h#h(F3#`+h(F3`x#h;#`3Khp@pTJ!LB!HB! KpFh&1F Feh5h(+-h$hpTJ!Kh *ܿ2`h# , !bF+\(+jd! FK ( X`L@!pFMkh +jh ! F+:۴B F+D0Fpfh+kh +\h+"! F+ Fpp@!8F F~(K`D`h``8PJ! KFhPhBh`Fh F@,iPJ!KhhBFpGPJ!pF F(O3+J! F+AF -hyFH!F! F+B -hy!FFHKH@@FpOcO-AFFFCFE/#K*F#IhM"K"O#Mx.FU <+U,B :FI8U+ѫh+Ъh FI+h!F0lD+h;+!FH!FHh* ch;c`+ F#hZ"`-"p I Fc(i!F F FьNF I ,Kh@K"UJh3`XJ!@!XK!FpB>*JhR BJ !HHHF0jь@!RK-CFS 0F+x+%%%KKhc)-',,,,,BK6 AJh0+%% ;K609KF0+ %%%F6Kg]FjF FJ0 +-JF!6 b K,Ф))#!B---#!K#F F 4CF*йP-! F>/O#` { "S,:CC,"iF +z0FXJ!G!lJ!\K!(-OF FUNhI0FPH$0M FFHU ,?,ђH!(hCh;C`+*hhY`hZ` "p4@, YI0FMFN/FV$+h3+`<!F$ F;h;;`#{Kh ^4@,(6vI`h~4'=4- 'qI hr(]=4-YhNFFV%0iH(F4FfH ,[H$5@-WHYO$%FW%0VNxZH(F4FUH ,JH$5@-FH$V$0sxcKHpY FiFGH4@,e/@ h(@T0-+ј0F-#F(6HW(F5I(FF`"2I(F.50J&hR&(F ȱ6@.*KT,*IhM#T[-r(F((FvF?./?HY& H0FFH4UhlHWuLB!XJ!HB! oc:p`0jdj030@FFY&I&!0F0;0+Kh++ORHB!-CFLNy7FTȱx3h33`%`DE)F;h;;`#Kh LEѽTJ!LB!HB!KpEFFZ]:*! "#cUp\K!-CLP'F#\23@+ K` J%`TR#@2)FFxHFK`@!XK!XJ!|B!K@ 8\* pG@!8FLlB ! 0! ,! (d8@!}@KB`C BF+:K`Jh+x(F`!PB!XJ!8F I'!F(F (]0 8@!FB Fq 88 M KhhF2` #`k`#h;#`3Kh8@)8PLB!HB!-AFFFF&- *F9F@F*(-- FD6 .`*h+O0hFhBа( R(cCch#`hc`0pFK`#C`CCC.hMh+h3+`'hc`+h; ``+`Khӱ3Nh3hi`F33`h[c`3h;D`%`3`ch;c`pK!LB!HB!8 FF;sch;c`+ F#hZ"`,pK[iB F8@8PKiڿPKYiԿPFH!F(R]pGKRi]pGP Osp FFR%0DP;B:Zp0B#<p@pG-G F'!F8sx+[I0F(3\ch;c`+ F#h!F0FZ"`""pQch;c`+ F#hZ"`""p3xKHI0F7\0Foxch;c`+ F#h'Z"`'"p=F'FO'O\ Qк'ch ;c`+ F#hZ"`];c`+ F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`5x-0FF(ch;c`+ F#hZ"`=Fech;c`+ Fw#hZ"`'"pK[iB FGPPKYi4PL F=@7PFFF:F1F(F+CFHh+ Fh-Ah h:x0B; K=! M8Fh Kh+`=!F@FB̿FF>F6̿F'F?C+h;+`+O%p=++h;+`+3x45ZVAF0HQF-H BXFGF"F4x=)8hBh:B`*9h hP`hQ`p0 ԹH\P3KhCh;C`+:hhY`hZ` "p @!xL!hB? B=+ pG=+Ѱ@ pG pG-AFFF )F;#:`=+@ F'! K>`S!@thB*FAFhx'>`&F$h FxL!BKFy F XAiF0FF(`BhW `0F fԪhh4H@a`\0F@*.O;h3;`i;h00DGkh`Ѩh*ikh2R"*a!`T#a#ck`khH$$t#Ck`KBJB[h k;h;;`KhE $@t``D`ha``lLB!(L!K!HB!F-AFF"JF\ &&F \$ =(& F\&*F!FHH8FD0F#FBF;$s=!TP#Sp9F"(`0FA#Kǰh##K`K`G]PB!Lch`Ѡh*JK(FF@ch#`c``*K"I@BFHCh*5M)h1)`#c` hh D[xI8F^ch#c`chCb` ћԠh2"h F`,,h<,`,Kh+R$ FLB!I!HB!NO4h,2#heh3`U:hhH Dh`h+!h#i;@hh0DGkhԨhhk`h`#i+a FK!<l-A&5FFHf(e(&5Fv(x(&%%OXKF%h?Wh#C-1F8h8C F&I!( Fܽ@(HXh"h +-AFEL F#hF3#`;x-+F |xT>M(h*h=I 4a`\"8F'F=!8FH8F%AL%FB8F"h#``3a6hi`Ch2aH%` #C0C`h\=+8F%  !8FAh CE`KB h\=+K"j2ZaKt`h2``0;0# Kh (LB!<lPL!@!K!HB!8F F,`h)F\$h88b$ H0N( x( I($ H(DDM+h*`h!F38K]I! hxxpG hxx[CxPxFpGӵF# "` FFFhKhh"+2O1gCoBB!F HxQ0I3 BH!F0F9Fнṵ FiF*: & F*4(#6BB8BԿ  Bq L̰ FiF* & F*(6#BB8B  Bq L̰ FiF* & F*(&#BB*#BB LF F* CC'iBѤ".j*4B!F*6(̿F'xWFF8F*(8V +jB0Fh @Fx-+Cx x+K"I#x˹K "I#`; K" I# I( H F ak`pL `pF౰0chXhh^@0+3x)+ sxC%(ch[h %`p#' #`p A!8MkhhFXhj`kh$( Xhj`8  8;k` F8 8 A!"(F ѳJShQ`Xh:(݀%(Mkhj`Xh&(рkhj`FXh&(ǀIHZ+h+ *@jhi`Ph(,, , G Px@ KxF ,iF )(@p@ O(*(@<,W V#)/5VGV;?CVVVMQ!!hF!p@Op@O  p@_p@Op@_p@@O  @ #*s5*)B khULXh+h+ˀ0+@ƀbhFPhS[c`bh#ha`ThJIh(FF FFBw F0;+R#ku% #M!F(Fb&!F(F^n!F(FXk!F(FR(Կ  b(FSF FFNBB T(FEF FF@B B F(F7F FF2Bq(F+F FF&Bq A!l(FF FFBw !F(FI!F(Fj !F(F khhx0 '8aLchhFXhb`ch#( Xhb`0( 8;c`(F8 A!8 FFI hX=IT%HD%-M#`hk`jhh[ APhi` I  8F8*" A!,-GF!.HF 4`jF(I)((`.P&P&$%FFHFF`FF( Z-F +#DB$I8F$%F ,5K"FI8F,FDDRF%DH4I8FEI8F,$*ht@HRԥlFHKh .FdKhHIFh dB!dhӵ "F xcoBOKA'BoB"FI $н-CF F ~Iw\.S`hux-+@Cx-+^+E]l+s+5Xx h-7%nJ#xh320Z. F(Fȿ F5(FH0(FzF *F`I _H^Kh x  XHlhVI0F vX0FF(0B0FJFxp~0FF`BJ0F{xh320[VF F0=-$;I >=&X;x%+ 8F/F/H- "8F xO(oCBO2BBB1?(qIIFII:FHn&F!F8F)0&HB,,!8F)=0FRuhc<Ol0"K#JaZa!Kh/7*-ؙB0FB%M* ѣx-+x4@G^+ ^* \x?+@C`2F )FGu(A!-AFF @,9F H&$ M9F2F,D.D j#3t#sp(A!-AFOl;mZ:ex ,NJeCh;C`+m hY`hZ`p0hCh;C`+Z2hhY`hZ`p(A!hF x:B H!F H Fh"( v!FFHK"`Q(A!JshhԱ3`(%*F` FF FH!F(F0F Fp(A!Jshẖ3`#x"+'+`x"` F F F F0F)F !p(A!-O#-FO FJ`0ѳKh,"mU#0`x\-R\- F" MF(hCh;C`+*hhY`hZ`$ p2%-Zx%*ќЗN0hCh;C`+2hhY`hZ`pI Fe#\ *+J  FO6IHF0 .+ ј **2FFO4@FyIuHd[xOSp\ظGyظB+иEqb΀)X oAظg@^i8u3x/s@YF UFxmHF 0PFKFXe(𙁄FIHO\ OM uо -ؾ 2ؾ"о.Ob] о %OvT"Qؾ оOeG'Dо\AOa=Of:On7Or4Ot1h10[Ռ     O^pO?YpN@^!-!ppcFFs# pr(A!RihNumJ#FmeKO ZFI\/zK vKFe(ڀRFx! p Osp a#F2F)FlHlKF2FbKF"F)FfH`JF)FcHZ0𯀻m"`I;e9m^Hhhx3`s `1F(F{F1F"F(F}ta!FF(FtkFF(FAF$se"F1FaXRF[F1F[RaRF[F!FRIhhx")')4I3`Sx:@  # `hhh `h@KH # s `Ѝ "F1F(FS+1FaS+!F(F(F )FHh\F0Sp #FhBh+ Kh p H (A!A!El  hh)h"-CFF #E (F3I&FP #"0I(FF(T;h:`_hAF*H-ehu'I<&I8F 5D1+ "8F(FHBFBF!Hx#HAFch3DH^5D {x?+-+##H0H bLnt|Ch7FhhhHM 5U9U< H#D| F>F F6)FFH0@(ԾV(-AFF:!F@3#p@I@FD'xc/=I F h`+l9IbF(ex+b=!( Fi/l/o/ .M8.I F D3`+I F <()I@F sb&I F .(`#I F &s` I F (I@Fb xB 5)h) F (kh;+ I@Fkh3Dt+h+ѡ0o#K0#M0#P0Cl# CCCdk#cc#bpGjkk)BrCc#"rcc#bpGlBl`3CCdB3cK@CcCCd#c#bpG$@j 㿂kBRBckBcBl"rBbBd"bpG hh(O#dBj80]F@k##cfF@k##cdjF ##I h(#b`t"pFFH( G[^8c6c2 d0`d ,"8(F0F(- Be f#bpCF@kF8#bF@k~F8n#bf dH(3m80@FH(&;jF@!80V#l#SC@s#d#b IB (t(I ]t I(b(I nt  I(R(I ot h"phF F#x-+ ##bbK@ MI #vȱhԪj!F H  3h2`[hkc+H!FCh(FG pc4LFFFF1ha(F L0h#h##`rh 6.x-. 5C#` (F 6 79h)-."h{h"F8 FhJh@(F b8J8(F$( JD(FT(J<(F<(8<08FL#h# `##`e`8M!) F,h:*J!H CJM!JAr-!Qr 2+F^#;?#+@3F^  SpQp# pHHь M!M!tpFL%h-FahH (DH( H1F H01FH#hD `pM!Qml:p-OFFFFDF0F )FBFбH`H\,F@f HPDAFHHD'9FHBD HhO, ԡK0F,* ԛK0F,k ԖKo0Fr,/ ԐK0Fe,ب ՋK0FX,i ՅK0FK, ՀK0F>, zK0F1,o uK@0F$,ب oK 0F,ة jK0F ,- -cHcH,j `K0F,+ [K0F,د UK_0F,ب PK0F,)JKo0FGH5ho,q sa@  Qi [6H*8,C2H,ػ .H.H8},غ)H8q,C#Hg,FعCK H'=JV*]3:;BIOPH8,;zH ,#wHCvH,ظ sHsKXF,3lH, jHjH/8,j fK0F,+`K0F]Huhs,#  THTH,ٸQH, NHNH/8, 5JH,GHGH-8,-DH-8wBHh),c3 =H=Hg@s s9H г@6H6H6HQ6K_KJ0iF8@,S5 (H+8-,ٻ#H%,FغCK HV\]cdmtu}dkz~JH8,عEH8,ظ@H8,?JcmBI1H'0BKU<+Da)I1HFU<2F7I$HU <2F4I!HI0 @F+' (77"I8F VO\ FFX @IF EGF"OsFHF )FqH(I+)FmH kI@F bxg|;x+8FdI8FC`I8FxC\I8Fn C:F)FWH4VI@F .PxF?E0+?@/?="O3F@FR()FFH4 e@F7?I@F(=O:hB)F;H;h00  4I@F "1H1I@F ("/Hx.I@F FO3F(@+*@ d!I@F F(?O3F(@d8M! 4 7MWo,O!~`M!8pM!XM!I@F hFhO3F(@eyI@F TFhO3F(@3ee}I@F @FhO3Fv(@seQtI@F , sI@F (h"O3F](re9jI@F p"OsFJ(_h0%aI@F FhOsF6(Kj0XI@F FhOsF"(7l0OI@F F`OsF n0GI@F FXO3F3g?I@F FO3F BF)F7H sg a+ؘ0BF)F/H/KhB.HBF)F@`/+H#BF)F6W)F1X &K&J  B$F)F  E7IPF -)FH4&3 ,7K,O!f8M!HM!0+CFS+F F )&IFtJ O 0SlI@F0+64FfKCEHFcJh0320["#FHF 8)FZH|4#+ JF)FUHpUHl#  ? 0 +u+ +0+¬P+N++)F" _DCEd(?)FCEY U)FCEH)F0OB@(?)FB5 1)FB$)FOB(?c)FB S)FKBI4F HB  4M uHM!XM!%KS%`O5 LF H F3FW# D# 3B K")F FB&T&6JB F Kh@& #`O0(JpF1F1S!(FFP!Hp@ Ij(p1{I(F`Pp 2I(%I 1N131+   I(F`  I(F(pI p8M!XM!y edAMrdA/sF+L,K &F#b0#01+>1 !I(Fp( <h+ 8h+H##1sI(FX(HtKH]`(F1 JI(FA(H  p8M!WEVfd^mdoXM!gdFHBOr F@XM!KJIXh O!mdF1 B3+P@pGFQ JOa F0#" a FL(q(qkB aNH|Z  F  GI `B?hk a F0#K? a:HO2BOA 0kOA BEs 0H aL"1FV0*K:F!F*Hh?)K[h+?ͮ$OO3& B®*xZ U,BE<2F;h!FHU,U <D65H M3F`QrFh 7F0o!hp$O!^h;`+ڊiBò +% hZ `ppG FPIF F*MKMINIS" "KI Fz"HI Fr!FGHm!FDHm!FBHm[!F?H!F (jhh '-IF FhhkB!F+ k N!F* !F NY0hhkD8D IB FY0hhDkB!F+ k ,!F* .!FH\!F )<R0ATfn{fFFF $ I)F H(0B"F;F1F(F4(F@%ɽpG@pG8Fh`Ȉ؀R[B@[(R[B@[шjbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHm FXeRXlFEXRBElTuBBmic[UJh"B!F@:.28,O!Fh KB FOr F# F0WEVF JhBѳ Bѳ JhBF!F@WEV,O! KFhOr# F04o!(#(BsېBq O0] I LFF H4 I H4T,2T<IH& TpHN(sF F(LhI F PI F J# I F B#I F <(#. Ih 2(C3 L I h%0+h bh Ip]?I'JAF0F`Ce(q(%'#hB$2I%0  -It B#B1FBF(  #ILI%HW <5K" FBIKH* FB(#!FH5#*##4 @(i|d=*R:0jh F I( Hx0,#H#.#l90L(7 FLI h$ 0(FWahHL0( I(F 8 K IB h$0 F*0P6 tp-OFF#F F!BZ܍""*I0F"F$0(I O "I "FI0F$0EK -FF$I QFH*%(D#BF)D0F4B%B H5 D9wDcp FF([О.KB0-KB9}SBD F(K(J(FF&KB c#3B/ F Fp@F FH$p@$ FFFH Fp@$6 FFH FB)Fp FB IF HZ tcidyararbmnllhopI#HL hDD!RCFF!u,OmO0єQQ `Q`A?`QQ `Q`A?`@ D80`hhh(<`hh D0hBO0( Hw! K!* ۓ!* ۓ!* ۓ1+ pG pG pG pG pGHw!-GFKFFFbRuC)F1FF@5@FB,F@$?6?4C4@Or!D8FOpO0&Hw!-AFFVKFMFCF)FH F1JU"B J"K2F;F)F HP O0 'Hw!)')'K-pC(}FFF"NFYCFH1F(F1\" FL"I F#n(\"! F #KEBEh #iBK2chS#1F H#"i8h }p]'g''Hw!'8F LiB h("! F H#18!Hw!-OFF$J%N  KF +S2"r_C{F:F K A #xAFO bAFJsO#WF`:F# A T:Fx#"AF# wH "# #sH #qOd!qJ8FpI oI8F;\: +$+Rx *gIZ h1 W-+f "^HF F8F_InF(W +TF[I8F(@CSFFLKOYh3|"EP DE #XFaFF F|2EDT XDB% 2K2E 2e 2eGD.I8F;;\ + &H# $I0D2)H #Bu"#BA"#!H# ##"F+FHFQF"# F)FBFI8F(?xBFI8F(ж0Hw!'''`y!pjOue(!(?(Pc(-OFAMFFi(h1IFK"*)FAJGH  (PFYFBF0AJAHAK)ȿF5J)FhqZRF[F:H# JE3O&"JU#Bp*J+K)H)ȿFJ)F&'H2+oK"F*ݸJ)FHx2+[ + 3F)@𴀓B<Hw!u,8~,,R,,,,-6-h,P-T,X---JK"IF#~GK)FGJGH.@FN0)+AJ)FBH"j0)+=J)F?H>D1*+c:K2+8Kj+Z7N0+U/J!F5H PFYF;0IД%4#CTF_F+F"JAF)H)FRF[F 5-є4#C'#0#JHK)ȿFJ)FIFHK2+O! F(sI  }-R-- .Hw!!8!0.R.h,P-T,x-N+-CFBLF@L%$E;KB9K F9N:Nh11Fd"F+5HC#3HV1"F1F0HP1"F1F-HI B1"F1F(H<1!1F$H"F.1"F1F H(1"F1F?H1!1FH"F1"F1FH 1"F1F?HC#J8!Hw!!8RZ.j.y......../-OFE?гKiB!hF'A&Ey INF"Iy# #'"#I #>FF I'>FFO8"# #K Fb? BFH #9F0F D00 E0 OEF#/30-?0 EET~K%B E#+? 0"F3,apCD+AjK>FkJ"ihFBڕ1+0F# C BA[K# c Bq[Hv11A A 6uE E ;CaJHO HN!2BFu $%T)N1# Bu pCBu$%12N!TF]F1# pBu CBuFFO11)"I,#Bup H Kp/@"O + ###HFF Fo( K2+ڀñK#!8Hw!R8!/:/Y/g/K !,#"F+FH<aFF#Bu#c ##$ 4㱑K%ihBHڨEД1k(F#BA*PEq FF5tHE1V# BvՁREs FF1)11A#ABAEkTgH6 #C gBu&F/F_KO |"#V!E BREOJ ##ZE2FQEO#OH;FEhlEc##@F#"F+F @F##"F+Fp4OX0Cp/?ҮF5I 0#R#@F#"F+F #@F#"F+FF %IF ӹ#+C"CFFT"HF@F@?@F N#RCBB# F)Fs8!Ps!Hw!m/l 3h@#yv 0   FoN0 0 0    82+@,@^H( 0! 2;RH2";##RF#FKH2 ?!#F DH!0 P2%?;?C P3H^2";##ZF#F,HN2! ?#F %H>P%??CP '$0+KiF<+hD#1+ FOF @ECBu%68FHw!///////!-GCFYL~0XHb%0)FUH)F"#SH5]-0PNk3j OHi#0+?JKH@ %iB0)FEH3ho(F7F F@F!-2+9H0(FD##F F8F!5(F,H+H0+8!K(H!FG"Ž0۱0F!HpKiBHG"E(FhE$F F F! 0FHT H"#)FGĺ8! 0?Hw!!0B0\0b0i0~00000-AFhF(F"F0F@D(F!Ft3FJ!FF@DPFtF=`n-O]KhD)F hdhhLIK# Kh $ !F UHpr@2 FO 1F!C5T%F5F&(F"()F!(pCO(0#BOaB*F*Hh3`uF)F&HL"(1F#HNpC_. H1F+_ѹ*FOa0Fv8FO EF)FH(F쐱hOa0FsF(I Hd0F F ]!G! HG%HCHlcF^H J! H#!H#JH]`H!oHKh G ":8!0"Ih ! K! "``EP!~h ! ! p`hF Nhcih iGJ03h+ h3`(!-O 'K FF K dȹIH,ZFF9FH(@݁/i+큷F( G(*hOa>sF(>yH< +<2FvIvHO h! b FkhOcu.AF lI"0(F.&F!&F0FeKhCF3DB xX21 RFSKheBF1FHFf0-h tF0FtKFPJPC _0BKPPMF[h0=KSh3S`h^!Fh !F@HBg6h tF Ftftb t\`0+i0E@р7/!x%O{h@,Сh"HHh-h HB-h $h{h$PBF Bf(F(.EF-h4\!T!uHHHlHpzd@u(!HH:p4Z@)hhHhh!i$+b#hbh+pZ`bh`l##`]KK [hc``ZK\`h#sa;h;;`*@UJUIRh:J`-\ `F0`./siB6h!GL#hhGIHJHK( FGIHHdGM$hGNh!h"ih) )F1FBI?HR$hPFcXFa=HDOqB+O h7I2Hh"i62a ih FBzhB -h-Fh+ki+(F($ՂEFO J,?&#!FjhhGF(?EF,'-0F H\!(!0R$I>IpH?fItIIIFH VIp9KpFhð7MC+h+Z(Z5HZVHGOq0Kh#+h.M.F)h-K.J.H)F(h@ =+hZ*`x ,&H%Hkh;k`+HFsh;s`+H (+hZ*`x +г y, Y,n,N,  FYXBXACp@pG,!4!6J$!pP60FCMD:I P@0FC;D !HAC .H  *H!Ԣ'I $  $H#0FjCHD%%%0F!LH(F%#4!0!,!NJpTJdJJJJJKKIKjKKKK-A  FOrF)F!зHi!U*ѕ1+ЕHJ t"! F n{O3dzf`(&0F\(1FH{)|{`#` H|k|)}"|h~#cbk}}"aca}!+~a#~a~e#h#b+#Cc!b 0#"C#cbclCcd`l=% $0#& C' ce(0* Dd+0+qHw- ,3!. A/ ac10 "2"c!ac8F #h"kZC#BB\HOb a8F!o"VI `p"TI Phع6ù66U+ѝ6+ ѝ8S88U+ѝ8+CDHnCI 8(9AKU!"&8F(!h"k4SS 35JC#6688#h"kZC#BB,H>Ob a8F!zo& cF#k뱝%5#%C%c%c5#%C%c#dbk#!h8FJCt#hbkZC#BB HKL9LSLoLLLLL6sRRaALL xOr8FAF!@ѕA0O" ! A0ak 'DH]0B9F@H7e/Fm)Fs B(1#sprx* C(18 aHFFH'I (7(1"AF#(1zK 5 RFh(NEoK 5 "oK@!nJoHB +DDD iI((1C(1(1DD#Dspw D 3{+jrxR2=FOr!KH { {B B 7/F=F'C; # F9J# ! ( ! ( ! 3KB 2Hu' ;F/FF0+ *Hc-'Or! W3F FhσB#"` ͼ 3p3X *"X ; űRh!(SOSVSI`SNh!SS=FHFHI p#O3RFAF+F  Crz *. D3srzD3szBszs"sDBx ()DZ 1F#ZB/RB۲B ';F/FFL opCB[Ѳ}s}BC C[0\gOrpI e*nJ#pO30L-A;FZF]FbH_I KpAF RF+F C@_EQK 5#LK 5#HDD\[Z'[+FAH=AI (5wopCvQFL @FDDBuuuD[#[[Q2I0h)P0B  Z0 3+ChB qF"H$[F HZ0#FH 3[FZ)FFHFHZ"I (ր#spSSh!ST6TNNTbTTTTI v PDDwopCwDuw5wvL BOuuu\D[- P0B? hC`Z@\˱PFHtI >XDD#D 0wwsw\DI,꨹[ 1BHF+FHOI (V 1=I(P0+ڀh[׹*րHF FH.{I [opC7wvL B(ѷuwu% 1BHFFsHmI ȱ0 1[v[ 3wL opCBn1suo1uDDDDF`H/Or]KP8 (@#XHChVJ5m-#XP0B hdP]C\B+F\FJH=I (\+ uww+ -w P#1d0B+uFF0FF 1F6H 8FF8@F1H9FA/N0`H@FHF+H{2Or!`lBСk)#mB#HL X( + ShB hHG /FH=H+ I (k" P khC`3h !XV|V8!VVVWHWuWh!p!L5%+Xh!Z`FF %I"UF% hF[h `Yhh]`"F F U%` UJF UQph!8!K-AFhFFF M%Qhh%P`BF0F9FC F8!h!-OFϰ F xIFFa(svN5uKFhh5E,aqI Lch5E$ k@hndK(eHA* 4B"x*,@5 !* %*+mB'ғ)h*nhnQC#@F0 #BBjn@FknB E,%knDDIEHEH1 v@ICH pnOr!3fHKF=J ! knhO ,(SCLFF F  !*"QF $KvK vlopCBѽ.1#u/1cuL@F#wL cw21w31wLhfC`##6#BBHjn@FknB ,?S 5XQOyWh!8!WWWWWMWKF#5h!KpG!KhpG!KhpG!LR F!F  p-GFFF$4GKZhhHM+h;K^h&hH .`QFHF,@FmFH맱 KZhF rch[Kh!FF H <!UHpr@2 FO 1F C5T%F5F&(F ()F!(pCO(0#BOaB*F*Hh3`sF)F&HL(1F#HNpC_. H1F+_ѹ*FOa0FsvFO EF)FH(FhOa0FqF(I Hd0F F ]!G! HG%HCHlcFH J! H6#!H#J,H]`H!oHKh G x(!0"Ih HK! "``I@!h @! ! `-O mF.$FFFRB0pC_,/!(F8hCxr+*уOaCzJT!FDET@v@.(4O ^#`.0F. &. F0pCOT [JOa(F^F~(Fz %F_@! ]F&FOr@! %F,z. F(t>.#KEBE###3C F(b a ([Xp%t#3 F(K ##& 3F/J!$"!8)I( h+- F6 F I Fv I Fp(I Fj% V$##%O4H 6, Ft FO0 mWWWFF F@pG@pG8F FhHȀ(i ahi`aiaia(j bhj((X`bS BB heZheh"fhn`fnfnf(o gho`g88F F`H`hH`h`h`ztn`lwhd d  lm(d Z lcdPlYd mU(e`mQhemMemI``peQ BC p`"54S+BE+8#FBT#"A#38 FF88  FFSBB2s2sXX\\dsdsfsfszszs|q|pccccccczccpcXvcbaXSjBBb\ V $P$(J(,Dc,.cc$cccH HLLPPTTXX\\8-OFh FFP``hh`Fh`h` `H`iHaiaia jb`jHbjbj#FbS0 FB0SBBTK\%BF-L53)P#V"G`2)D*3Or5q5pj`m|heFmweFmre nn(f`njhfnffFnaf o](g`oYhgoUg"B#KE" 8FHF0FDF@F@FD#$%BQ#3H#3\5SE/D# BQ# G#3P54D5DZC#B4%3TU pGc"0B Dѓ"@ @CpGp FmFlF*h KB 9)FOb F&H&qfq FF(h `h`h`+[#B+г&tO#ct##D^t0F mpLABLsF"M#) F3?hFd(FOb!(OpF Fx#L"#r"pA!papB!crpr#rs2F)F3F[#`^ F`p[KеFhFFi#a0F9F k `н!Kh pG!Kh @pG!KhpG!-CF F@F,K!#BBLҨ(J'Kh9FF kVyB=۳;Ѹ5 Kyhy9Jh""2"2)I hFFFFB Ey)5*FSB `/(x@  !8!,!!bK-OFhj[k^C2F[0/kFF8F )DѸy?۾B=(F9DmF+h+ KI(F 2FF0.kFC I@qqFKP F# *sO#C# 3T#0+#C8 F FC 1#2##PJ`KhkAqA;Aq60F ,#2j(.bHKhkAqng f((F#2C#7Khm Ey k !ih8%@@%l D@8F Ci+@i# 0kCiF+@ #iK0[D0 DB "F I JhFD# 0Khk H!8!!<P  >Ey 0 "ih85@@5DL0@8F NCiF+5"HIi AFHEKhEHDH# 0##"## F)F F!<8!,!H!-OtMF F#!X"!F(FO&NFwKIpJHOF(F!F;h3h# 0 0C ##+@恩HH(#CRC3CI#FC@! K2hlF!`I!F p$tXFC ##bHq;hL0" !#RF FR#B|H(DvI l!HvJh3`;hktH ) !t3h FX8XW@FIF'#"#;h P"#'SK#CWH_OOF@p@OHPHPH (K"g !L0#P H !s"##`09F9K0Fge19F0F[#C$NPx++H'*K`)K rP "# p 7#FbI #BEs 2Hh(ЎEcF F i$iLCcAsYAFH F#2F;F:BFHh0KF0 h!! !]T]]]^)(-OFF\K#BB2F;FYH>XIll#FR ПBB oRCsBBt0FKK9F\%B Os 1E D0rFCucC3EDrF#D$MA 0F9FFx F` 0Aq0iAi"a0 )09FxDFBF+F0F3DK@hc00F9Fo~i 00F9Fopi!3^H!TH!!! FI-OFIEEEѤIIE@EҢHfKgEE'K0F9Fh2`KK\%BZFOs " 1E D0rFCucC3EDrF#D$MAZF0F9FFx F` 0d ȡAqiArKF Fh~!oKnKnKnKh"FmHGwgkN+Fh1hhKh+gKh/=7h0O SEO9F8Fi85p@ O  wFE E $8J3hhT(@Jh*O< JF#TB 9H"F+F1hh5F8T p@ OШ0 *ѹX#BB7RBE` BFRB`2hK`KJhh+ #OsD`!!S^!!!T!!!!!!!!H!!P!H!L!-OF5KFDFBF+FR2F;F-H-I4E5}AE)I*M#")Kg(Kg(K`+h+:8EH0`D#N@#K4` FhB O OzQF]KF`F@F9FF@F2HJ ``! ``0h(`H!v^!H!!!!!!H!!!!^!KhF##`!-OFVKFFOKhkFP A|XFaF (F8O P880VF({@K0F9Fh >K/p.FhS"!`OC"@OgO`c`O# g(((O #(,qE Һ#2h#106 MON)h;hB&X5#*h#Bd10h3hH;h0`d3;`+h2hY)`B#@H!!F`KhkW#! FiO S F !H!?`-OFO=hKhF-9O 2m (FqF$F (0k[Br;hC, D($6kYF'O 0F I9FEy 4 i 7 /D#wHuKhkAqpKhS^XSFfk0FM2BP-T#0 F(XKhk[BrRKhC2 D#)F2FF#PFYFBKhFFFc F@FIFi F@FIFiS !P;F(?//Khk[Br)KRFh[F@FIFi [F@FIFiFB!# 0i#a5F i&#aKhkF@FIFRF[Fx?FF.' H nO #F# H!!`Z`^IFHv `psFFFF FBx+3F*FI p)a-O"K LOp#hk9hH12H,H)gKh{#hHKxH H^#hH#hH#hHU#hHLKh3#hH;hlbHcE#kOy DI#K###;hcOzsBFOsKFIIO0 A  "##d#BF؁KF"F+FdH0+܀OKh A c#LYK#aFF[  F FRH0+?h,h,zi4O{Oyi  3 D# I 00L DqFkIsOyFFzC #gD2KE #c FFaR#(HfL#hk&H`$h,#$HX !L#h+L HN$h,C#HF縵!T!!@aWala!a!aaab5bZb4!ybb@!b!bh!cch>BLfOR9hiJ>KihHs(3hOrII"vgK"`#0NK,0'c# k2OsCWC3BB0k2C3YAF FBB O )OkKh+Ă#iHtiKhS pO&fH (!06hFXk&,'0H[kF TKg0 P6OsGw0F9F(FqF DKh+vg#EHm 0K_FA O@,Kh)5;Kh#2C3+;*(ңn3q-KhkSDp4/H4#QFF(0Kh+l"##Kh((CEE<Kh+[F+RF<*3(`Khc#C*XH!!!P!!2e_!(!@!`! !SeT!be!qeL!e!nsKhK#2CFCv#2CFv .w >"#. Ho>O{ w#;D C .w?ڑKFh 51C""j2"3Kh+i T#gQFF~H{gF FxHQFl  uK G1'h(qro7thN1h4FgH FGi C""3R7/m2"VKh+-)7T'FTH FC(PI#2C#`( pGK`GHGHTh  ##AKh`` O# FC ##0#07Jh3`#0  03hc1KhK@OsBF8B$F.4 gOp'#)`gOpK !##2h `h od h`o(emH! !ee!)ff!@!Bfd$!P!L!`!`n)F FL##H0O0kZkkRSC3D3h#n!IE@E*#DH`CKhCHBHAK`q3hF3kfnH0+Y"####+mlJ#,H#+H0J(шT%KhOr$I$I"J;)K"`%KjRKd ( h FXFQF0(?wHzf#Cn+? = \fT!fl@!f_H!!(!!$!eK -O!xx›KFhjB}\0EwE=Dii&EUDEuWi E{LEDDiO{i&nC DD K{hKs'"#$*FsFC@FEvE&D,u4d4'2C4x,C4pEBs0A{cQkZN'EH0D"EsFFBu',"Fu+FEBCr3hC*s 2b204BE X"! ;K;I" F 9I 2KhjB0SCFFF\(K)Jh\5B #Dii$ XCf#3DCshNCs0FSKiHFh KhKh +KIFihZ Kh˱x0!!TX!@!!X!!!H!Kh0NFO{3hKhj)FFd XC2#F:FIH^#3`Kh+LАKx+HЏN0B3B!FH%0B 5r\0 0K1CAs3DZ %-" K;ҲK1# !V :VK;IO0EEOkKhCZ #s`O#EOERF[F(F0)F]H z*F!s`g G #+*FF #2C#BBHKg6Gg:Kh FE#EX#BBR XC#DBBLC6gw&'.L#hC`VPhl#hD#+EE)в!BOB2F;F"HKF )FH>wEER!X#hD043D4RLK"`!!!fpT!!U f! g`!f0g!i-OF&jFi*5" F)F p(&߱BBJE Eh B Jh ?hh B4E0F k!x!pG-OX"!n#P0'6KF>FF4Kh4K`0jBZ00j!FFd pCj3F*F)I)H#0JH%(@IK`|IO hO IF#FC/#*s)#@A $P# hKF@AFHH3J $Q2H2Kh1H(H(F>#*s##0y0B hO !KYFKFFPF0Hq(K&0;0 hdFHF# #`& ,ghi@!gi7iT!AiLig[i-O!|] xK+U5WT5H0HepK"` H%HZ !/@"#FF)(0ЩHK`H@8  HH3(ѡH.(! :F @@!H{Kh; !#p#CpL"NK!h0hX"!#`0K7hX#hH E@&0ñA3hhO!FF XCCF*F|I|H#0WKj++vMuJ+-h)FhCbfHH*h:BR#@A]#^iKx[+h]hIhHj#f *hbIcHj ]i0^H(-hj8)F(DZKhhCb{Fjy:xQHn(8K"`!)Or!(FjO@'AF(FjCF *F(O (%sEQ3@ *@0e0e0+f!(Fj( *F( ##B3 *@F$#4##(#8#8wi\@!i\idigi,!!!iip8!j!},jw]T!]!H!Kh*7hTLi"H`EX(0+Or!TFBpT(/O@,PS9F5 pFZ%BT/C/### #3!5 pF: 6B##8%9WKPѻESj+#BB3?#C#FHGIH.HK"`#k;k/=H(C3Ck;k###3JpO4hO hBT{ex+6hBVKP#+*Ch`D` !m |]#hh## #vШhhom(FJ#(o## #(!g@!NRjH!YhKhpG!vJ-O}uIhC h;FhBЀ0ñ,h<9FFd `C#F2FbIbHB#0UI#+*#xC))UKhTKxTKx)')(C3x+0B 7F&iP0B !#0FAF(V9H1F8H(X"!F"X /J.J$h xh8oF hxo?8Fj!H#0FAF(?FKQ0FAF%C3CKC;C* }!!ljpT!!!j:\H!jEx!P!!-ONFiiK9FhZF,\%K B 0 F#ZC #DRCsXF3h F RKhKh +2h!F|KbhB#BQFyH$+jF O ԡ# D+@"@FIF(@𿀸BFyKFI) BGCwr1a10F]C@XKhFEEhFhNI `+@KKh# ]# bh@FAKIFB0vw'n ?p*#sC@ApAD(q0`0#;xC:p+O#0C1F F#H0+"##0ZkRRB#+mlK*jhkBдcj`3cb# C L3Dh2`#I )!!T!!U j!X!@!X!d+)7h*jkB$i3a;FA L3DZh2Z` FF:n#!FF8FLOR1hi Kih KhiF% PL F: P !!!X!pG-OX"!biK'FhL#hjBǀfM+h#hj1FFd xCi;FBF_I_H#+`#hO@|C0XE-,)F F)FF FNKEhF ph0oJJh hzpo*mpn L""X xB*UZ=@N` F)F84Kh+J"F+F2H F)FH.Kh+=.H"F+Ff71FE2Fq#BB ##h0 h"I2isihhC ##"II"@F"F+FHg4E^74!!kpH!! !(kRk6]zkkk$!!-O=NO! 4h=hA#!p Z0Kh+zݢm*7$5+sݨKhFH0#$5"K1h`OR&KhKh[F5H(# 0m*?$ݐE8ڸ@\3T*"H!nH L$%H-CC"kB@1IFvH$uKh#P%JC1FB:0HHD$5+\O?h32""nAHRK *LJ)ћ5OsrO sT#BH5##Or!.^lL!!kX!"##jB򷅠Khj9FFd XC2FIHJ#`\5JB xDi #iYC#DWCxhNzOHs0F$z i(F|K:hh + )FiwKh[vKjhB#BsH;h+kH# 0nKhnK 0;h+CkKaJhhKi\5B O{CC 3D0" O{SCBC "D Az0d Jqh0F F0F9F-?J\5B xDi #iOxXCf#3DCxh5Nn:Hs3O0Fsi#0H;hĀin!Kh#i'K8hhKhF:0[IF;H:H(¸0-@]0HH$%* #nAH#@%Dl(DD8hAF@FH/K"O1h`Ki`ORJKihKhiFZ# 0m = !mOm!!!!@!T!lk#l!![-AFF$B!F H%5H- 42n7n-CNL#h 5@LO%TF#h#*A@r#C8;hK0AKAHS%j ?H-HF8(Hpr@2 FO 1FC5T%F5F&(F()F!(pCO(0#BOaB*F*Hh3`kF)F&HLv(1F#HNpC_. H1F+_ѹ*FOa0FkFO EF)FH(FhOa0FivF(I Hd0F F ]|!G! HG%HCHlcF(H J! H#!H#JH]`H!oHKh G !`0"Ih K! "`jP`XT!Hh ! X! T:`pG?#K0јB;"KB;7B KBK M Lh I!J@@B (`# +`#` ``0KBKBKLIh@CBKJ ` ```0 `##` ``0O00KBTTT8!!(!!!T FpKh+FH!FH@`T!UnhpF ` FChK`j bˆ6q2p"6p200000000mekc#l+dmeH3OrH3L3L3P3P3T3T3*q "*pn)F Fp@qhpF ` FChK`j bˆ6q2p"6p200000000mekc00#l+dmeH3OrH3L3L3P3P3T3T3t*q "*pn\AP"\@f4ah"`44444T 5n 5cnkf0000P5P5H5H5ccccH5H5cc)F Fp@ȺF:L F$h|@, L5+]K]KAhhBYhhBUiiBQXiQiBMjjBIkkBEXkQkBAјkkB=јllB9llB5mmB1XmQmB-nnB)XnQnB%јnnB!XoQoBјooBBB B\5\  ]KpGH!K-OhF,MONd0M"FH#OS#ih F(@iO1\(%ڊIf:hPFYFOSF Fi@??IiQF\(xO;hxKh wIwKxwI 8vK@BhBtHABrH1pHipN3hoHq;h`MiF=kLORi h3h#YK!hi/$h\h ZBZA`K_`^I@F$JM`k*h!Dcn@(`FH@F q06  0#`(@_Khc$b!(F~(0+OKh+)FTHSH@H0>IP7HO44H!hOR 5#s 5p,Kh*Kh#*KiF&# 0&Kh+#h%H$K"hh +&M.DKh+KJH) FFT!Tq|r/rHrrirr rH!r!T!rs!!! !Js!,EpVs FHG hO DMcDI# #0jZC#AokOy#>Cw #sD_A #sDC -K-NhF*:+Kh+6ݐ0+20'H&H"(?s1h"0P%ORc0#X30KhKh#KiF# 0+h+k Kh+g3h0+b0۱ H{sh!!H!!!ss!!!sH(?!hO0F0%h"!Wp0L%P%0Or#X30>9F(FOR!h&9hKh#KiF6# 03h !@s#;HGH|(~Kh@3 %@OR 5rKhpKh#oKiF# 03h0+#mHlHO(hKORh#0]KhV[Kh#[KiF# 03hkc)"[HXH'(TKORh #cJKh/HKh#GKiF# 0JL#h+@3hL%2<)0B4BH3h" 0>H0OR1hn-Kh+Kh[*KiF|,H(# 0 0#h+\3hL%2W0B۱CN#H3h 0HB0OR1h* Kh Kh;KiF8! H("t!!!+t_!NtsttH!ttt# 0 03hlkB2ЧH4Khk[Bd0H0OR1hKh]Kh[KiFH7(# 0 03hl[kB2ВHKhSk[Bd0H0OR1hKh%Kh[KiF}H(# 0 0yKh*\3hF\HX' 9}(F( X 0뱙B oHpK*FoHF0 "5I+-E?="H% "7/R0WHT0OR1h32OoOc;`/K8h#TCBOB>S'J`"(M/F1F'H'Hkh;k`+!HIJ+hZ*`x ,{h;{`+ H ( лK p+hZ*`x +y,Y,n,N, BY, T!xd!P!y!ypDJhp!еF KFFh H2F;F!F6Hk нT!"yd-O$1K`1K`1K0@F-H-KO7>FaO` @``a(&KAF&MFaO @m`F-`%F @``a( F( F0F05Ea#`@\` ``P-+- F!!!6yX!!ط!-OFJKFFh 3EED4:F4zBKFBFiuh51iBRHB)F h,i7(FEFIJ#6M`HJ`+h+CI1@x)1a1B&pBAFFkO BL0FqD;0#6nC7KhgL;K`O3AF$0`qD[$0#RcFFh]`MORiKih=0iF H& `l F `!h!X!T!X!!U j!!!@!K-AFF@P&P%kiE-i± `F H>")FnW&0 F#aG&@(FF0!Q{ KKi@P"0B i@"0pGiBF iapG0!K0h 5sCKBdsEBB fr#BB 0F0 0 0!^F)(-OFFFF g ED(@@FIF(:Kh(6JShF[i[E"YFi#{A##kA#0[iSEK"QFhM#_A#g]AE4!!!pG-OFkOAHtP$$@\O@ 8B(!DJ4I%F[$pQ$`8BB R$%D @ @DB$v5pXZZn+'\XBXA R۲ [۲#@۲\C  FHm{ Fn)'\@ QY\#RY\#B  X\@Hp{ Fn) !TP! !R!\!THH{ Fn) !TP! !R!\ CTH!{-GF$F E)D@π!Fn!F5ncI+F*O)1aO1A*O)1aO1.)T!F0o $uIFNF  E(F DD\$J @*2b2F`EB 1BF!FX'U!FDQ*H'X"!FH!FDH" 0RP">. !FX&.!F*H&-G}FFFFJFLF(:FfI (dIHF^(FO7H"F_IHFCF Nh+AFZHxkk+`#k`j`j`#k+ackakaa@0+bB0kbclb&MI0"QFF(F*FHI8FFI8F DI8FBI8F@I8F.c2F>IHF0\"F2IHF0BF8I X"!0FV@Fv0E@F!B0|aCE9  ҲB3E,hEc|Wh#0 :h0 "#(##*#*#0f "F`'8F }|d@edA|6|?|P|\|n||zd@|-Am$OcFF!FFgCF"FF@FF(F@\9`#3# F m-O mF.$FFFB0pC_,/!(FhCxr+*уOaCzJTh!FDET@@.(4O #`.0F. &. F0pCOT [JOa(F^F&(F" %F_@! ]F&FOr@! %vF,z. Ft(t>.#KEBE###3C F(b a ([Xp%t#3 F:(K ##& 3F/J!"!48)I8( h+- F6R lF I F I F(I F% ꯱$##%O4 , F FO0 mWWWFF F@Kh @pG!KhpG!-OFDKFFF@FIFxAKhk2F;F2F;FF F@FIFFTFO` ! @O0O0g-O;hY,K(F@+O3cJ]3B"Hs&^ "JUh*)XK@FBHZ;hYS]CVUKhHHuK` # #"## !!!|0!|T!tg@!Kh ]pG!-OFFFVn0kBOsw2F;F*0kB[i0HW/K0F9Fhk0@F 2FIF;FGB" 9BB" [EFF\E " \EBi"a Pz\FFFBУi#a }!-Om Fh"!F :"QFF(F B##BFBF @FIF2#BB1@FIF(#g###RFH8KhHHXK` &}T!tg@!-AOB F ! FF;F 'h("(F#'0kBSi#0F9F,MK)hxr4i" i"agOR Li| Kih+hiF# 0!!!!!-GFi FF}FFVKhO JFZ3KF`#Bb!h+ kF+KO! 0 I##SEY! O3 C1B!nn!}}~?~!F^^Fe~T!__@!~c\\\~H!!O3hD=0F#F(@B2#F0F (@3#SOF B@;h*O"HkHJ#O#4$TEt R! \A_>H=Kh=H F@&[-OFF!Fֱ3 3$3F $O<pO<@O<+<4FO;h o BFQFHKFTy.@O0<!RF@FF(@KBЮHO%, 0X!]DhB]F4jaFjCa#,H ##hLb# $#C X ВK@QJ2 3gRFIa#0F9FzV h[ ###H#BFKFj@#kR.S&3{K@!zJ{H'BӸ #F c@# 3B #?gc Fg #"#ig# BB:# FjF(@#j_K1hBt3B;B@ciO 7F RF#hBiciB"##EP{iY#ON AQ# # FI BFKFx#EE0j$!m#80XF(6iI:FI FLB F :izd@6*MTJn֑#C#BB#BByѴk-O% FFF.FFG]VJQFHFxBP(A(Of(p(&9F F~0 % # FKhEEI F| FJFF F!H6?)ѷ?"ӝBҾ @>FXF!`C F\F^B& +FB!@5O6FOw]!pF-GF$F F (FF౩g# w2F;FbBB F^ *F!FNB F-CF$4& hFhEJhU"F+F6BBO0BF @E40FC4#RS]pG3FS[bh_)FF F<0@pGF04[ HD6 ]pGU-O!FFF0TF(C"vI4(@'ih a FsB 4+ӀBFKFlI(F#mbm$t9FXFXF 9FO # (FFp.4+#(FXIO0YF6mB4 +#(FOI+ݹLKKJ(FFIImOO (F ####BFKF(й#O(F !! (й ѳFgm8FX(6#mB 9 #I i 4+;FJ!C#(FI##!(F](?csaPF F ''NrJFlΓ-O!FFFGF wI(F!JU#B 4+2F;FpI(F F-#F)32*&+V+2F;FaI(Fq#"(F###"#( 2F;FUI(FX 4+2F;FQI(FrO "##(F2F;F (nД)c)aд! O Ɓ# C F!F!# L KL  C2F;F.I(F24I + F!(F$I1+# (F# ##BFKFfBFKF(F"0  4j FO0 4+O2F;F I(FG"@g]y--CFF OaF&FH@uH9F<0F #aTed#$4##OF@Oc!8Fd$C9FOb F]Ia0ZI Fe@4pCO$4'{$BRIr0PI$4 NI#C9*FLI^0II#C+GI F&jdF$Os$4#Cc$$#@FIFC#`IFd#$T@FIF*F(FqFF F F)I,4CgBFKF$I F2F;F F0"# F0#" F#B 2G3 F0 C F Fʔd@֔d@0L4F  I0 I F4"FI Fd@u8!FI!(F I!(F!(F4(I(FC 84j8ڕ,-AF jFjF&#mamYCh&ae FAF a(FBF I9F(FCFI(F4F FF\$ȿ$ ¿)OAp F$*pOqOAqOqqOspOOsp ÁjXm j0pG$4jjPm0pG $4jjPm0pG-G FhF %0 MFIF0FK2FI&(H FFF;h#h+FFE RFW&06I#hH KEE W%02F I5 H#hO0Rt~p9a$$#^0A1F#FL*s!hIJ hN("h I #*#s"hI(F3O0 p@(ŖՖ-OFF# h*Fs FOUڋjs kc#*sG@  BO0j0F(0FVF-^Ыi+Yi*VУj BR(qYEPEF(qYEPE::0FQF#kF3 XF`$!80m#jFiF k "IFXF&AFHFG0F0QF0FAFG0F0ck0FiI-i(F-CF FF gIp$D#@FIF"FvC IBFKF(F^O0O1"F#0F9FbFFP2F;F I.w"F#0F9FN B-O#"#KF FIO&hFF'O # QFY  RFIHFO6 I FDD#C C#0F@(]svpFM$+bY1FHi4V,p-OFF FIFFLL@# C)x2F(F)QFYF"2FT(F4B(FR?-OFFF gF2C;CC)I F(ȱmEZF$I F 5 F)FF8ZFI FwO:( CC0@9@@A   Fa0)F F #@@HI FT0ZFI FpPFΗ hsF F{ L " h|(`x8"h0FI7O0Fp@(Ŗ8Fi*s*a*)FF$@0O0 8IO08 8FF FDHK!Fh(I(FO08@(3pF h FLKhL(`0I0FO0p Fp@(Db*FL*a* 6s*t*#i*0(1y h+I)# `1]010O0  1$@'  Fh K!Fhz0 @BIFO0V@(hе!F !IFF!v2F!F( H#0;F0H JнR )-GF FFF)jOJO FI9$$ F(:FI F:#"## FBFKFP F:F I$0F2O0 ]'Ø-O!FFFH_I! FX("# F##"aFFVыI$T0A1O#3!BE)F@F)F'F@FL6G6GK[O2Bw6C7 Fi pI#BsFF/.jI6OOO FG7;0$0FF_I#"#g F# (FVIv4 FTJjh8+`Shk`O3`\#`4##4#{A #k#2C3 #0I$###3 BCb#ke jJE*ePO +mE AF F0#  +>RF[F! F0 F4jg##8I FO0F 4$$j j@ 4j##4##4##PFYF ޘ)Ga'*K0FhB(I Fe%H#+$#H$$#F FHHx! F(HpO0 jHh #H #H8J!hFiFH!mH !0iؚ͚'EYьl~ F$"8Fz-OFFF!8"0@K@JIF8FCF]f*l*R(FAQ+]`6I0FX4I0FtF02F2I(FJ0LO` -I(F #F@2!飉ZF2F&I(FDE F$ ! @(pDE F(F0 KJhBJ(FI O0Wu?ITJpDi{@(FF (!FFX#gECaaaabCbFHCjj F@p-OFDFF d#gCEy $i4["jIPFV L XEq @gPF[I7 FKEiBEBBы+- 4Z #PFNI#BFKF a#bcbñ+-+EJR# DJ-DIPF@KAKS%0p#a@F#IFTF(] gbCbEE ci,aka aT#ea#AEE#ila+a]a%a#gFFg(iig#{Ag_Ai#cigCahaeaCi,aa a(F(F IPF @O86Ĝ-OFFEF,u/"F+F@FIFrC "FE +FhaCD"F+F\C"F+FiAR#aC# D(@#*#sX  #Eyz#i,u"F+FC"F+FiA3D#a##gC #gBA:#gBFFw/#C,u"F+F0F9FC0F9F"F+FaCgDg###gXFKA1kPF *-G F isFFF ۸yrIVY4pIO0Fi mIX g #i6OAg+a#i]a FKFBFyAr 1DFEw 2F;FXIPFP#igKA#6ggV@#i+a#i]a F~@FIF:CBFG KF0 gD#Bw,g iɱc!G f 0IPF v(aEaa,I`aG#c##{A#9Bs5 !I i I gBqIPFHaFF#gKA#X #i+a#i]a F.g@FIF0F9F 0Qk iBipGpGi FpG-CEABs  !X C Bw qF c e𵋰F$ !FF0(F IGO0g !J(ȿ  Fܿ# 4 4IFK"F I IH$D I H MU$4 HN, ožpߞ\n* ؂*  **   IO0H*8F FF*/* * 8** 8* *  8 8 8 8F8 8+ J@! HZKJR#0 F*FI 8O08gܺ!l-O2OCF F(0FOI FhMJB BJI0Fl(F0FO F`Eґ0c #BEs OO 014+BFKF4I0Fc@FIF$$#F̰O FF0EF4+ݗ0+'J@!'H%K[#0RF$I0F< QF 0FGC$H#8)Fm0j$XCS# c "#5E#RC2C3E#  7 F(FWEV۟gܺ!-OO FFFF#E=yJ9F0F`Bf( A(O p(s(O #)F Fd0jKhBiI F F 7! FF#C_I Fej% F#t1?V4FjQ1E114+ݗ1"JHP2BHK D02*EJ@!EHCKBFCI Fe!**<* *:K*F[F8K*F# FF# 3I FO5F  8H#1F6q#F\<F`\B#*D2C3F#7 F0 F0!@"u(F#(FIF FCFI F%(F i0  g!%Մ>Z)F-IFF) h!O!M HOM FI&jZFcF FF8*FI F~O8 FG?F*F I Fo;F*F I FF@F]'Ҡ-GFFBFU. .g 4%NG 4 N2FI FO581 $$j~;hj#h(F##O###9h(a FCF2F I FKF2FI FEF(F]'-OFFFtJ9F0FBFr-pKhBoI O FqFF F!-gI! F&! F !  F! F4; $"XI F$*:HTI!*D(64+N 4+F! FF(=#OO " FPBDI FsO5pjEE| "AI""?H.B>H*9J!BB:H9Hh$h#3! !2I!( $hh#3,H!H Pm#$!8[#H#H #R HOabHH#1F#i"j $$iR F mpPsҥإlь#P{RϦ^-AFFF$EMBJAF8FCi(a( g(Dl(u(DD)F0F0D0KhB/I < 0F!0F%FD'J &HR&J #HL$H0FBF# H< #H6 iH*H&  |#!F#*ji/ p-i8FiPsҥإ`-AFFF!8"^&KjFnFh3SsEF*F K JAF8F CFT*l*H (O0$1F FX0猱 F0 L" I0F KhB I 3F J F\! -ni9Q+B@+pGpF F#F"##J1F(FCi( l(a(Ѵ F F0 H  KhB I , # F#"#1pؤniFhB h`" ؈" ʀz rF 3 BpG-OFFFR F> ڈ>p > z>Dp ( FH F 3 , Bљ0s+Й0l+0+K$O :" PF @2F(FB<4,t$O "HF02F(FzC"ѝO01F(FJ N0M0L0K0J0   4,ȍ-OFF x+"! FG 7"F 6%I 5  3 2 1  . 6 ( ѝ00#*+L%O IF0iHF@AF F 5-O7AF F'8FȍpFN$2)FH4SiipȍpFK$F4 F5r)F`ip@pȍ-AF4F040O%H CF#I(Fy9$F"FAF8F zII(FhB#FI(FRD8F 8F 0hF1F CC00#@c0f O0C :P-OTFO FFJ1F(FCFo,KhBгI LF(}$!F(nI8FH(g@FYF,5i;+.,,m,,nF(K%jOq(FF(AIPF(:O "##1+遉LF(ŀbF(𺀆I0F(𳀕!lF(I0F(𣀕!\F(xI0F(𓀕!LF(qI0F(!<F(zjI0F(tЕ!.F(ldI0F(fЕ! F(^^I0F(XЕ!F(PXI0F(JЕ!F(BRI0F(<е!FMI0Fx!FHHI0Fl !FCI0F`!F>I0FTьF01FHF(@!0F&4I@F^&jz!FhF -R(F+I(F*()J8! F($I(F(0m!pF(I(F (*FI8F("(F@(i G'2?NWbo}ьʪϪWu,F(怉F(%j#h$"j#Bu҉F(!F(zrI0FqJ+F!F(jlI0FiJ!vF(YeI0FF(N`I0Fv(H \IF0Fl(= F(6VI0F^m#$!80K1FPF534FHI0F@(RFEIHF8XPFJFBI8F0(NHFHF PF E#52C#+*=RF3I8FxPF$i8F&F(8F+IXF耳)IXFF@@FZF&I FF FR"KB(FT F 8FO0 FJFIPF(HFI) F.?ьʪPsԃתsWuTJhp-OMF@FFOJ9F0FC F(i( POKhBЩI l c! F$g~ ѠI%! Ft(! Fn0љI#aI(FtK((FF<II I F@$$# I FIF(ЉI(O2#P FI(FI(F(ЈV$QFQFF2 vI(F(ЅN FF*FJJF0F9FO 2A3# fIF#c#2C3#l(]Ih (ЋF0{"XIHFlF(:TIP(?jF;(2FMI FHO5&(JI(F8(?RGI'F(F.(?GVEw O#BA=I F!HF4$F6I"#(1? 0I$$1F $4B5UEOs $#3!1?I]HIWui4.<Ϫ^ʪת\!yPs߫@($$1F $4B5BIF(?I|(?fOrF0FI(Fn(?􇮋F(?OKPFtF(𦀰IX(瀇IF(FN(݀? I(F@(πI(F4(ĀI(F*(𹀇I(F(𮀇I(F(𣀇I(F(𘀇I(F(I(F(I(F(wЇ1+#*s̱0Os111gsI(F(UЇjpI(F(KЇ`RPFJU#"1#1?aI FO0$$1F $4B :F`p$48"0D8FF(e!"\AI(Fn HI FqRFV`CI(F^(ЅFI(JF=I FW8;I(FJ(Ї!(F6I@(Ї!(F2I4(Ї! (F-I*($""aI(F(ЇBF#I F8F,$t+Fz*1?5Is G'2?NWbo}ʪyPsԃ0T$1DBF @EF$#31?QI$:F1D B$)F0FO\ OO ZF|EJ3F8hQhO3`# # bb# # ˎ"##9F 3e#se>QFe0F9$$+F0a~1?(I-$$1F F$4B#QF0F5a###$#0a3P1?I F8 $$1F $4BO50F6T(F5p'ӰFFt"!#.2@%!K 'K (K")K"*K + K!,*F! F9F0FRSi@@iL!iXF"!hF"x!FhF pF" FhF!ah"hF_hh3SB"FF B J IfjF I CI \B $pd'ip!!KKpFx +IK&&x+@h Bx@C^0@B?I @ AF uJwI :Fbh hIFhhqI(FF`0nIF(F>F豊(F iI(Fx(𿀝0+@𺀡n)"l0F V0@𒀇^I(FFFZI(FFF RI(FJ0n##QFv (F0=JEI * **ѻYF JF:I (AFJ5I k 3I /9F0:l1lckB(F"l0Fn 8"l0F!n 0h1+n!kQF"l0F!n 0bn#o;!F(FG0mI"k0Fm 0mIdԾKB#?Ul-AF F 0FF(FTF|9FF0FnF F$vAF F((FB, F FI@]8B-AFFIjFFRF +'CFO08FF(А"!F"9F^ I0F 0н #I@F* F&iF0 F@ FFF:#BF2?#`O08F"FF(F2!( FFFF#BF ?#`O08Fr"FF(F2!(d FjFI~0#`O0]9mF"!FI F027#Oa #J _:#xKH F0D 7#Oa # J_"#xKH F0D mi\pGhJB ~BBrB HpG JBrBHpGHpGHpGHpGHpGPPrFhJB ~BBrB HpG JB rB~BBHpGHpGHpGHpGHpGHpGſrF-C_BDFF FF(FB 9^)BF)F0FE0FKhF0C {,"FI0F<9d%EEХB5/IEF N3G@Os 1$#+*,.080IHj)-,˹.0**+AH xh300[Kx:+* ";H()F:HF&&$'i)3H<im.7/, 5-H*#+H$*H 'I F0i%I F0b ""I F(BѽOsBTHP6i(iid! )17@i8iG+{uOS_iix!oLFHOsBH *Cy0 I$jF% ]0I(F F0i8F"!hFjFI FB0I i IF0 KOq J H I F!0I m:tiIF0I I F0KOqJHh0 F ICF HP$ Fi:ti F!"!j #  I FC J IF I F0I L B,i/IFjF^0KOqJHI F0 I  I F~0 I  >:t6ii #I Fz0JIPF I hjF I F0C0I fJM`ipFFFHF\(F\< D5-d++<HD- > p@ /lG@pFFF!" FI`PCFHT$ Fpit  IF(K!JHF ! F:tU  IF(K!JH( ! F:ta0" F!" DH!"!(F(ObiF F ^( H 0+ѝ0+ѽ0i+ F  0  IF0 K@A J H I! FU0I B:tm  IFZ0 KOq J H ! F-0I ׯ:tw-O=F"!I F#L00OsP0(ڴI P0'+ @׃0F$ !(2<(܄B2FF'-  # K0 HKFKKKKK(!0!!"F 쮈kԣ2*1O 3rL 33 SJ$;# @B;@BIأg#1A2B&@OУg*O &&c@C;#%2A$2B٣zbb# 2S;#"O1;FEkB1FnzqyOaE_KOE_KH3OI3Oc3OC3OP3 OS3@OB36BA&p3&p@K F;H*!0:ND"0 +@#x+~+#+90+*+12+++3x+tcx!$IF$Hf2x*c!J!Igx+FHI7BX;JHJFIiq+x!~!d!*0lR9]s˿3x+ !y'FxOxHIbxJ#OS E > 3x+xHyyy(y H:pFHj73x+ՀxH^@0JB@׀IHJ3x+x x  HFC!: FH4gz#zC'KF  HF8  FHK '0IC ) F FxKE sE vJ~CuHEFtJtJlH  :jIOD /^Yx)0jHC!T2x*H#+0+'+:!+5aH6 ++.^H/!+"+(\H)'+%+YH!)+Ӗ+М+VHVHVHVHVHVHVH VH VHVHVHVHVHVHbx!F2)cx 3D c + D '+?|%@HJB@y+Ѐ+@CI#Hf3x+y yHC!ZFHRg{#{JC'KF?F cF 8FH: J3VM@`jqPl|uArF ?\l/4JTdv{&P   p*0BIC'_F ?F;KE sE 9J~C8HEF7J7J7H  :5I :DF /I0H3x+? "zy,H(I)H3x+?!z'F&HOz7yxz9zA!HOZ(JJFb3x+?̮ !FH =1PrF uAlR0IFjFBF HV0I n(F$:(F F%0i sF F jFI?F$0F0KOaJH. FiFI Nx1$F J I I(F J I : Fx p:t F("!hF jF I Fv0   6i(+I*L!FFHR:% #IF 00I FI I0F 0I$BȿB , 1F HJ4 (F xi 1JplsFFF` 1F F0*FI Fcr𵉰IF0#`O0(F0FZFIF3FI8F0I L I8F$0 I P(F F iH@ IFjFV0K@.AJHI FC#*sRBcC#! C F Ig0O0 & :tii IFjF0 KOa J H I F=0H &ʲ:ti IFjF0 KOa J H I F0H| &:ti  F IF0 K@1J HhI F @B+7 F F0J IpI(FF0KOa J H:0 F I KF@B0+B7 F FG0J I60I I(FDF0 KOqJ HI F@B0˱ F"!I F#Z0I ipFIFFPFĕ jFI(FmF3ĕ !hFIFF0F@F(F @Bp?vi 0 F!IjFF0K@dAJH|!F(F0O0)#*s RBcC# !C C !#\F(F I FF(F@B 05:tڱ?8FI?F$(Ft0 KOuq J H(X) F^I D 8KбL! !!R { J HG "FI H ?R:;G?0 +Fa+W8A+=8#`O0jFIF0xO4#` F"WCFIH$ FLlFvF J Im!HOML!(=FHK"FI(F8F+FHKl%kh0FG-hm!HJ KI(F"F H0F faRU[|p$A`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH# 0 + $ A;+#`O08M(FC>+ #,T 8CK\ g!Kn+ BЛiFpGVK!VH-OFhEh FOy 0MI4g LKI B,I DF vGwBDD6GXT FFFFFGFF&'024I 뼹i+0-h-Ph+XxF(Bi*ЩhVBB B(FG(! 0SBA(FG( <0#EE E##Ey##+ I * (F"뀖Ȼ!)ɚ;z76e-O$mF FH )F F#0Ik FFF J I $I ihF踱-h-+"!"ih]h x*\++tjh FI(khKz*oZz*qњz*sz+u3Kx/u F[?FyF@F?FrwJxI ! F7"IF \ rI@FO < 0@#1F FjKx+6b"IF8F\dK:FdH)FF@F 0@0^K_J)FF dihF(?ihdh?_hZ F%(S+ TJIhh FFF &1F F{F:JBI& #Oa#>J^ꈪIF=H"IF>\8>9I@F `0>7HB5H"IF>\">1I@F J0B.H 1F F0J(I?#R&Kmk:!##JOa]ꈯ;x+CйHd8Fd0DYz8BȻ!f! did!iiMAhpyi%~i08F!:##Oa#hJ];x+йfH8F0D/?̮{h1F FG?hT\IXF @FYI 0WIVHF0+Ůt0"1F FGJTTIH #-# #RAIBH#R>I=H#R:I8H #R6H#4H# #R(I(H#R%I#H#R$IH !Km/{h FG?hKn/?حh"1F FGiKx F0F Fi+4?>Ialf!Ȼ!𵋰FFFII0FMF("hF~jFI0F0 h+I j" I8F J I^+`+h"F I B ؾT!6i(^Pk-GF I FRF0KOqJHOL;h  @Ox*F0FF(FfFȱFPF[CFJ1FPFJ 0FIFDt ,C<`O0c!sFZI FF z#`F(FZF F F LF h[F``(F6J hiO0 p !OsF I FF(K!JHxF(FF FFLF h[~F`(F6 J h.O0 pp!O-AFI FF(K!JH8O;hbF@FF0FFF F[,C J1F FDtC <`O0X|!IH pFjF I FD0 K@ J H J h#pC#p#Cs`f:t!0IFJ!hFhh#CTh#`"jFI(FC0I I(F( I(F( I(F(%0X!5ip  F[FHJ/[F H>[F(!FH6L H.l}u]s-AFFaI*(F ? BF[J [Ip("!hFn"!FhF\jFUI(F 0xDFOI R jFKI(F 0JI[FHHHIB EHBIv) D @F2=MFBX?B?(F'[FHpHlI 6 5 F A ܺ ؾ d6i(Q^dvr,Ru?Fh F"!@ -M&FFFFB50s8 fF$3FľľĞ40 40 0 0 pj(68 hkbbhj(O0p FFFh(`(h Fdp1F"FF((h~.`z p Ft #`O0p𵥰FF*FFP$"!C-*~7#F0 #`O0 ji!F8FCh ``c`%-GF FFFj2FaCO1BFoB Rh"+L##Bw#BA>"#0F9FxF04 #`O0 j)F@FV0hPF `k`-OFF# F@##`i 9 (Ѣ~(@ IF "!V-=---@@F(y6I@}@ K.FD/!8FnF4#p 8 "!HF$"%"JF 1F8F.FX i",I2# X8F( #Y0#X0,, X Y* ~#`L8FO6$#O " Fj F"x*O .^O "#`O68F@O6$\I@(@OrYBڀQ)Հ@A\)@π!^ [YX\0!"!@!YP9 F FO;+6D2Ҳx^ X0O6 X .:, ;+6 FD2x#a(W<A(7<0< ,+ #ɲ C +t#x*q!Fp78FF(f kIF 9F(FF(FV/O;F QFXF0F0+7,51FHFFKFJ I9]s%-x1F(F$JI "FVF F6% JI   0 00O08FT7 -OFFF!"0F%F9h;F:F!FXF[5g``%hYFhFG F5F00(  0]- F#`O0 O` O0 -GFFFF#:Dj ,2!i0038hH($+x-+QFh()Fh iaiA8h*( 8h"( $h#`O0bh* (x (hH (h I h FF1F8FCck s`i3a\ #L-AFFFF=J#`O0 ri!FF@FhC``e`(F-AFFFF&0F&($#0FF8 #`O0ji!F@F=Ch ``c`FF$ !FF8K`Eaa`FF !FF(K``Da-AFFFhi0hkaavFFB  Fphi0hkaabO04i`a -CFF (!FF%F KBF9F`FC_a0&w F,(F F-AFF ,!FFF KF`%:FH A$_b1FCF;0 FѶ(Fļ-OF8!FFFFFNE O 1-  B2#`O0+h(FZ& "FhF3FuFGйeh!F64祱+h"F(F3FGPeh!F4  BO|C@`-G%FF/FOET<^h&hnAFT AFFGFPFk74(F|*h"t[hG pGh00O0 BjF#cbdi j0O0`h$h,0 FjF##bdjhiiAhk0O0 `k$h,0 F8F F`ciE``a`a# F#t8@O08pư%IF$IF0FFX`"!I!H R#`O00(FF FxxFBI Or!hFx*("x&*(" jF I0F0 HN FpdkrxJiIH p1K!-Amx h1+:h/+Hf&p iKx;@FH df!F FFeh0F)F$hhKxB(F( FIH ܹp FF!F(F"V FLF`"I8J;yh320[ I (O0*FI F0O0 6u:i"F0J II FTh"fx{I F*0#`O0$0 I Fw0I d<9i"!F}0 н03JH+"F^"Fa0J IjFI F0F#`O0 I F0#0I /9iK"`pGpG0 O4S+E-hp(O)F ## 0@pG RVV]pGFVFH h Fz`Jh+`! RVV~]pGK[hñ# #"!C -"CFHO4 F!q0(iK%[hӱBF#*F! ##+Fh0!F\Ht%  $ d (F^FHFPHNHNH$~"F  HK"HIIHNGHEIFH:  BAH/"!O0(" "W9K`F"O0Ch+2H;GB* OrB ,H,!(F#h+$hd" " Kh$+OrB+ + O3 RH"F "F H0!ц"O8zAs%&SKh;>+`Y T! "D!0p@pG L IFF F(!FH*FI F  p?0"!H@FI MF(` I !H*([ k`0N!Q h(&%Kh'LO N@0@Oa Cܲ C @ $ EA K IJ-D4BK`K !`( hKIh @ CP˲C #B K ò$C3BK`K `!(0 hLh+$C C!BF#CI`BK`K `!0(0 hLh+ C/F۲I`BK`K `!0( hIhCS_FL`BK`K `!( hIhCCOFL`BK`K `!( hIh!CCcoF#CL`BK`K `!(p hIhCS_FL`B"K(ьhhMhCQK(@ C_F I` !B۲I`BK`K `!pK"#I@h]$-AF!J%FEE9F@&FP9F5&0F7 FhFL"FIZ F8FZr(`0l F xn+Kxo+4&&Z^%FI렱x!Fn+ Cxo+0(5F 8F(F]sIFFH rp-OH F #JFAFYH.XN%h z%}VEV <BV<QKhcPK PIV,(FNHXFV <% 6kII+BIJ+FEM FCIF()FEH0F0=KE=I(F@HVh(K(I(F,H#-H###'H+h+%JOc#AFJF8FGF`+xS !(Fp*F9FHHKI(F H  !?vru:R lь*FemHf-O]F S 4E3Fh S3 S3)FFFhYFH,#1QF,3!FI Ff0 cI(F8II9K Sh+F! O H "IXF頹#Z"(FFP  E\F #!F8FFF(xKh $vKA #sH/qI!nI?lIkKB 8A(F0 G!@ Z  S"YI8F@ _I F0 ]I;F[J[JOa F`+FO@ '48SI 4zFBOJ @FOZF0+-+H'=!HF 鰱"7+CDX`>IHFJ(л ~0!H:6?F(<{H.xe!w`]s'F:pI0+9v  ! 0_H^N_J@A 43h 4h+*F 4UHV?+h+#F*F!FNH  $"6 4@4 S7F3h< 0 Z B! | "F9F(`$D#;p4v3I 4"(" 4HF0)Hh)4H$t3( OsBU)FFH.G0+?B 8A(F 0H)F>$ 8@4F ,ӭI ] F ]qF hpSQ '8F T9(F(Kh8Kh@ 8F8!(9xn+Cxo+0K"`FC H(Fo,.00F0 H(F>'`,!(F(EpD'P7D' F!QIFH4 p-GFFt"F8F!F(.N#.JĠ#`#`3`AF*J(FA+e8 (.- --------"CCC"FIYI YC3h-UhIFX#V (FR#hZ\C#`;gi@(@(0] d }t#!FH0#F*F I D[Oa `#J[ `8 \8F F!F HOb)F FZH!FHf)FH8@ 83Hq<IFHT p-OFF#MF`FJ(,x0#`+`J1F FCo(#RFIY.I Y+h,AFV#TIFhhOLi@(@(m c#!FHF0*h++ $hU H? KFH#F Id ^`/^8F F!F H*Ob)F FH!FH)FH8@K83Hq|IFH (p-OFF#MF`FJ(,x0#`+`J1F FCo(#RFIYnI YN+h,AFV#TIFhhOLi@(t@(m c#!FH0jh++ dhU H? KFH#F I `t/^8F F!F HjOb)F FH!FH)FH8@83HqIHf jp,-CF F F'N#09F&J F2Ao(#BF"I0hY I ZYKh, R 4W#ObHF)Fph rh I6thOb)F FrH!F H|)F HC"@(,i<`qpm e"$F#F)FH0rh I F+y$IFH< p-O%gOFFF`")F F.FFF`JQFXFC^l(.M(=9(o+G(XC U('g(Q8hO`gs(m(o()Bt(4u(>8hO  goCgoCCoC 8h#g8h&#7I8hY6I pY8h%0KhEp">o  g& Z#4Wh58F4#`й޹8Fb0:FI 2 #g cg.0gECj0oCg#0+@(i0M d(#!FH0#F*FI [$ dOa F# J['!H&b 7 F"FTxB(#F*FI 0FT( FI@ݿhFU( FI@ͿhB"FBx ("FI d8F F!F H4Ob)F FH!FH)FH8@U83HqKIKKKKFH (o:pKpF N%*F!0F(f``pFF I !F (Fp@%!-CFFH"F F!`FH"I FrNJIF8FC28F(S  kkkkkkkkkkkkkkk  kkkk' kkO kkkk-k}Ukkkkkkkkkk    kkkkM kkU kk] % Oukk=Kh=I >";K:Kh+6K"`i#s "iF0hx (,K0IhicCS-JhC`4iCi# "iF0hx (K"Ih i dCCmiCci "iF0hx (KIhibC3ViC@RiC3NBFI0hXBFع I @(.!!:!QhAI hB `Bi"aXBiBbaBiB@aoЉJh*SJ!` ՅJh*IJ!`i"raXBiB2aB|J!`Bi"BaBiBaD"`ZrI(FXqK`pI(FXiCa`bkI(FX iCa bfI(FXiC3a`baI(FXiCSac\I(FXiCSacWI(FXiCCa dYRI(FXiCabMI(FXiCa c(F#XRiCCji#Cf "iF0hx (=K>Ih=K` "iF0hx (5K7Ihi`bCBiC>#` "iF0hnx ((K+IhibC( "iF0h\x (K#Ihi bC "iF0hHx (KIhi cCiC#a!!!~o!@(K"`xKh/ Y#Ob hh  F$i]=O E% 6H& )F7H0hK+  :hB"F #s+F"F+I  " EOa(F##JZ #   #@C*@HFHF"F H# "H! f ]! ]tWg8F F!F H~Ob)F FH!FH)FH8@83HqBx**AI |pF@h#F(FO3c`#h"!XhO0#hhe`i#"!(F#h(FiiF(:F1F(F@ChFOzrFFhF!%ZCP(+F:F1F`hO0pGsFF F#!F`(F##2F(F hJhB`h(ѠhFFh`)FhHO0Fp!P(< `0 <pGFFI°B/>FOS"@#A# #>#? F(dhTF HXZH#`O0 B@o B-OFFFFB^O QF" @`DDOsD$(OpF"F41F$4MND#BF8F #ICh( .0F N}A L!D ĕ0FH N}!-G["F FFIH@!8FJF :!8FFFG?H0Fu$ "!F4p:h9I@FkFJ@|AFF5Hx F\i 0 ̠O3M&&OFI,=`E0+A&O BF"IHFCF2F9FHF@iN0+Fi!FIIDkdiij``kaph6naa #ai#sa \! ]#!IFH xp#-H@B =# I < gz ]-OF("FF(F!FvsJ$#sN+`F@`qJ`nJQFHF&Cg8(%30h]#0hv#F0hr0WKZIhg###ZFVI0hXTI $Xf7h"QI8F^78Fv#x:FJI :FGIGz &"EI8F>(78FV3x!?I:F ;I:F :z ڀ' 0 8F 0#K0Ih ##a0h#FZh  Z#Ob89ph909I CFa a ,b/@(@(iH"'R?B8 d(#!FH0"FI N[-H#H#H TF HhH SF Hh H H 8 D+8HYiw7 F"FxB(#F*FI 0FS<( FI@ݿhFT,( FI@ͿhB"F`Bx ("FI 8F F!F HxOb)F FH!FH)FH8@83HqpG@pG8F FhHȀ~(i ahi`aiaia(j bhj((X`bS BB heZheh"fhn`fnfnf(o gho`g88F F`H`hH`h`h`"`lwhd   lm(d  lcdlYd mU(e`mQhemMemI``peQ BC p`"H54S+BE+8#FBT#"A#38 FF88  FFSBB2s2sXX\\dsddsfsZfszsPzs|q|pc@cc6cc,cc"cccXvcbaXSjBBb\ V $P$(J(,Dc,cccccH HLLPPTTXX\\8-OFh FFP``hh`Fh`h` `H`iHaiaia jb`jHbjbj#FbS0 FB0SBBTK\%BF-L53)P#V"G`2)D*3Or5q5p`m|heFmweFmre nn(f`njhfnffFnaf o](g`oYhgoUg"#KE" 8FHF0FDF@F@FD#$%BQ#3H#3\5SE/D# BQ# G#3P54D5DZC#B4%3TU pGc"0B Dѓ"@ @CpGp FmFlF*h KB 9)FOb F&&qfq FF(h `h`h`+[#B+г&tO#ct##D^tL0F mpLABLsF"M#) F3?hF (FOb!(OpF F #L"#r"pA!papB!crpr#rs2F)F3F[#`F F`p[F1 B3+P@pG-OFFFFp# "`XFxFF#Qx[FRFFI2T+ K+#B+#G+ M+S+"k+b+g+# s+t+m+##` # 3# 3# 3#D""`.ISF |#FF@FIFF Fh"*  F)FFEE[FRFIBuKhgE+ZFQFH[FRFI#BAKh[#QFEH#ZF # IE#[FRF , F)F 8Wz(!KhF:^IFHvVKIFHnIH#hL+%%Tp[ZFIH;h$5+% (q0AECAsnE, Du4d4!\!T@=hi;a+F6A7gKOh{h3{`Уi3a+FA ;h3;`Kh+jn~ KbhBFTcmY9QchPB m@&RjnT F0F@FFF FIF O| 1#@F#IF#Oy DI #@FIFPFQC   D@ 3Z;3R+k,BFN FKh+f1h F_ikHD}khD`gk#  Czcj'Dabk1Ick3ccE$Eu0kB3hFFZhBv~n,u E OCBJrD*s 2b204BE @hbn3h  H F pTKFh3A@;h"FHk0`ZF`" FHF(FXZF Oq !ZF@5PFOr!N$KPh'K\BOzsKkCk FOA # "0 #(?=h #aKAl @sR BR"n$:h%Pn #FTP!!DT!T$!kCOA#k"0 F #P$?=h #aYAl@qC CSK  T;hZn $> #FHO{FF[F ;hr36. =I-OF-N|M!xKh+QЪKh/MѩK4hh\C?еO8O O "8##A8F)F@EF%A"O18FO1Fd?)F F^1A"8FA$FK` OQ MF(`(O1 ~K`(}K}O`}K;hCO2(5,%0+O,%x#<#(5#0pKh# 0 5mKhmK)h4jHz +h)fHn dLdJ+h!hhcZcK BaH^ +hYkK B\HT +h2hYkBXHH +hk_ORRH< +hk?O2MH. +hkZkBHH$ FKh#hBSB+hk\# )h k\BؿF\3,h;K\!k@FXE6Keh+AF4H+hm**"$%kn\kQBd`BdoOynCF!e(m@1e!Ye!F)Xm:0IXe!!!! !P!D!X!\!! !!#Lx!! !7B!cFfnOn1f( *F!FyHp ,h1h`k#!FBFcfpK4 FaF#9h)@3 +hI +OdHB ,hORaK'zq\5###ka'd gO3a84bg1hcb<#`kcd#p00XsL5P5gLKO0!\5zs#k bgg,hzsgk~kY:FA Jq8*FAq~9FP0`f)F@Dbco!kO `Fgg `EeD9" G{DbK d DK #BsH KMh*hoHDF42O!TT!P!,hKa"ighogybmkPOIF D@F4-h#C#$4c44+igFkg0FF F F9F>A4BB #0F9FA44oOy # D+O2FKFH!0$E-,A̿'[ D # DCOHAxO 0A(q0AO JAzO KI,*nA*sA@CpA FF"#FF0 SaAK#8FAF(F/ AFF#sDYAF F_kO:rB(( F#BB8Fx:F# K PFYF> #Aq:FXC#H:K;(PFYF4 `HH, +nHH#DExP ?OsHx8FAF#YFFFPF`0 HH,(nCH0!" DE, *nAH$JF!DAH '?N4ho%n@F)A)#il>D`apE?js#0 $%H -bO NOCH* AH#@UlDDsD@0Kh+ opYCcM:@ak# "#IO3"AC(` ' P!h!L!H!T!!,!!P!!^F !+f@!!`!Td!{K!hzKhF*sxO#*svHZ sL00K1"hOZz8F[OW#x9FXDxC;O`y_Khc^I"### hM!h 'hO`9F F9FOPOb"FFObjFKhOPObOb1h@Kh+?Kh?Kh3h0+Or!Wp@+h+6H<+h+(2h3K\@Bj3ф i#iHCFFhRnJq%J!F# K IfCLz0P#0++h+;+h+OC'3hj "`!!!!!!$!d!P!TPpht@ # #$4 0jBH@ &F# Da G HEq \IE  KFE 0" D0[D 40HDyrKED FOq 0 CSCGwBqhHD( Q0!dN 0h66hbKps` `[sa$%*¿:nA3g[Kh+#"#0sgo [BԿgg#"030+ j ;BP1`0s#se03e Be Hm3f$%* Hsf!Hf/Jhfn1!f$1f0:nAHqfrn0B!H% K h j Db *4YhJHBI5smxBp hj:bZhB5smxBp hj;bhpTD!U !NP!@'F] CE@󇀻JH0hJhBnvq n:FKh$5+ ݰK!hn\CTKhi3aKh+T`pnBkhIBTkm[S 2C khPBP55XCm@'pnP FQFF QFBCF> QF6 @ +Z3+R07kDtkk4tJm&hkk3kckpM#D[B%hxhBoHvw9n,!F(0`x08CphAj1Ab0dnDVJhkMi#DBKh:FnKEvq n0$5+HK/Oh;FnGK;@+3c3\CTDl +ݛKh+@- D?e. 3KLI*F0\%B BC"gD i!iJCECU)DAwhZnpGqZ!FyH\DDBuKh+0 j; jKhoHB  #43D4+ ZKh 4$ ZKh YI%YM#)h`#VKh+30304040hKk{CsoII DHNOb0h4hb!`LBKhF!F(h,h0+0hOr!Wp68KzthZ3h:F4O0++h9hZkF],hcbn;hbk)L)K!hhB0+KFhZkB#K*hhPn1Rk`#h!K0hh +h8hYkI |M+?IM!dRTl !N!uP!d!$!!IHF0\"F2IHF0BF8I ."!0F,@FL0E@F!0|aCE9  ҲB3E,VpEc|Wh#0 :h0 "#(##*#*#0U "F6'8F }|d@edA|6|?|P|\|n||zd@|-Am$OcFF!FFVCF"FF@FF(F\9`#3# F m8F F!F HPOb)F FH!FH)FH8@q83Hq pG-OF FFF9F0FBFKFFFO`i#P4\D%O` FEE` #5 D#G XFaF-CFFF F F!F&J/I FO!`#q['L PO 2O0O1  !F F :^FF^: p FFFj2Fc2F\2FU2FNppFF F*F((mepEKAgBBҏBB,  BBҏBB  #Bq  -OFFFF # "`XFxFFQx[FRF7I,S+ G+B+!K+M+k+b+g+m+s+##` ## 3# 3#D""`"ISF #FF@FIFF Fh"*  F)FFEE[FRFIBug[FERFI #BA # IE#[FRF F)F 8WzLIF F4!FH!FH pi(#"!B ЂBЃB AB݃B pG pGKplF(F4.[nX 6J3D.mD0 Fp" FyFFF2B2"h`K-GFv FH!N<:FFtEFO Eҫy1F(F  3C3uD Op1F8F"!CBFJI ,` F IFFhF Kx8B JI""f FIFF h IhF K| B JI"""k5K-CFhM+^Ѱo[0MH#.O~i0DfpC+N FO 7h9F6(K#BFy="KZi$KhSCB1B29F0KIF1@F#ObkFIFhJRٱR R\] 0B @ 2B%1hM P FkFOb)Fn M"""""t!|-OF#MFPFHF uJ uID#+ *Y2C3F( F0F#9F,6O@҉J4 cJ4dIXhRF#F@!CGs\HB4TJWI42OfCT,6&Xh#F@,6D0;00;0(#&BB F;J>IF4 gBF#6G70F9F|,6"@h0FF#BF9FlF$&Ff&I @FIF>#F&FFt$&0F9FLKL0FX "YF0F0pC OѰ#F&IFpf@Fs FO $$ ` S[EB 3Qd"-AF:M, 0FB2 F<Fh3F"F@!(j0FB#!2\xD) FD+ O0F` O\CJI@CT,6&h3F0F>,&;{K,&3hhi;`@D"u-Oð F! FKxQ|AKhkB*FIKhSBЫI KhB;FIoҧIOc*F _O3*FIBFI*FKh. *МI(FLK F(FaDaVO OzFSF#C 6 8a(F,F8F(p9F (FoK̿O O  $@Eq F F wI6ZFOAF0 D)F@lKhF * #0 CBf~f#de#;f#{f M,FP6 #ke#KX0RIhKh-<(F(1I"t!x!" 7 a p! "" "hQNd |! ")Fx#040000lI+DmAJhO KiO8VO  j :#EE8 A k)F@x 6BXI B(FK&ePN V7h}C(F,I *F!%FF; BQ"jcil:>d0(FX 63D6\0D0D,6n (FC,63DZ`,6 ` B,6   0 ,&2DD(0 ;Ӂ5,6DDO3XMUN +h+)#O^N>rF XMKhLKO3 IH3jjhFHZC 6" AN##O3"AF8IX!!6N*3h[.KyBFKF/I .J0;FI1,OhW?Co0XCOPO0+h+ H+h+ jai;J!F#KfAI"0B0$"t!6 "x!"X  "" " Ppht@P#3h++h+;+h+OC F FOO&5F6;B"yiF{hO :j[3! B  3N O1HDO #(F [  0  O #(F K E O    C  ,6OERFS KF@!j!HF F O1  ,6RFO [DXhQK@!&!MH!+F 3 + N  ,6[D&h?KID  !(6E9IO $&E 4K 2  Pfؐ0+M-Kl;cn(F(Aи%Kh+@FD?5. 6fbi#jIH##K.FD0DB0+68 KhH#AF HF &65"hp"!d"RldN"". Kh)@.Ml,F+m@"Hh0FO&jz`Oy H# # D+*inԑJ0FI5#F%D30+bѽh02J1JI'fHFF}JI HF~F xK*F 6wJzI8FúBH% 5pO O 0 &DBV&iJmI{i"3+D0#B#xnFXJ^Ixi9j0(DI#3 D2MJ!&BI#3  5hKF@!6 D?K"vBH% 5HFP1CF:F@!@FD"#!lC.KnA4K"q!!1HoO@ "! (( FDh086kCjj#06h!]$ &GFIH 6GB)!I( IH:I"" k    4 le  u$&ZK@&!YOj62B&!RH6pPIQHXLK@&!N# ""!VlSEKnA#3'4/5Dh0!j;H&#h0#@!$.I/HuO &@$K!*N"#ciQAFKEObZ OgOF PFv&,R(DlaiK8FFQhVIFSF*F D .?ʭC!l|" ""-G}FFFFJF&F(:FfI (dIHFx8(FO7H"F_IHFCF (h+AFZHRkk+`#k`j`j`#k+ackakaa@0+bB0kbclb&MI}0"QFF(Fh*FHI8FyFI8Fy DI8FyBI8Fy@I8Fy.c2F>IHF0\"F2IHF0BF8I 2"!0F0@FP0E@F!0|aCE9  ҲB3E,UtEc|Wh#0 :h0 "#(##*#*#0S "F:'8F }|d@edA|6|?|P|\|n||zd@|-Am$OcFF!FFUCF"FF@FF(F\9`#3# F m8E-TЊhh k: e{RA 8  8eAJ B ڐhKXCKD` DP0pG"-@=B'pG@pGIFH , p-OFO F.F!FZF(FF(O . F1FꈱK1!FJF!0Fh(hBF FHKhD"FIF h+RF I ihhk`7hBF8FOOp#@(  -O FFh3SBF*Fh(`cz%zb) #H4D*F=FH> OX1H6[FRFIFH0 FH* FH"[;D+ݥB H  .G@F3MzG|1~/ !M՘xq\x[x"&H!/!=՘xxq\[x"H! @/-h3SBF"Fh `0+1 0 нFFF HFFH @ p#5Vw"I 0I #sFL1 (h2J@FH"!&(h(h J3F@pHpp#l#{Bxx#x"y#FZ#FIH6]l0A L" F34[*DBK0@@C00" Kn:f*oB² *I+mQeppGphppF%L2+h"D2!K"`. 2;2+ܮ!"2KO2` 232+2 #2 KO2` L H H~˄`pp#(#hpp0F- hIhHhLhHfHdH#^K3B_HvMk]H:{'{*k[S+` MJ({?v3?=[D%%:k{{ ݔk' KIk7E{ 0 =K0{'l)F6H){  {* S+1.-I+I@{(H@jGk[@ G z[{kS+ 0Y@?@@-C6?H#p# ?Rp## !  K3+Կ p# Ki L3 I3@$Bȿ@4p#rFH1%2"DB#D.q2`7 {  ܟ {  KhcC @P?333333?p#-OO -ONIIc=FFZF9F@F 6F(F.(K"1F FOn##.pSo D h  p    c%#!Ě!7N4!ez&F#'FC !OLHB#7BB8FW <8FE8F< +#< +#  Khg'O (IF7DQ FF(#F8#&CCBQ#OIyKhr:FvIvH z D C 2 lIF,C 2 DKEaI \6 "SEF  xCE-?Bبh=9NI 6 FL IIF B(rѝ0+CIDH BIh @IF ~=IF "(R_ r8IF F(D+L-I#h 2H12H5 \0IF 툻 : L)IF  >#IF F LI#h+Hz%`Ht#h3#`I  H} I L ]#pnP!S!e!v!!!#!!! Kxi+ H3#!p~H ,##!KFIFh"Fp IF IHb IH#IHH #!!" ""!#QFJFKFhh\4$@ KhK K J I( FF*F3F IH4 F%#"9hp!"-CF5KF5IFh h3$OO\B +Kh+IF)I*HC/.'Kxi+&Kh+7%Kh{gd!#Jj-2F;F%0F9FFxF F00C0E F2F;F-FC@F%#,"hp##A"I:K hh\4$C PÈ#CÀCy+c F%Kh3#h# yq#q gїBy3#3B(00I1H꣈0+I-Hy3#3B'I#H 0 I =D#hD+ FNEB%4<Or!hF2h4< ["!F0 0hF4C#L%hp%%%H%#K-OFhݰIH>NOaOJ3hFHFL;h$JxFR+3hOaJH;hHB~J5II{H?#wJ{I ".0OawJwH0+xR+hKOaqJpHheKhlHCjJkIeIvcIfHvFcJFFeM#cIF#n0#o0 #l0kh P(#pCOH`hLQIFQH0FNH%(lMHh?!XFHHzOzr#PFYFHT"0D"p;`;aF#\k`X# #k cd#a!# ##X"+lbkhdiCe+idkie3F)I*HJ?'Hc"?#?;ixak]#hp&%%3&D##?&s&&&R&%&p &'%!D%&L#CchpCO%-GF*N*OlhOb (h&(`$Kh+;#I#H9khhB#k` "a1BKhIH PDj`IZ퀱O EE ;h+RF IH F%#p'6'Z'-OFMFFFF8F0#"F8F+FG#"F8F+FG(x;F=J@A0FDAF4hF$~)#)%-GFCMFF 6F("!cj F6`)@FcqZF8F2H0!&(;#DBbb!"F(4)&/.0F9FAF#H@Fr `@Fda"F! q ./!@FX0a `ea q+ja,b0F9FvFHigaaV 0F9Fd H"F0F9F F#)*.*I*%FnK D4D#`#F0+#Icy+ i I F#jI F P"FI FB g0F9F5i0F9F F-iBia I F F hK&FbbZ*m****#pFFFoFI FciB F~+jeaa,b/!0FE hx(F `(F q F !hC # p*pK-OFhFmInHmKh+@̀lI(FFhhKRgIFgHn)FfH&'#`#BB 0F9FoFИ  0!2#F"[F6GO &'#BB90F9FEF-("QF03#D0i 0 i 0 i 0 i $0 i #F"(!P6G+O&yhB ;hS&0i"#F!68#0!8#K<##K##"Kh#F룉[ hKIF H)FH1 FF#hp*#U(p*#%%%+++%K-CFh~I~HD}Oֹ"#!x`8`wH#"#tHÈCÀ"0FFN hK7kIFkHR1FjH@F<( hK#dIFaH>1FbH*!0< FF]H"F)F@F (jhKWIFQH1FUH0"@F(@F.OKxR)r)+MK#BB%АBq?IGHGH EK"AI###AI#AKh b=HX # #(9)Dz`,D<`&('BV?3`0P("(B(S( (DC( S C S C S C S C S C (35#hpY+#s+7V(p++++),#%&,@,%%#[,%pG }'ݼe+KIHmD %,p@pGpGFJah*S BD"S BD KB KmIH  ]H%I%,p KhD`o J3 Im H F]?#%,pKh)+Kh,'K$2IH\ F` 49@ F@KjFIh( hK IFH##p, m#-K Fh3K FFHhhGKh I$*Fpj1?KgmhKT2F;F I Hl F#D%$##%4-p8KLt$FB0+"mIHJKt$#e###Hc`2t4!`8#%i--%-KsFh F3K FFHhhGKhK*F!Fp0KEmHhK"F+F I H p#D%$##%-p8FL h()FP48 F8$KpF`KZhFB KxFVx0IHF Le`p% #p-F+K,MhC|5*Kh )O)N:! F>`8H D#Ep F(!I Fh I H8`hKXJIFrIH8`phKFJIF` 434,F!F H@k%##%pWu?I.d$-CAL#g#8F =IF=H(##C8FF7J8L8I5H.u85KNq5N>x( F"+F0I1H)r/I.H?2#8F#(IFHF4#5h#C8FFJ I(F8"KL0h)#FII0h1hHL3h[I `8%9.hp#.%J...#[.pĦ8.I.%Z.y...Kh(K 4 pG #-O(L$ #F9t44k(ШHKh+ %.FK9W`tKNFh3|5ZhKh+)IH>IH5, EsFIH.#0)K#BB K#EEEIFH HIF|H#0TT |KxR+zK0+.F8>F%59+4tKuIuJuKiHuKuKeItHbcIsH^aHOa `0ԝ 4 + `TIeH@."QI&bH8aI `}93A ]I3F bGH[I `}t6 .BI `0B#93C9&2FKI5Ht3IJHbHI0Hj.Ht Oa `.0 XO)C)9;h3)7I7H+5K0+<3]h09- `=f(q9;BO{q ;hK"J"K#I-ȿF"H*F= `C0+#H+H*t4H#!t4`D0- `= $ #1hp%:R-1pN1%#-OFN7F|5LBFیKx(h#FxZPF|%!Ob939939B%3a )O+% 43xYF(DqKZFxh)D4F)0B ( hKhhIhHl09$-|ݢ,"0B: %D,F :XJh""FWITH,NK4I},SQIQH6QK ***JIMHIILH& mKIEH#HIBHGKhGH@@!x"F( 4+! F .I#"FhR@CXBXA`hJ?4IF*HZ 4$Kh!I.H4C,J9h`0 3 )FHxOb!I(DObxPF#|5939939#% #hpi1#1p1%1112#!232#$jKFhM+@ـiNl"BcKBBИB%_KhFB^Kh]I^HV#+` F(VKh+h h%F ``h}``hy`hu` iq a`im`aiiaiea ^ F  kW c`kS`ckOckKclGdlCd(",& xx||%F%F%F#TH%#hpL2hFhF(?.Nk#BcB$KhFBKhIH|#+` ""$$&z& x t plhdOb! FB`q#`#bq#dq`#0 caa 0#$00&00 # d##Or0~WKa!hWMK+E G #ca #:x3\#+`#ca1iNl#B,"idq#|#fq#bh`q#hbq#"k#k##"##dccc3H/Ka+h;$ & ,Jh*%h*N-*Ift)J*H+ F)I#R&I#H"I oB###oBBBTM=;+?  :IH5IH2 FFI FIF H)H%#hpL2TL%g2# p22#2223IH9-;BIHzI H"h***! FF31B# I-bi=#9``%(F Mp)3<3#-GmXN"XLYKYO5F#e###c`##iB )hK+}JzrxO'MKTT-F2-DH&(=3=#BB0hF0E1H03J=3=#BBѫ+c`0#a0ca0ala##kkc# #kc# #l#d ##ki`#`K## KK#eH&H"+h+?n K-F*IH#= m%%-T#%c3w3333p8%%-M=#zK h+uKiuKBtHsHrHt43`(@΀mNhMt4/F3t4X$0Bvc0CC c `Ki/FOjO E `{F#1!G#,+#O`!B `q#1!G##O`!B@Fq#OaFG#4bC3*#sڀF0B c0 4@F8F(#*s++h+?o"Kh+K!J!I9m H `#!GHh+ FKK"t$x3%F0B5@ =%T33# #%4hpI"KF%%L#h++%-OFM#(eF +k k# #C###+lPppCO` س_𑀳O!г_ O8г@O гON+F"FIHKh#"FIHKh[ FhÈ!FH\Kh#"FI~H# FF0#|I|H00Q0SpKh+"FuIoHtKh F"!FqHR(F@#C F FBF9F F)F FdKhC`CF:FaI Fn1F FiPKh#"F[IPHxZKRKh FH JJq F(hI;"FLIF#C F FBF9F F)F F;Kh+R>ICF>H:F`OFC)Kh#"F9I(H*3K3*Kh FOq F~(XhI"F+IF#C FZ FVBF9F F)F FKhCICF:F` F1F F%F4p#a4hpt44Kݨ4% ##e4#4ɖ5525#OKh#"FNIOHNKh FLKOr@a FFK(p hIlBI"FFBH"l@KhF"?K?Hh[hG>I?H0hSܠ \ 6HYF0hG FF0HFh%-IF!HP#CppBF9Fp)FpKhC`CF:FI F$K1Fpp:O O HF##4hp%##75p#D%$S5#.-A!KKjh+HJEKiFKBEHYDHUDHt4+`(q?J9Nt48O3t4XFF`h %9m5H3o r5c0 B:B@F(9m&H3h+0Dh `DDJP3`#S`#BOBKHmK"t$%%T33#a5s5%5𵩰N3hIHLM 43"`F $ +`F`(`+h+ dhIJIFH8K"O`1:hS|54+D~Kh+@uIxFB.3#|5 4F F(h( (hIlIFgH p KOcFeIfK_H3h:`)aITH`H_O|58F]J;|59;99;9h3`KITHoTH.4OKNk"hPK)F"9#9F:I`P"2D3s93hBKxt+>@KAJs>K=H:(hI@9IF}"b|O+a*iSB3Iph+I1H$HYX/Kh+).IH>-H;h+I)HS(L)H: F7'Kh#"hxCp)#hp5# $h9p#%#5556%#66O6T#@%%%7v666#o066%@%L%HR]pGpK7Fh F( hI+F"F I H KhC+F"FI H0@90# 7p#07hp8FKh"#O`A( hId*F IF H~Kh#*FIHv$ F8#A7p#i7hppF N F#BB F)Ft(Cy+È4E F)Fp%8F F-, F)FY(Cy+È4E5 F)F8KFIF|"pI|㈛IH|I H|㈙I H|Z IH|[ IH||H %!}777777 %pFxh$Fk I; h\A%,F2FIH(F!Fp%7pFM.F:FIHH(hCh;C`+IJhZ`x 0hCh;C`+ (3h ,hZ`x +n, y, %DJpHR Kh{ H(F H(d F@pGp#|7*FFFKhL(%hI&;F2FI*Kh(zhII;F2FH,FH$KhS I3F J- F H I$ F#7 8p98#77hpR8 FF(I(H F&IF$H`i#IF Hi0 IFH j0IFHi0IFH`j0IFHayKJ H)FIhIH F@F H)i8p8x88888%fn8880F% B5i I F#OaH#KJH09 % 99ÈmFI^ FC #FhF|2 h FA ` q FFhFv m+9pFCy+I2 FKhF@(C@bhH*F Ip@F H Kh3*FI Hp@pK9#_9p#p9hp-C/!F D'O/O ?۱/+'p0FdF`0F+Fh0FFC뀄FCy+I#jI F F# CKhF( hH"F I@F H1 Kh3"F I H@'~99#_9p#9hpFCy+I| F# C?KhFH( hHD"F I@F H Kh3"FI H@9#_9p#9hpFCy+I< F# CKhFb( lhH"F I@F H Kh3"FI H@9#:p#,:hp-CFxFF.+F .LAx/)!h,H| ;F2F  h'I%#K%Hhj!h#Hd"J"J"I hJkI hJ/I hJI hJI hJiI h!h x#h[I H#@:e:m:]sRt:{:::::. I:-AF\FF3'F+D+" F( 0 +;#{p&H&pwH)Fs0F::%pmFFhF!0lFE*Oa&)FHOjF (`#xF+K"Z`A+hFVhDB< +#< H!F- O0 mpQ%;FF FF. K!FFhF F$B ^1F(F@%𵅰SM,F`RI rQI hOIPH\`NIH(aKI H#ihF(@K@!h(FH#pBKih?+h Z7 *_+-+9H)F 5Fh2F5H#4K+FF `0F^-D/K&hpOȿOpCcE=o+F&AOq h#"E=!+F h"+F! h+FAOq h(c0` hC%^;7;R;u_;%u;%0ðFFFJOqK" FZ`*F C0~;%Lbh*IH#c`%;~𵉰 FJ!FhF^"iF H O$B *18h( HD(F ;%p FF F J!hF2hF LiFF hf*F1F h`!H\p;%ƛFJP!"H];J)Fð JOq"H}O0C];pG8 FEx--ц2!FF H@hP!FF Hh*F!FFHH8@>>>hp(7((HHpGHpGHpG??>F FKh.F I hC `C!+:FII2F "!(h+h"^p+hp+hD O2 FX` XBXA&0&M?'?.L#hC#`(5(4( (@O'`Oo!?Ӱ`OpC C[cò+ oO3FOC K9H`F5#pSpP` Y p#SpB F0& Kn:f*oB² *I۽mQeppGphp8F"IH8@* < , !Fx4 (" xL[;E#FF3x (> 8@8hp]-AFFA ;H89HO5d7I8F "GF"@ *kex#x#;C3#DF"02 *'V'@,://#xk--"!hF"x!FhF.#J(FP"!hF"x!FhF FFJ.! HJ I FFH7 /цhp[?;&l:p&KFh+x)ЍH@%xKYk HHF!Hx;+2%%%wJwHwIhahi!isHrIhh ࡈoHኡd+   iHiH|hHhHhHhHr" fHn"eHh "cHd"!B`H@7 :g;+_^5201 403OH8G=201 <0 ;:9876543;H j+#8H##ࡈ&H)1H1H)H @ܻ*HIh6'H'Ij/&H#I j(hx@P &h?;U??R?<<?<?????@ @@E@)@L@@ E@@@>=@-OkN$kOFF0h!FE M<`z :FIF+F@F%#"F !"#  TBWIFTI(FF! <(NI5DFFLKhFBKH;h IH0(z44F$O B:0 F4hC-@@C';hy B!0#p!F"hCFh7+h~F*H*K  h{#D0F 1#B#H ) Fx F-FHx 8@0 JDhFHH$$&&@QA &7A[AA,&pAA&e !&FHF*KIFHB A=Ap-GFKFFFJh!`!`I/ hC `/ /lh/ / / h,h h liO ,izHh0FxI#p@F// /@؀rJ1Fh3`F+F ##pNк"Pр"! F> cFF_0_ pFaإW Aإ7BB*  pF3 " p!3 Fp3F"B#pr!F0Fm  O /!0F"F/7K0Fh3A *B U/!F)F=FD/#00FAFh/#KhCfh0FvX0F 0FC0FG@h0/Ѫh!FP0F\X@Fhbpih h2F I OO@F& 0&B0!&M?8FL h()FD4`h8 Cy ˆry**0D@F@6COqJH^HE"&"KFKHK] FCEE(F((IIIHH7!FFFÚ*F0 J #FRL4" Hp 0BB Lp3=@F00I鹆vF !" lF!.!h F( I0(p!hOrHZH0"&"&0EhILh$<  F-Tu!(FGHh  IOrH.6,OcOqJH*,OB ҲOqJH,O! ɲҲOqJ H ɲҲOqJHtH0"&QFNFKFHFKQ"QK#N.',<*Fxp1DYp)D|)݂BsF"Hp"&="&"KsFhFOqH"`X.!HB0AOrHK"!#x3OrIHex-- Fp@1F`hp@ F+FJOqHHp "&"&WFDx,,@_@m#FJOqHH_F"&R-AFF!)F0F*F,F HA+F!FHAF"F!FHAl/-O$FFFF#"F!"#% .BLIFF(FF!(BI5DFF?H.r4FBgңh:`ѸДy EYx[SԔy0B 9Fyh!@ , xN! #;C3#DN!01 ) 0#h J#"! Ch JHFI n; f+X1 mZe "p#D0FO$@iFFWuFp # ]#!"]-OFM'40FFFF,V x-)0(((' 5hO535hO5<D%ME@ |# !J0@F]0+F!J^p ` ? !J@F G 3R3x Y2 o:D.#/< FP" ! F50 + FIFHMG@Mu$F%FFMb W" "5#F*FI0FF"FI0F@0JI(F4?K H JI BMKMRMf K I K K K KF H Kp PNNdNmNwNNpM7:LI%hF(FRKh* KI hhH hb Jh3`0@pG U*&(&N*&8FMjh+ ++*+++-++hKhVhGI8@FH+h KhKFhGIF H,Kh 8(&(&P)&Nh9*&-AF "F1F(F0 I rFZF(F1F(F0 Kh+KAFHZhI&[ B 6 5 H I R FAQN*& uRN?J Fh"Jh3`pGJJhHL)&*& P)&N=K-CFhM:H(=!O0"AFF F #!FOs(F3`Os@+KP0 )F(Kh+B O` JFAF(FOc3`Os+`7Ke FT# j`oD# 3F *B0 LhFIFH,+ IH Kh; Kh#-I H, M*&"OP)&*&GOdOL)&*&h9-AF4KFFh+^1Kh1Jh ,V.JhJ,N9F(F,K"A[,)K)HZh,'H&N3h+ , `9F(FAd0ըFB3h#HY3h+H*F9FH,HA A+ѿL)&*&*&hp uUD)&G@}O?-AFLKFF h+@IKhHJh-EJhR-|DK"!F0FAd[-?K@HZhj-=Hd=K - !F0FA?h+-++>"F1F,<)H8+1F"F  Fa"H& H H"F1F#aHLHH -HAN A+ђL)&*&*&hp uUD)&MOьO@P?-AFQKFFhF! FO,0II F@O2oCDFe##"` FzB "F1F!F0F(K"Ak5%KF%HZh-F"H;h+ - !F0FA,7F%$BH)FH Aپ+L)&D)&*&(&(&P)&O*&hp uUG@P-GFhKMFFh!FOX ,R FF ]J ]I TBF4!OO FWI(FyF1"PF\CFEh"+RFIIx(ѵ?FIRF j  ?IT"0CD"PyFOS#F A01 h8FF0Ѵ@ Q1Kh+L0KhF/KhK#OR0F#!F.#:F1F#F @40h 8F$+hKhK Q#OR10F P0F#"F1FF @40h F M*&Kl]s+P0 [B2F0I 0/#C#C #*F1F'Kh'OB 3F!$J\4## |'KhKh+#)F0FKh1FH$B H!F#H4 d(F#Cc#|PRP(& 9D)&*&*&U?P-GFF/lKh# jHB =#h(@ǀ ("3 SCO3 (#0FF . 9F &3 ("2FD@F0 u(?("" B*FKI ?&F/FO,,S1F(" F('GE(V #7KA#V#KA#V#KA#V#KA#V#KA# 3!+F$J d0#("1F8F (63 ZИE FGKh+Kh9FH#H########(&|PRP9*&*&UP D)&0FF" C -"0 P0+*FI KhKh3#"(FYKhF*K)FHZh#h+ ORt#H0RPD)&*&*& uP0FF "C-"b0 1+"FI KhKh3#" FKh[K]h!F*FF H> + H8 H4 0RPD)&*&*& 8P-GF9JF0h<5Jh*a4Jh*]+;2Kh+3$"FQF8F0,'@FJFFQF8FC0B(F#F)FH(FGVKh+ѹJFIH*;h;+  1FH1FH1F H H1F(&(&H)&D)&P)&*&PQ4Q^QQFF" C-"|0 %+"FI KhKh3#" F Kh!F HdHZRPD)&*&*&UQK"𵋰8pKxBK/!ZppMpFD)F2F DH#$J KFSF4ӱ 4K 4J-CFch/J 0K-CF-L.Kh+v*KBr*Kh#*I*HB'J)I)HmC3H/@#h4+@/FU( - EIFHw fh" 3FQFHFG# 0 0@)JF)F0F0  ztKnKiKh#nKh+[mKh+@VdIkH<#l?#/L&"F)F0Fk_K2h*@6 0VI#3F@MHG$JKh#OKh+NKh+@EINHhck O  F0oF%0FFCFYF0F`0@8F dO h +8F-K 5'F`ckBπ000  r$)F0F$"BFx7`()F0F0##t()F0F0##e(&*&P)&URR(&(&H)&R*&R OcO BF)F0F0h +,F(LF)F0F0GF UGF#:F FFIGE<8F8'()F0FO@0CF(:I F #F06K4J6IhR'F)F0F~0 *H;F!F- F"(J#ST#JST?#h0O bk KE?k`"9F 8YE% hBЋh;C 3D( KhBъh*O: F F(  1X  MP)& S(&K-OF=!FF&`|FBixB@:=#<"I F(@a+z=+Й8 B@Y' 'K/Dh~Hm%`"!B20")F*oC*,!8F"#-P#(l O;.FFpJ=!PFFC#pbIPF(\\,! F8#pF3XIPF(2ѸTK9FRJTHFQKh+@o*,bBF F,B"F9FFHx+Nh+o[_[m[[[[[\8FKhIFF "F)F RCF)F H$(*FFH` 8,&]\0\mFFOahFH. "FI hF mlpmFFFOa&H(H)F~ .iF&(Z)FH)FHLch hK&h | JS`#h  2F& ( mplO\t\,&mFFOahFH( H!F4 Kh  hiF ( ml,&-Gm$OcFh!FFJCFO QI0F0TB%FO  B)FF(@CIF0  5E)OaU?V:IXF6-?NϱIFPFPKF"FOF0H.#F.I&F-H$PFH"FOF'H#F%I&F!H4S @wB(!FH& E? PF  2Wl\\,&\H]]$]5]|lB]H]u]p\]]-O F-"F dܛH O`hC I*F PڒI EE*FAFH<, ,,OcKNOKNOCKN+;\KF#NK+#C0FR * /FDFO 48Fg>E8FtKQFsJsKtHtKtK(O \O FOF8+U<B@*  U LUl'DD+ +@j"F #2F#+JO^監` NA!*FQFOH`F Y #AQlY #AQFpb {U<"FF?H'{{H# #2Kb! NC#@05I" "!(J[CSr.0Ф" " J![CSb0*FQF!H~ {U<H'{{peLY@^Q __^^^&ӚRg_F_p_M_y____]__ +I[FOZ 4+OK+Oy# &L %ZFJC#!0?nOI#zpCS!0?`HOI!xAQ"F+F "F+FJA!FXF2FFHA*+q[FOZ 4++7ЀLk& %zCS!d0?# OK"p!JC#V0? !pZFOK"[CSD0?kHOK  OyFFJA!KF2iBFKFAQFx(ZFBFYKFAQFOK )F#FRHx@[F4+zB+FAL P kO %zCS!HF0?0OK"[!CS0F0? 0ZF!OK"8F[CS0?~ {QF&J'H'{{- {FOyBFH\KFDQ'{{BFYKFAQOK iBFKFAQxJQFH  Y@R___`W`]`w`lIFH `p-OF)MFF+hFc!(FDFh`(#H FP@`=-0ۺ@IF0D  ;` D0IF0D P ;` D@= ,&0F )7*((9*@pCO6гO@jF!*h* e!JOa(F|K(Fh/K0h+)FHZK Fh0!FHP  jF!*TF(* HjF!*G( 0`,& `l`8FL!h)(F`4K*FIhKO2`8h2x#ahHah H( "!h Hh J` J`88H&;b&(b3bP&a&a& KhSK"IhC!H؟&&H,& K$` Kh FKhK" `!H\&П&X&@&S&-AFm FFF+O#FBF+I8h8h Ob&H {#N( $K$$I`+F0h*!J0h320n+ ?+ a+%K$*FI`p+ q+K$*FI` K"1hH`h 0h F+F*FI8h m&\bpz&mbtD&}ba&bbNbKhKhz pGa&D&K-AhF Khs M! L#/h&h+`!`/`&`#0z&؟&a&D&-A FZI&"@>\erE ЅT5h27P&$TDMNF/*/h27p9B7h7 "pCJ%\I 5d<F@8o" p/JB ѕBي\^p3CE3F2*9F"p"+J#FB#3 +рK"F!xx}$-\-"]xB"3_x0/ٓvEЧ1.DV$|Fl,7F$|oE5DEH,3B#A$RH:FbED3])J\)ЖF)[)Qx/h7p.0)bFgQut_&&(&&19Q$|Ql|>QH9FaE D32x+Fp3x2x-?ή3>])#KHh^ F&|cp(MJ$N4+S<+I0hJ KHh:O2 K J Ih" K`pHhp@Hd&uP&c&(F$N3hB&KMh/h C+`Kh"hB3"FI ,Jx!Yh HYh H(/`4`a&a&a&Hc&(b3b0uKO2`H@&c0cKO2`H@v&R0QKO2`H@d&c(L=KJIhO3#`&&`&c(L#KJIhO3#`&&a&d(L KJIhO3#`&&y&'dp(m#$$Kh`+++J i((J a(+Xh dF !KO2`7hh,Fxa+KJhK.FFNDKJhh3##F"""YhBFћh##0F)FN(F> mp\dgd&8`&WdMdRd<&&-GHM(hO2tK(sJ (pK pI$`!FnH0mKhC$lNlO^hrdMgNiO"FF(Q#x 3h#+`+h+!FhI(]K!F]Jh;hhqZKZIFhZK(FFB!F WK#h[ )h)RKh+OK"h`h+h3+`IK`3hK=h-V9Khs4B 3K"` HMS$h(3K*F `)Mh.KQ$h.K.IFh.K(FFS$B *K#h[ r)h)%Kh+"K"`h+h3+`K,"! "O aP$;HYYHv&sdz& ",&П&X&e&<&&&8`&MdWda&؟&d ȀȐ-MU)I3h+F0+hf( K" Hh0UKIFhK(FFUB K#h[ )Kh+K"`h1 030K&8`&WdMda&؟&z&<&-G(mF#F%%Kh`;MKO2$`++HJ ](EJ U(+h VF(mN>J#BF,c,a,PY&,4KO2`Sp/2HF(x0K*F-M(FF0|#z)FF;&I(F젱+x|+(FDF KO2`FH(%FF$#BF)F0FKOt FG,#NO M7o`&&ggg~&gWugg-AS.(+MJ(JJ(C;R#!B#AI@옱x|+ ;KO2`i9H;($7Ih&6K6I` C!F3Ht $/M1N2O$h+;B43h+1#(K(H,;FR$ pF)h!4+h+Kh+K"`h+h3+`K  K"`Bld\dWu&ggz& ",&X&Ng؟&a&~pFm06KO2`^0K3Hhz-K0Hh!/H:(.I F [z{)Khd!K(Hh F1F #L$I F Fi!DD F  " FhhAO8hGKhK"`J` 1F pki&i&iiS&E"X&j z&@&JKK`&&j&JKK`&3j&FFN(I0F(츱CF /K6Hh5K`Q0Z x[ -;h$H AhE3`"0,*3`3 a'#<,Fkh;k`+H (0#hZ"`x +kh;k`+H ( KHh^O2K`#hZ"`x +a&&k&la&1lH`&i&pml&ly&N O3%((J[(!Xh6KF? FE IZh Kh~,u##3`p&gdl&L O3-((JiF(!Xhb1?Kh^h I2FF(F<#*s###`p&gd&l0WKO2`(H@^IhH@X&llO2K FG@HchhIh@&l-A((#JiF(XhF O302HF(xK*FM(FF0F D F"F)FF"FI8F"F1F8F8Ft:8F#00F\dgd&-G0*KO2`K((&JE($H|F(x"K*FL FF0|#r!FNLF;b7h# !#`)F0#HKRh?(F:F#&&gdgx&a&dd$&(F FOQO31hI0FhI0F8I0F($$hhlCN(*hI0hJKI`h`0hh#;`&m mm&m&&7m-AFFFF8K:FIAhW@h#c`0F8 JhF``B=H"hIhA@&bma&xm FJO1F`8(LNO(@T#c`h=(F!F(Fh.#`8h;`+ڊiBò + hZ `ppG(:x+7OFx%*,CxS=h\5`$Մx5PW"7"0"kOҲW%7%0%0[ p0 p1 puKsFh FF(< 9OR)F0Fl ` .#h+H"h*ݫ< ;۲+ {:"`THx *3 p &o-GFFF F lI 2"jI&`P# "gI0F(#`##*"bI0F#` (h `hh``hh`+5F#` 2FIFTH^@F FO0+x /!(F (FF@G8F:F)FFDh+3`@!PFh%+8K"`[:!F([:!PFF5#p0 "(F+x;x#BOsB3FJF)FH h++CKKh(FW``h-}hK(FXJ`r Mp>pFpMpUp&epy& &R-OL "I$O3F D@*(@ I(F0 x x#)FH~(Jx+G;!dF(A|Iꐱ{I FꀱyI F xH`$*F!FuHO O ##p(F#@! @K jK` :! (#;O  O x+ı#x/! FB *WI4  8#%FpDF%FF+ FLKh++M/xGHI(FD'/Fd&x^BI F8&&7F&F=J8KhFF!F hObF@F  #    "0 00K"K "H*F@+ .(йй  L HFYKFJI 5%gFpspppppp&e&pX&rFp`&qa&/@+ /!(FF# ;(FO ++xObII@FB # 0 0s+x+Ǯ?Kh=I=HMF,]#x+ZЗOb)FOb3I@!FOb:Ob-I@F-MWO (KhF`*hOb%I%IOb@F &`Kh3/! FDF# +h   KhpMpQpFpven-O]F SFF%1FPȹ !0F(0 "<xFJ3h20[@((8F]F/F&FF(@~*I "K(q$ex+}I(P{I(x*+0! "(qx-+0 "v(q#Bqx/*XZx**3 "X(qx+WK#CVHUIzб,"F!F.(?lO3x+e^FIZ FTBIPAIK?H F>IB !FhK#*sLBA!h# !h h?`й?   h&&0 FFP0YOFm0X@<#D  G G $Ma&a&&&&a&@`&[&vZ&w N4h< HKO2`-O I#;` F0h1hH*0hKI"`@ ;hF+--k )F  F@pG GD&ky&[&v @`&i-OlMFF"!H$"!H "! # KIF8F x  렱 (h>2FJF9F|H.{KO2`OrYi9FwH(uKtJFF`,ƀ # %@C!iiP@BjI *FgI0F0Ki3cH3FcIhh!`h2F]H^0i"i#i[ #(F((Fi"iiPF#i$002FYF(F3`TB JF9FCH&:J`S3h00+ #"!F#(F8I(F7L7I8N `(F#h0`x4H h0h#KO2`#-Kh3#K +Ihr ($"Oq(FOrOq(F(Ft JF9FHJ KO2`X F lM[&U&&y&.&z&rF&sty?I,&D&ya&y2t-OMO#MFKh8kL%#h;(FhI gI K !.(Q/!lFh+h +YHYKO2`FWI(<x|+7 ##pBNHNH! /##p(KKhsh + Oq(DHBKhszh + =Kh+( a:Kh+( 4Kh2KhB !K@&KhB!{3!H~(@ +HY!K#RH/(@̟&@&h&H&d&[&П&a&&K}t}&Z&@`&Asd|&Wu7P&}a&a&x&7}xsH(@zH@ +QHK+(I8KKK`K`)x|+! I 0jH1KK`K`K #}H|K C؉B0 pCOlJ#`kJ`pKh*oK@2AoJoHoKB fKiLh}O0dKhmWKh3bK#*s`Kh%_Kh+Lb;+^ ZK#RGȉ!(qf JJF ؉LىIKh6&(h +AKO0O1>H:(@ 8N5L#C#"#($&' hY`x (G FFOF#G BwSh;S`+BH\#"#^(|?IlWuhp&[&hЗTJ &ua}?&$&H&̟&a&x&ğ&h&}s#BA9h# 8hB#!hRCs#-#2C# Sh;S`+- 8F , [ oD` Sh;S`+( "AF ,ЈO3,+ ,уL hY`x FE#2C# hY`xwI#Bq pK h) ZkK# hh +hKO0O1eH&[aH $ # G# 0 ;TK#*s fNLRI h!hQH )XCMKh#R JKBJ!|1??!###N0/3Kh*F7IF FH !5H~p4KO2`)K#*s U -I ,Kh+? 3 3  !L h(.O3#`  ; + G K !` K`KC&̟&h&}5v~;~[& e~Z&&Is@`&&&pGKHh&~881KO2`8M"(hFP H&KO2 `8@ ,8&,&~FvIFF F))F"h;`+ڊiBò +ݺ hZ `ppG8K$!F'FhݱFFE2FFB1FF!3)Կ8FO0-GFhF6I0F~F ,d^,А7.K.J/LhF.K)F-K.IFhT `+h<+F0F|40F!0F0XPFCF ISF2F<,SF2FIo h "PFh8FAGCh "IhoП&ɀ&рm=L=M#h.hx!*$*:Jh1)!`8J` !`Z"`x5K!( FFFF2x ) ));*Jh)!`2F !`%J`  ) 3 x )")\)Yx3Y3 { F{"/ F8!2 2FF*`#`h Kh*"`"`K`0F0&[&H&&JKp`JKL`"K"``KhF`hFF(h#h3#`p z&0&&[&&H&&8FHL h()Fv488 F8 L#hK H I 0 `#hOaHhK*FHF&*<F&6L4S H I \04OaHhK*FHF&n\J&R-CAL0k!h(xF;I h h#OR7I7H0(S /Kh#*K ht!h+H+O4;h+)N3hhhCF!h%H !h$HCz;#Kh#!h"H!K ")h@F` "F3h8hh2hhhGKh++z!h hKBI I & z&p؟&~&&iiX&jD&4&])qFI "FI @hك-O!-FdM˰#ha0t#A1s:Uk{DTKyA 8۵@FIF.A {Q JFFFFOFCJBKF?K&'?JOq h;J{EF YFBYFF@Fr.K.J DFKF-JFqDOaa@F'OaaF@FVF q DKF JDhJA q D{{j&vd.d&3F(_KhZK/'-?Dh?/d!]VJqUJUJF?  DD#'PH!Bq /Ж O.FV7sF2F'/'FN# DJV'Lq#DwDhah0t#A1s:k{Kg.wA 8۵0F9FA {Q FF&'!J!#Bs?)=а @P1/FFY@.AN&h& &i&&&%I&lH&L&R@a$ax& @22@u*S!0OCs dH2C3O1C C2COd ( F Fs@0OKA .BRw@2O_A CS)FLJpF KK#*sDnHIug.w-۵(Bs"ۺ{hZ`x B&HO0p$M pc`nCh;C`+C!hZ`x + (,(\(`nCh;C`+xBhZ`x B#+p#x+? L h8I`hp4 pN&N&-OFOFFF;x+2ЛI8FRL`fHdh+&9FH!@+.!#1l(+0K(F# Kh+ـ`n ( ((+JC (xI0FT(=yKtIh8FL53.!8FrFx>XkK8F*FFP[].!0F\F(((_O0F*F9F8({]3G(@ ((8(S K(HHEI(ЄEIꐱcnEX(=HZ=H!AS(0+0HcnB4( ,H6,H42bG.(0+H@E (`nCh;C`+ (hZ`x (KHh IHh0 `nO0Kh*$ KHhe&?IN&+RП&z&f;d&Dža&k#LOZCLIk 5U`nBh:B`*ABh x h2@ BF#+p (`nCh;C`+BhY`xٹ-K`*J#"+IhB/FA`nCh;C`+C#K$Hh4K%J0K#i3`hZ`x (KFJh, B30 0?30p  K Hh:mH`&ui&y&&a&2KhF;CI FHK"Z`320["I FK"`I F| K"`I FtK"a I FjK"ZauU`&nZfh;`+ڊiBò +; hZ `ppG?K@Mh.hO3+`=H(Lў;II=H령/ѼsFF/уB3*<ٳyB..1 ьB`.UB~٢.TBx4T%Bxf/ B(Ul *O< ݁Bf9&B.T_+ 4TB[402*TBY>"*U4F;)x/*CЄBK4+03'K'Jh+F$K;)x/bm..*(ЄB04+0KhK;)x/B4+{B.U4 zBc%!B)U 4T 4FFFF#+U&a&Rz&Wua&X& pGFFFF1F8FFV4 J"`,J"`oO0#`8FC\ *"FT!>BNsh;s`+Hx ( \K#`3hZ2`x +0竉o#` ##`p-CF MFFL(Fr@sBF!hH JFI h #UqH&RCm)DBKI h 0F,JK8hhhhB;`   z&&ʼnp&&-Od FFFF &u #QF@CHFP@BI2F~I(F}Kh.3Й 3FYhBi+F2i Fi CF # bh#@C1iit0@BgI ` a`dH"! FGF+F^I7F^H@! FF0*FWH#0UKhF* !#RCs#IFRF FhAFIh$+ gO 8hA+l*F>HO7d!8F# ht 2pOzqPD r!BPh+0+O22F! F CF+FIHj%'#2<#0"OqA FJ0+ #`8F d rF<&B &2th8F FM)F F8@F< "FI JwI > F,0"FI 0NJI I -A#FF0F FKh>#H4#HG(F(ڋKO2`NOFP3h*F#I8h*I8h$$P"CTMHB }HKIhwKO2` yKhBF(F> D FN"FF"FpI0F$"F)F0FiH%(FNfH\F FO F!F Fv^H F(F!F(Fh,*VH8F F+ F!F FR x#MH$KKHF F!F F>-,!BH(?K`?KhT>KO2>O&`B"+FF M0 + K#`#ob ##`𽎉pG!z!Hzp&K!Z0K<13H1hGpGp&Kðh#Kh+Kh,~ L !FH!F DHz! <! 8zHwJ1 wHwI !<hGrKrLh!h)(F4 FhKA,lFx@+-hN#hx# h#hx;#hx,+#h3#`#hx##hZ"`"pVM1h1[hG(3 F+~RMSI(hFx)hPHPH FNK!FFhvLMBO"FOq0F.(nF3h)Fx3h33`x + F>HV3hZ2`"p(8N1Fxd3x + F1H7x[x,+x +3x#Z"pNJ1h[hG F3 K1hGJK(FFHC&&`&p&@&t&h&?IU x&e' K! `d& IK"`i&e!KH`z&x& Kn:f*oB² *ImQeppGphp-OL" F)F hKl!F"O&FO")F hH@F;h{PFF H>"Imx&&Tx&&H! ! CF1ИzzBH! |! xF r!F nK/!LA FA!F" F I H IIHI kqp vK"sLXhI1N[P+x;(F)FFph"IphK" h0n+Hp&0|&H&P" HiFk0 Kh K\AlF FF(!FHH<&sF K!ht F^!FHH. & K|Al#x[ FK!FFh  x& K7FLA/! F,A!F#J F+FP0F pFx; +SF + `F+FKt , ,њB10 p3x*pB-OFFF$[$`@FIFM2F;F@FIFC$ 2F;F4,FFQFH$4ӣDR 9,**) Hs##h HOlnjq-GmFcL)FcMF haK"aI`"aKXh^`K"`Ih|"  h # 0"  hl*h 0*""@ +RJ! QHz,PI HLOF FF#h" @0+ 0O2"@"h 0*(d<2Fp(ѝ 0+ + +p 0K<1+.HAFl+J[ERFE&H##`"FBHK<1C HaJ! .K" IXh)F L mx&&&&&l&&x&ЌԌ&|&0ŰOr*H(Lr&H*$Hb>*Or!HsFM ! F*I Kk)F z(݄B!F* >/ H$ FE0  -NK-OFO"FFXhIOI J!@Fz~K"~Ih"鼱<yKl!xK*"hhk pLOFO O kh;k`+(F,+hZ*`x;h+kCi(Ѵ1(ò (1ѓ ( c,1K  bY + ѹ<1[KHAF1+l1+(# 0"=K"h *\8h  *OOBс~ +)K1 F(FF K(13#Hg#Hg[K" IXhJ! H&d&Y&&l&x&Ќ\|&&s&&ðOr9HF(j7K"7IXh! v! r2J!(FD0K"0Ih|-H&'' (FFFzF(݄B$K!h !F B!F >H FnK<1C ^HaK"IXhJ! ! ! C&&&l& x&|&&ðOr;H\F(n9K"9IXhH! ! 4J!(F2K"2IhX/H&'+ (FFFz( ݄B&M!F(h!(h !F !F H FK<1C Ha*K"IXhJ! \! ! |C&&&l& x&|&&0LF h(I(F>J0CchCc#ch#c`! hJ!  0x&&0 LF h I(FC3#3! h 0x&0Or9HiFv(k7LhFDcy#cq3K"3IXhX1.M #10#00%J#01 1J #11 HHd1J#1!K`1J# 12 J #2 2 HHjA0&˿&"LI h  h"I@yx&{t zt F, !@8F F 0)F(( 880MGI8(CH\{Oa@J`F=KLA`<>K[h+8:O93%1O5.F,$*F(O4%GJ5Nhи  BIAIS"PFd@+J`*K 2K%I"%K2``p4I `2I \0I X.I T;h,J !,Ht+H*IP0)IL!(Hl\,L,4HHGHE&t&&8&p0&&d&@(7Y]Ӓ&{&iY` ~&hp!H/k K-O ! R JRh "!! "l"K"!:"FI69K"!:"BI6AK"p:"@I6/K" "Bp|&&N&J 0[ `pG-H!M ! VLVI VNSI ORKFhF" "h" O2!hF&(ݽ0"FI(CKxS+ W+B+FY0+cOb h O@ Lh+N ,Kh+ O1!FKEx @+:F 1 M+hk :F!0" ^+|E)h h;`+ڊiB ( hZ `p@Fmx&&l&&&8FL hX)F@h)F48 F8CABAj@  F F@y! H'y;+2%1 111,h&)F0FHP0FB(F` H@n#y#P#qhB` +x !;#+x"{B`cyCcq Kn:f*oB² *ImQeppGphppF1L#h;!+.h0FL#hD+y `;+ED%DDD-#h"+"` 0#0 `! )h(1FH"h#hN3#`0h `1FH1FHh#hN3#``6F3h)FD0` H#h"+K"Hp@`ϾpL&lIFpDx+2ЋB/\+^+'Ex-@= Ex0޲.Kx0=.x0=,3xB[xpp2 F F$pB Fp'F7Ih6L#hK!`y F=41L#h+S=! FFH#p FF(?y5[(FF8F.4F ! FF(6I Fh(F&F)F?! Fpp FoF!@yh(F#x!+ ` F]!F!F H8H##`oL&29Ipm<  <D  <4BT<hD<LOaJhF\1BIhFFرN*F@1hF뀱3hiFH !hF#phF@(F4u0#u0 mpP?I&ZpF FFy[(FDF I0F(FzF)F F p p2s$M.F<3"I(h $I(hLR"I0hD"I0h@(*I(h(""0!H눹O!H(K! H( Hj F px&?f@xt yt P&Cp"I$ j K,3CLxF( Z *Kj\K" h FR@5F@&B;B+! 0pUP&x&HH!,0@xfP&"%L&I h x"#I h! hi;@ j! hi"I hRH{0(3(HH PI hx"I h8 D! hh"I hf hx&xt yt f@ޗ0F(y>K<1=HF"F o =F1?"8F .K?1H )(-H&'"F+Fg(HnbE[O2g*sO!Bq[O2O6V O`1FPC'zsK#!J DDI, ,." H, H(tКךhpKp[h{ (HK #S$$.F)F"F A$DZ H+ H! J! 2F,*pp&qwݚFF+ * *pG#\Ա\.FRa/٥A/ #A- 4B3O0FKOMO`,h,`^kh# Kh o  0 F&&&F(H } BFh!D!FhJh3`pG&FH(xNuh5!FhhNȱ-h ! F Fh` F:!0"F I`shu`+`h IhFh!FhFhbhFp&RF@Kh# F@O0&8F F@Kh+)F F8@8&pFFF(`+` 0F ` H `#h K#`pփRFp(xX08 Kh# F@&KhKJ!hJ!i &&q-C FxF#x1K!FYa@F N' M J1h/`NJ F1h/`N+hKE F&&-AF]NiB[K"|`(Hic #ahJn(A2(:K(:(MFKJ(7؆(E"A(2а>":_2ذo*ذo1 "-o#а_) "%OذO "aOа?""""" " " " " """ K K` K`K `#s#xC#$0#%0"00  ĕ!a &&?(&&4&&7 jFIXL00P#` %HHx( `#hL+޿K"` %` H Ha( `#h+޿KP"`0ht@&$&*s 7($LL,(!(;H((4H( ((*H (((# #L0#M0H.HHHHH8#ML0(F 0&-C HeLI#`BFN(H#`#`9M HKNF`HK`H(`H0`HK`HK)F(`}H"`|Jh+`{J`{J`{J`{J`{J`{J`¿"zK`zK+`xxKp)FxHwOtZKtt)FtHxUKxtqKh+pKhc)FoH|)F|mHv#|44|4FK|t4CKt)FbH^ ax#'aca)F]HS3h`+x#`ca)FXHFx##caTK4)FSH8RKxt""'N`MICbKH24bGIHH4C#4bBIBH4C4b:I&W&q&&&& &(&&&&?(R%x&&NE y&F/AփP(_c)FCHx(x+)F>Hm>N(F7Fx{".hFNF0Fg.h0FX00D(`1F2J8F0N)F/HH(FFx*K!.hh:NfF0Fg.h0F200D(`"O1FHF:F)FH"Kt)FHN)F(F7FH0(F1Ft2F8F_4xK"`  Rl&IE&ql&L4 Kh3 K JxhM Kh3KJhM#4&&&q&K!J&qKJhK&q&K!J&qK!J&q8Kh;KJhK|MKh;KJhKtMKhK M$+hB 4eK"$8&&q&&&pGFK!NnJ!@M&qKx#KJh>pG&&qKh+ !p&KJhK"&q&K!Ji&qL4J!M64YK!JM,4 K! JM 4K!JM#4&qBKhCCH@ `pG8LFJ!M J!Mj J!M+J!MT8&q Kh KD@Ǻ{ F@&&FK4X@0c F@&FF#XBXAK!JZ&q-AFFFFR PBK?<!!H;(!FH3BаB (!H'!FH$=-$XX%GCІB5B5^,AO2"H!A-GuYKhb``3BpGl&8CFL#h3!H%`8[-GAp L!#hFc#KA*sKAR hBF_$%O Bu!hB#BBъi1 ! h!YHO 4El&pKhJhr$ KhpG cpGO0O1pG !pGl&8&М-ON5h-L,hgB#BB04iB#D? ; i\E#EE0$%iBPBhUE1?.ЊL"h$ՇJRh* BB  (I $O32 $ O2#kh`ih```i`alhhh`h`"Fai `i`a,$(4RBB[i K ?K?ЂE{c#EE 4@O RF[F81?IFLH}FKhcEKhJi"DwO2`3h4"D=I\wR1nF_(AF5HaFI3Khc2Kh(۹СiJF!D1%Kh`# Cs#iKDa[$Kah+O=,A H Kh+>KhK #BBK#BB$K"`O0Rl&&Ԝ&8&l&&@&H&P&%Kh+3hhB"hahQ`ah `hh hT`h``h`i`y`i`a04iBD ?  `O R-& Khk($,D04PaAAAO0O1l&8L#hO08-C#hAq0$B2 bE4EE"0$8l&L#h+$KYhI h4O3#`"K`hbg7? H"Z` M0+hl&&&-OF-N F7h/<,u K?РBq4` @@icMEDE?3irEYEPEВhcAr@0D DEu  O3hc#BAO0;hl&&p !KhhBFEBu3F6hBEa E0p pl&Kh 4d\J?L@Y0#h l&&K-h0$ :)l(q'$6?A72iBOEFEФh0ArA10$O0pGl&(KO2 P0@(X`pG"Z`pG7.JhF+T$cO0O1GhO0O1B$hd"#)h`#`##04cET O4O5E4#4$"#z1?!FH0@ҽ0l&#"#`@0 ]KhbcpGl&-AF&MF&L(hgF `Oa "#a@`` d#a `#a0dO3O24O3# 8F0"h4#4!h(h.#h$2tA3&l&KphF-34 $(hBBhhZ`Bh`$ DS4 0h$O34pK!F`Kp@hpl&&KhpGl&pFFFKh;B? ;^+#x*+cxcxSn!n! FL(,F,F#x*+bx Kk* d* " s*u*""""4`4`pt&:0$Bs[mhB\Q3 BZ 0 0J!8v F '?S9+0+.+ b+ c+! 0;4F!H!!FB H! D-$FKBx&x&pFF(x(M)h9 F\lh5M)hi FR8hkh k`p 5>H1FH pFp\p 8I38H!(W5H xqN3 r!(F-H}F,HxFh*HsF@)K$%&h'Kp&I F8x%I F4P#I F.("I F*(!H}(2opLppB!HgH6JIH/JIp@R$-ux&28>CHOZx&cq|&KSypGt&òJ+hH yJ+Ipf+ ؃@D$y J F !p! !HHt&R{&++++(  pG pG pG pG pG pGFx+$F( (* O1۲Bc cx@* +*B  FxF8( (;FHx?@Hx?Bx?CHxx?B2x?C)Hxx?BBy?Cx?B2HxKy??BbxCx??BCC2 y?B4Khh )k`)poO?jc?`+pI?O2ib`*p6ODid`,p#oOgig`/pqa)p?hgM`ph?dM` ph?bL` ph?cQ`phfZ`pt&KpFhh`)ݔB( x4%B# <)#F x&B F4FBF ;)FFF ,`pt&IH2Bӈ"q0 pGI6B@a! pGJh RypGt&(8F4I5Hfja(3M+yՀ@ !yY۲-JF!pI F(#F! !#H,,ٴoӴ?ӴӴo4## #Ot####+OI,с,A"@q:@ p;? bZT,1C,AH8{&t&I3B"jq pG,J#XBdhB3 +  *-AFFFF5WF0F'#+`0F-F88F(` `O1J1F( l# =0F(##+` ##`8F&FFO1JFh$h3F*F F&7L%F(8HBiF`+2s88 8D80&((H2HHpG&rFsH FxI %I F( Fp@HF(x+|! (F K J)F3FF FpWud8FH Fd (#h"Bh h[h2h*I(F$h8sFhF F2!"(F*h#3FF FpFLO8MxRhF(D:hB 8Y(D8,F8xjhF+8@8B&$&𵇰)L8BKB+K DB$O& (FD(;hsc ګB"DX 8(F|888+2= &$&%LN 8#D(3hscx4D,+x* 8Hy F/p&$&7 L8x*6hF(DKhBF;B8[x+(F(M8D8q8xchF+d8 0&$&pLXB p8\[- KO2 N`8Bx+(Fp&00K8x &8 L#x% X8O2pK`8 8&00pFL F F@sBB"Fu pHYB  CB;;KO2`[0 p&00sFpEM& xx2F!(F. F F(6 Fp K"8p( (( (O2K`pG&00K"(( (O2K`pG&00-CF*O L/+x:F!FB 0C838830F1FHF0F((##D((D8F&t&s L% FFMDx3"F!0F5(Fp&K$`pG&pF xFDhBhp! 4F0F>kh%`c`kh``l`#h`pL$0!F$8"a&K-OFhL(&A ɹ*ON08(X 8-++(F }+08Z#DB0((o("X +'d# 8$ h# 8x7#1F8(Hh(B.@?$8+IB !!!(F (F}.(O^((@48 ~(4(@48%t(k.( (@48 8( (Obݨ(((Pe(48B488x+ +z8x +@Ձq488B@ˁ< + < +8Bط#488x+K4848(F򚁟#'48488B@< +8B@< +@f< +|^8Bt48488x +8x +@cs8xYi#8Q$I48K`h*(R`H -FE RFHAF(K`F2HAFeH8x+t&&4000R48N-@8(K"8(8xFhBuK8x{BFCٙ  *lKO ~[~ 2[FFE-ٻ#Ѻ B RF@FF O D ## B * O #NFγ@И0:  !@F.0+ye-FđiKh+me-@cht+b+++ ?/+7+ +P60 +@9..6!0F/d(@(RH#c`50#03@_. !..у@+.-.#* ##* ##`h+| .J .H0{4KhB?2KhB?1KhB@0F(?xa;+##0(x(yi#a+ 8(3i3b A HCK"`@&&&&&&&D&&&&T&&KhBoKhBkKhBg0+c0FcH0F[ A Hmh#@+ Цah)Ji!!ZM(O#FF/ (,.W. .."!.L.E*.@.Khùch7+@> Khch7+@9ch7+@7 . .0F(? ch#;+|(@chk0F(?n(? ` 0 #A=F-ׄc+R#y==c>?<BD@B>;=<3>??>]Cq@A>DgAi?> CBE?==_?@< =DDCBk@=DkD??@'@wBDD%>?GBAA?)>DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD6#"I e%&&&R&&#*sK`#*sjKDKh Q"!#*sK`#*sJK$"!X#*sK !Kh+ #*s۔K "FS#*sK! "F)#*sK !Kh+0#*s*}K $#*sxK! "! iD#*snKlKh+ "! i  {F@#*s:`^Kh+ 8h"F e%(#*s:`8h"Fa`J8r#*sDK !b+#>I*s#"##c#7Ie*s#d"##cCk i<(qQ.#*s#K !#Kh A H& =zKh3+?֫xԻ"l K`(?d###`#*sK !&&&l&l&h&B#`#hCs#`#*sK !!i q&%h%CC %h%CCCs#`#*sI"##!i E%`h~KHh`"d0+@J IhKh+@}IҮ|Kh{IRFyHmyKh)FxHNxJ#xI hDtK!h}!m!oHL#*s]K ! i(?p8 # _H*_Js_KFA="![H#*sEK ! i(?e?K QH#*LJsLKFA=#*s5K ! i FDH#*s,K ! iF,F VES!2FF(BZB:<6*+-!+ 3B Zxv( FFF [K# B8FЬB< +4##pd@O(; FChhB0x&xB5\[x+?g+&4#`\xg,K,F,x+F5,$O,L34d+hf+d##3FhZ`F`XxpG-OFF !F0F(G>D$KhB:#KhB8FU5iF0F(F8+d$դ +d$z,#@/d$d,- =p]0  F&&&hF #M3?iF(h^L&hf(hbhF0F h##`I"#+`##I#p&\&H&@&-O FFFF F:8`FK(D%Fx`zhB(Ҹ.ݡB 2FIF F^TDO"x-PU% xB *%pO%4I0H08F F hF DkhB F F4x*ИB( 8 8 AhhB9 F9x*hB,2B;pG pGFpGKhF! h&O1pGCI@$0F)W F)FF('Kh&HAMa(D(;O( A()o(q("d(#/Oq FzK` ! FM#"(`#1? (hO3+` J! H Kh+HAM F0&B-GFO;hBei;hF;hF 3 (F((F~Kh$(F[ F FT8*#iFB=F&(FFF@F~F+vnI@F(mKOhmkI@F(O3ObfI@Fz(O3OW@FF ^Hp HF1FtHF FPF0FB (F3 PF(0F*A GKhO F((*?HAm Y(O%0K(F`0K F<`Z`1I8h0KAF"/L`X-Kh#h PF~H#'I##%I#%Khf#MPF/h#+`#hK1Fh OKh+* HAm0Fb *&&Wu\&W.l&o&&&&@&H&&&Ȝ&Kh@&Kh<0H! H@\&Wu-AFOFF Ft}>F= F(ѽ;h,F &KF"h&K" `򿘶&KFO2h瘶&K" `򿘶&8F$ F4F@B F8@C 8pF F F F(F F2E"!0F(pO2!(F Jp-CF!F$%FFhF!FhFJFOFFAF;FX7(-mF8Fb%0Fe  O(F9h;hB0FX F(F&=KhF } F@{&L#h;H `K#` hh&$%!F([x0s+4 F@0-G!Fd OdO FF{h;{`+8F, (F$C;hZ:`x .+2BOH!@F!FFc FTFPF. k# F+pHK(Fr-AF!DK"xxBFI4F#x xBcxB4#x4;5FFF#xk/:FAF FKh+fO0;H(]FxF3|*-*F3IHFT(K(F(!.HPA(FBFHF>! D F*FKF!FFrPFFPF5%е@" c F( (FsLx8`O3H3`6 H=`4` (FF(Fs0#x+ F&&_Wu7W"K-AFhFӻFsHFF\(HA׽0FF8FF@F,D4!D F@!F;F2FF(FEF(FT, FA&Q[0iFF"(pDC\B\A$(F, F'00gKhFFz`(Fr!0)FFcIiF(F((FF$hpCO(FR!*0)FFcI Fc$(F F'0&33F(#" F#(HpGF DB,C/*F FKh ӹp&8Kh 81?oUKF? FxBB 8 88&X ;0A)(4 Kh"`4pGX&-OF FF08bKhB aKh+۝B]Kh;B$[Kh#XKh;B}oBB@(@FXF$Թݹ 0&'-0F9FMJF?F"Ѹ!F]й @F1?ЪE3Q3!FJ83K h9C(0F9Fܹ0.Kh{? )KhC)Kh+)Kh"(K]'K"` #K"O0`OBB?{0F9FO[m0F9F Kh($L Kh HMFOb&&&&&L&X&T&<3v KhS Kh( Kh+Kh8pG pGBppGl&|&&&-GFFF @E<KhE$$$EF 0F9FKF?FѹEE0F9F.,UFKh O0Gt&&-GFFFxf`Y (G FoJF? F0KhK%K h96("IFO F F poKF? FG$%#"F+F@FS8&&-AF FFjKF? F AO0ZPЍ@"F+F8F,K(FhB pG@3K(F@hB pG@3F F@޿FI hB F`#hbh IZ`bh`#hBi:ahJhh;`P F@$&@3p&KhpGp&FN F4hBСh8F$h\0! F8FO3O2###vca`K-F+h(+h`\`+i,`3#a#hBi2ahJh3` F@3p&hpGipG Ʉ 0 FȄ#vpG~pGCiDAapG@ipGhpG`pG-OdF Fn?HO0FKh+ьKhKBh+#O3EqF F F)F(сKh+ F)F(&F/F|KhvA (b6G70F9FF 0F9FFEy0FBFKFnI iy;>)CF (Р HO0x , FF FJaIKh+CHKh(?  au9 ,O2 FA3%:J8Jh*0; (01K"`F F HFauF !0F9FF(Kh#20FA39Fg* !Kh (Kh (0Oh F)F&x&8&&&&h&&&-O~OFF{ O0FxKh+ wKh@EOq{ ! (oKh+ kO3RF[F3K44F!F(bKh۱#!F,* , , (;h (0 ;h (CA40J(EAN F)F9E?F?w5Kh p#2C (# (503h2@FA30&K"`3h+$DF4Eeu#REs   !FF Khc##:*  F)F &&x&&&h&&&pN?F FMB ( (4E KDE<4E0(&KEp-OFF F)FF Fq('. o##F F0F^ $#FpB FQKh+ Og F)FIF0!IHOwFoF??FFTEu  =N; F)FbFH? F6Bڹ??РEy0KBFh##8KFj)J#`(J`%Jh"F#8+FV7F3h;B F)F F1F? TEu "# RF[FwVKh@ K F)F&`K"Fh#8+F&&X&P&&FF;KF? FhKh F)FK F)Fh.w F@ Kh!FHHag&l&hFH]е(!H@L1FF"h:K? !@ h8BBн@¿н&pF FF H (0F FKh F)FZ2F F)Fp@&FF1?!HzKF? F! H@;F2FBq0E1Kh@l&)F KFhBKhQBKhBKh&&(&&F KFhBKhQBKhBKh &&&&-G!LOH8F!F8FFձرBF(FIF~BF0FQFxPF6HF4e`` '`(F( x&,K(pFFFh#F(FO0p (X F!Mh( $$+  pT(!F(Fh1FD 8hhD FD0Fnh#0F^ DpJ1FhD (op Fpt&x&HL ax K#aH|`ax Kca!O`!``O`Oc#``7x&HY(  pG K"`aabZbbb0 ZcJh "ZcpGx&&FD F=Kh0DBh!F:J (_=-Y2KhF .,1Kh++&+:F!9BFKF60c%Kh+(0F 0FFi"M)h DD D(hKh DBt" !( :F!F0Fw$$$ F&x&t&p3$&d&-GƲZLFF0Xs!##0 .QKhjNM+ #00MK5sGbC+d(@EKhFBFKF j>M)##d3 KPF"` Oj FMH҆P&-GFFFFFF!6H6I(FqF04H!FO4Zi1HH(FE/HBO5 Fq Fn! ?? PBFPFq!  U RBK "`QF0rGEyFF5#CFQF0 - FMHP&-CFF:?F?F* JF?O0 F$%./ DEu BFKF K?"F+F0F@O0a* H#A+K'8"0!HC &'(8J$(6.((^(2"K"$%`%JEh$8r!H)pJcFI h9I h8L` K`h48h#3?H! 8H8&&&&05#LoO0O1B;b0&@ hFXhFKh3`p&hF#3? НNeKh4p&&pQXKIbBbE5? h%D$E Jh$Ei hhB2F F)Fp@(p&&l&`KhhB!HLO0O1&K0bO4O5S3BCEB0&K7 Fh!H.((XK`(!FHKh+H(F1K`7 Kh+K!F H HhA=0&&1E`lK"`&Kh+JIhXCKK`0;&@Bl&()((Lx.*$I3"K`!!H17I_!H$KO2`K`&Kh*KHhA=I F( Ft( D#AM< HrC\0*Fz0;|l&Kh+JIhXCK`,;$&@B&()((Lx.*$I3:"K`!!H17I!H$KO2`K`&Kh*KHhA=I F F( D#AM< HC\0*F,; &"> FFH FW(HAMtp(pK`pKh+!Hp@FDJF5 0Fp@]KF? F0FAK F)Fp@hٿ&&bl&( (А K`F6K`KHhA=r];hKF"`Kh#H@ؿL&P&(7 F0((7+xh+=+M+s+w+m+5LL5T L5T5L5LL5 h(F ` K HhKS"0A=0&d;h;l;&l(KhpG&(pG),'ܽ@K"H`/H,H)H&H#H HH H H F&;vrL(F}5((e4N$F '#xF00:ղ -#bF+MV" BĿF$04xA,+ ,$K`c&3(hS  pG(h ЀipGHpGrFKXk0 pG&KXkA HF]&FhFF_x-+0""x0; +FO  ##`Ʊ HAmF0 /08.` ##`@BO0B-OF( Npkh++ Ci G Rsk"iF `#scFO x*_x+,% ,$, ,=9,0,6-,5n,30+z$-Zx-*3&+* %%3 F8(#F8F(x++0 z$ # Fa/''F FF&pFa?/''xF=+Xh++4HA 2\+.HDQ-H#hZ*; :.:::h"i[ `-h!i `('3#*# `xx +0iBF9`x tc"AF'i8`ci G(? &^&P&𵇰FF#@FFiH--hY3A dH!E)A `H**-xzu +UH!Fci+-   G@-hb_hZ*Q"5555#-=--"ih"ih[ -.--"ih'3#)#`!ih'3#*# `---!+#i`h#i`!Hh++#iihA= #ih+!H#i!h3T#Eh K"`.6bP&Fh FFxF0; +FO #+`(<HAM xF20;ٲ ) 0, #<, !A4,XC>`%#+`O0BKhK hpGh+  pGP&x&H x K"` L$FB #Bs"F+F#_E#Bu"F+F#E#BuFw`1`pGBsFF F )`F1F F(7hh#k`T FA X!Fh`^l` FEMDB "F!(F4("" K I`F* h* X` hC` O0ph&t&hh@ @h0 -OF@+\+YF! # [$ RCsF#ME'TJ#hBME#HRCs2CQF#)ME ! !h#RCsF#  BظE| H"Fi#hh:'Fp;h&K"``aZaaapGh&K-GFh tL&j^##bKh%Of(F V?F?F PFK@FIF(F UF;h;BA&bX&h&&&1K-Ogy?V-JO0O1)Kh#O%Kh OF9E*HF  JF? FPF#BuK?ІBw F)FPHF4OFOռ&X&& LF H@`#j [ #b@9h&8Fh h(FKO1 `O0  8h&Hp;H;FF Ki;EBBh  p;-OF F##d pKh@#Y? ДBu+ A+ȿ F)FĿ3 #C#2C#9#C #2C3#'F.F#3?+ȀEfKhk,dBo#8F1FdE YKh\$hD+D, $$PK 8 [ h+D!FKFF FPFJ[F FF(FR#@H0*F#  Hh! #F``#1H0H(@*F #  $xd *F8F1F  u!8Kh+ *F8F1F  ](FPFk`^` (FPFSO4DF F&&&&|&;p&&h&-CFF $`!L$h!LEk?K@Eq {?$дBu L#hñEBq |?EBuh !` Jh  Kj+&p;&h& KhFJhZ`h#H`@Xh&t&p&8F F #x[ KiFH#a?*F!FHGK"`8h&|&P&H@ |&-OF쁍FFF(004,0 e8+0F9FO (πE#  FO2O3# #X?i?ДBu Bqk?\OKFFhCEu2??BqNEuBwBw#FF:Kh@BOqw0gFFO FHFQFj?#3? EE5?4FF#BA7E4FF0F9FO4O5 #0"FSC+FC("K K #?АBA K0b 4b BqBw x&h&0)Ek?opO3F F F)F 0"KbKh+ѽ@h&&-GFFN xCOEE@F(@쀆Kh*F(߀*F(׀~Kh+@Հ;j+@рF(tKhF2 #3b{;h+ =(KF?F9FF2aKh+ѺFPF+IѺ FXKFhFoHFFFF #FFFO&'F"(x?0EO6O7@FFF@FFFy?zg?q/0H/O0L#0FO2O39FO3!NF80h(, kKhM0h( F !H0ih@P!H KhF*;h+3j#K"b#3b-h&̜&&l&& IJhC`Kh@ && IJhC`Kh@&&g IJhC`Kh@׹I&&FhI I I ! F z!F v! r!F @GI,K-Ah,QСO`'! VDY(F)F F)F B!I : K"`bNM/h3hE+hB +hJ3s[`3K"` Kh N&P&$&&&&-pC!F FF^F0F!DV1F`]j#w a (F!DD)Fa]X FpL hBBhhZ`Bh`TK"`Z``;&-OFTLMhRI~F8/MMPF#` F:FOa0FF(n3x!+BF1FPF(0 + +XFFx+F ) !px+FF&ZYxx^)3xB ,$*  ; (\(33"p"#HF/ch`C``h``3`8FZh K:"hHF`"Z`  M;?I&)-OFð F(L*-O`ђJKM`HHBF(x+=-MMMM8F(FF@FF(FFHFVD6!0D++FBF}IFNEHF@tI0FnFF0F8-kԑkO*FOq0F(RnKdKBa(Fn]0Fr@83\ +0(F`* ( 0FFa12I!FF12@5F12I6FFF)ћ0320XXFFI>KB (Fn`(##`c`` e6JhB#` #c`\ Z X VI12I՛F)12I!FF)12IF12IF)ѵO2x*Л *К *XFZ(XFTFPF{h`C``hx`3`0C&;p?I:[R$&uKhI F I FI F僧I FI Fx! F*(V     ;/5<BWuFF Fj((( !H!HH!@QHUn9J-Oh+dgV0F9F]Ġİ5FDhZ`xL)hyn*hHL^F0@6.(h}KB ?uL(KдP0sNPP0hb鐱P0hD`qH\P4` r#P0P48hPgKBдf eHBeH^J#XN``XKh([H2`PVK"`blMKlRhd"Zd#l$+hHN000`+2hIK IIIK2hq"0xOb1h PPFObPPo2h(Ob1h*rOb1h `j*rFd `r$0JOaSF(HoKh)I qPF 8h KBд#IHd8`(Yа B ;h ChJ`,' '?'p'w'chplp 'u'K;`K0I0h(`(KHhT#`KhI q:lD< +2[F@Fl J h3` hpw?I'l'KlRhhh KhFBh:B`*ڴC hZ`x!hy   ''F "FI q, F F@꿇 "FI q8F F(+F"FI q8F LF h<1F#(FaF;F1FF `(Fa hp'])O)N$;h&JB* #&JcChX+h!3h@hxI@hHFOR+F!hFF(3h!hFb(F4Kh@Kh@h<h ("F IF q`S` ]t'''?I'Q-sCFM(h#I qh`KOO $h``hL$h4B"F`X( hUIF qB pt'''E-OGLGNh%F#iFDOhи&,и\?Jh 2 Rպ0 :x\*e&*c"ii2B Aia+iDa`3"i2"a6O 2hO RD1?)??!"ii2BDB aiADa+iDa` R BFDFF iCD@D a9F"ii2 MB Aia+iDa`"p7Ft''uFAhFiFDFJBAahu` `/*F1F#c` Dbh#h!*Db`TK"-O`K!L (.J#bKh-hh#hcc.d1F.ch*03h+hshBU#+bj"!jph +rhhB #`:0 (ѩh h+5JhhB0 `E Bh+ aj!j@h(Ыhh* +BhhBZhhB*[h `ch` h+bj2F!j@hs +ChhpBpAk~D@ (+~=;>+{ryyyyyyyyyyyyyyy yyyyyyyyyyyyyyyy?Tyyyyyy6LiyyyJ!hNhB[ !0hYC`g0`'h #2h!{C J#b#Sbh3 K(ih`K[k+('t'''''jO+@}j5>jj !0FJ#bA0FzbB##"IH#kkH##"IH#bj!jHK(ih cjO |Kh}KB<#;`;h3zHt0x#.tK` uI V0<#;`;hlK"`"!&+AF((FO + ؘ0"!O  ;h6BSKXHhQK$ &hNK h\XF~lFXF;h2FBDK&HHhAKJF!@FVDhP@!XF(bBF>HF:hB4KVF8Hhp7K67I 6K -KhO ;h B'K&+HhV F"K+)IhSE^DDe;h6BKHh8K$ hvK hrKh[@Khhh (l"FIF qt'H'''=hp*ht@*'QKhsjH[K!BjjhK h&N! (a#b IH#";!H(@Nj~H+@z}K!BjjhzK hljԁ+@g p !$8F 2 F $0kK!bj8Fh^hK h.GcKZbB`Khkj_HS_L!Bjj#hD!h |ZJ!hZNhB[ !0hYC`Z0`'h #2h!{C(i7Pp``'`ki&jZiEJhjiRhB i `EKEIhqJcj1F;O#F(#;a{jO + @+h2F)I pC hYChChC`:+h+ :!(Fx(#p+x B+5(F a0+#0hBC`ch+g`0FCmQ'29KpFhK`,,`h)F h+!  #iSBSA#iB̿## #iB#iB###iB## hp$h(Fp'?("0FMFJ*FI pObiF F2 iF 0I p F^ M0lV K : * B² *I QppGpp I0 F;0+Bڰ1 q0 YppGp 2L!F$h!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@@'K0hci1]x(xыh( F +F ( K|  t~  ɲ!vY} 0 Ҳ"Zu0?(@'Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p@'?(p1L#hZi5kkC#h,J![ik@*N%3hB#h[im@)FC #J!@"I#H#h!J5[i@v#Jh"hRi( J!@f#"hRi, J!@\#"hRi4hKH p@Pp?(qp'p]<'8FH` M|"FI0 !HD#p+x˹IH$H JOq HZ(4I X  F8H8p'fp{F#Hx jBFH /!PD Fn*(ЀhF#x?+`x`! FC\0S+ H!F> F!F H|hx#`! p FIFH p K D|KD |BєB4KKFIHKh[i1;xB[xIH,IH@,؄@IHF@r, IH"FIH@f@''= p?('0CMIFH Dp7F F"` F}#xx4#`O0h"+ѕ @0O0 F0F'xh iF F0"FI pCFHD"#FiBUj3,(XBFBڔ5D#>a(=iCj JhZ`pG4`Kh i` {h*;apGx'j cbpGj bpGj bpGj @bpGj bpGj sbpGj sbpG h+#`pG# K`pG`pGK" `pGi'K" `pGi'JKhh*B#+#apGi' ['# `pG H`pGJ K`pGlM'J K`pG`tlM'K `pG8K `pG\K `pGeK `pGBK `pGnK `pG}# K`pG# `pGJ K`pG8c'J K`pG\c'J K`pGec'K h41`[ 41pGi'# `pG# `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pG]K `pGџK `pG`tK `pGK `pGK'K" `pGK'# `pG `pG8" M F(h` h (hi c#hL!& 8i'"KO1h#`  i'Kh 4 i'K hh  i'-A"NL$ F3h`h3Pv w0h)h6CEP6B"  i'"K hh  i'"K hh  i'"K hh  i'0$M"FO1(h` m K"`8"!hF#iF+h  F0i'i'KO1$h"F` JK"` Fi'i'KO1$h"F` 4K` Fi'i'K$h` Fi'KOb!h` i'FL"! K" $`kK` F ['X'! Kh*K`XK` i' ['X'OKhK`# @K` i' ['X'OpnOpje gd d` a_ ^^ [ h[ WZ T{ K` b'# "O1]"I vO'"L !F wf'"I@1 X'"I d'" hH "L !F wzU'"I@ wR'"I {T'"I |S'<"I uP'<"I xQ'<"I v wN'"I l uP'"I b xQ'"I X wN'"If N c'"I] D L]'"I] : Z'"I] 0 Z'"I & xM'"I  c'"L !F wj`'"I  k_'"I l^'K$` F 'K$` F '$ F `d F $ `\ F $ `T F$ F `L F F8 `  F `  F `  Fi `  FH ` 7e FH `  F2 ` !  ! } ! v ! o HZt HZj 8HZb # "K` / H]' V  z  hR *O3ZЂiB##apGhJ{ZC *O3ZЂiB##apGFOA FOA} FOQu FOQm FOae FOa] FOqU FOA4 FOA, FOQ$ FOQ F" ! F"! F"! F"! F"!  { +# j######apGFCi FFFi ""BKj6Bj7Kj6:ciԣijB-aҲw*b(Ҳx"I-~6#l#:F)F FG0Fj0F8F6ViBѠj@ֹd3Ci-OFjF &&- h  FFF ! (FO2AFZFpF6%+xkF5Fj8ihBiȿ80ыBa3[#biR#j DBۚBԿ"b#b#jB[#s#b)FO[i_BAEcicj F F9FS 0  SF*YFAE ck FF FSFAFFiB#j# K2Fj6dbiFj-i2F#j)Dj?jOԹ8L h g("O1 h  i'pFFFQF0FM*FIF Fp@+RF)4 "%(J!'J@1#J! IH@J23 "FJr! J! J! K{!h+""j@d'X'f'7e g' h'vO'b'F)/ %(J!"J!J@J!IH@ J23 F Jr! J!h Ij@l|S'{T'wR'zU'7eU'V'F): (+.J!,J!)J!&J!#J! IHH@J23 FJr! J! J!K{!h+""j@l^'k_'xQ'uP'j`'7e`'a'vO'b'))IJ!J!J!jpGwN'xQ'uP')  J! JOqJ!J!J!jpGL]'c'wN'xQ'uP'))IJ!J!J!jpGZ'xQ'uP') J! K!h J!K{!h+""jpGZ'lM'vO'b') J!J!J!J!jpGc'xM'xQ'uP'HZ:H@enon" L I3 "1Hpt"1Hpn |S'V'enon" L I3 "1HpP"1HpJ d' h'enon" L Ie3 "1Hp,"1Hp& l^'a'enon I H("I\ =#JI  7ef' g'R I H("I\ !#JI  7ezU'U'R I H("I\ #JI  7ej`'`'R `pG H`pG# K`pG H`pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG `pG `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pGK$` F 'K$` F '»Kh  i' h+#`pG"I v xQ'"I l xQ'"I b uP'"I X uP'"I N vO'{  K` b'"I : xQ'"I 0 uP'"I & vO'{ K` b'L h ("O1 h  i'J'Fi#BTj3hah)FBڔ5D#>a7D2(/(=Oq Oq @@A @A @ؽ@= @= @˽Oq Oq @IH p^p&Lfh.A,(?23|= p=l"! >zO0.fO05M(h7`(h7!`(h,(Op@##a|F`a!Or I#D E# 3(+#c`&&&0Fpx'?((=-OF,{KiFBu[iS$@,oci b! +aO3a3\::k FGj+@ci h*eh'i O O &&X  xF# !PF  @ 6SESF PF BFF66J#F#`bi- mB BFhiD`0hYB (aiDљ %uY`ihDB`i@)30`Iihc6[BԿ``O WFO iEbjO X :BF  0  E3:FHIHHCKhKF r?OhJDBh5P-umCF*FQF0D8bx3t 3F/Ih-H!,=HO1j.^O1j5ci hQFCF*F0D8b9,jKh9&i+@;bjh"jaB Fj@O(F1<('(߁ (b (ہ(;x'[p8?(u(+((3(* ( B а ?(>(@ @B @󧁰@SB@ @0ciozw*΀V"/ #iiB3BۦI ]B h"ja DBt[3ajh#bg&k&I `M(h7xF(h7x#FF8F8F(D9b9F(h8^%F40FHVFFKFF+0h,"FK0h5KF"!0h5"!0h>0h<|E *x(%d((@ q(u(iI N0h1&gK0h33(9 i+?mh"j[R#sa"r"bj,tii DQBXh jD3D%uBȿFBԿ%b bax(ia??z(`(x( 8a8(8?1iB-cjh?&aO{p@0(F1v( :hC20/I (F( @SB@B FN0h: i= OqfO0$`"F h E"9h0h 8")FhF;hiF(F3h g Fi'pF M(h: i;Oq 8O0p$`"F h (h"1h Fpi'pFM(h: i;Oq O0p$`"F h 1h(h" 2h+hL! F3PFpi'K[iS 0apGx'-OFFFF($PB,FO0<!DJm`P0S$8!D ((`Ci4 C` $``aC3CacdccK*FBc Fx'( KiB[iS @ci ՠj4 FD"!@x'-OFlL FF!hF`hFEahh5"ea`"afh%F0x(`KBh3@@ 1Fw 23 RF+* (  h6 !h1  !h1" " "  i ( :h6z !h1 !1!" L" @ ,GѪi"ji*$$6T D 6\Eۨh6X'K#pE !h1T4 !1LBF1F6V,!:Ҳ* I@ ha" " >FU Ljh6 !h1"" " ;LHF'uVUUU @-OFFP;#O O PFL!Fh+z:F)F #3pИ0RFAF0F. Ih5AFh5Ih5I'h50FVFh6h6h,F6C# >+ؿ'B/Bؿ''#ByH+FB FBԿh5oKh6~7lHpKh5@gKh>eKh;1d (F(($`((b@BE@B а:UWK1FFh+,e9*1 *= =320[ 9  =320[Թ * -LF#_,(LEO (FOD YFrFYF0FlꈱFF `F$PF4HEFEF 8Fy,[! FFpF1H*O>R`P3B #"F9F #O3?F  j@F1F@F98F|<F&.@D4p:( h5d)jNC  h7~F0IHN T!**F!H 5!(F*1 .ǔ-vLCs-*)F n2 (,8qI h%`jL h@lI h|##`iI0h&@hIh"ph 6(cH"xc82hFZH41F0hr1hWH* UK!!` "` FT "Y D!0#hC#`O##4 d TFĖ4QFOpbt4#`FN( ;h+@+@IFP8`򟀻h+$-H@Lh$4(IF FP$#" (F BG,!K! h3SBF"Fh K `h!0! mMc\Z'ptbt^cf@pM'Z'acdoc ~cvO'ccb'ccc *OrB  LKhKK%`2  o`%~* OrB a` o(Fm&r $Z" B] x"0FAFS0H&O!VAF d-&FDF zS;DF ̮̮- #xK;1 F;h#IF\8` F # "Ir p0,!F8h38h:B6 }pM'b' 7hF#L%hhFl IF(F> hF h##`-IH\F `XhFTIF(F& h.KhS`h$IFS Vh$ IF H  0pM'_NccY'cdp0#$"K ## #IO3 I H` Kh HZ `!F(F 0@da\p&dpM' -CpFF(S+! (t #O0;`9I(F(,OTI(g~F(OT`F8`9'(FYC7 B7x/'/69F !0FF F0FF FO IFF(їI2F lBx%+2@+*!:0/!HFF"pHFz"F#/" pFPFC XF{8C{.+ QFF(T%0 FE5F8F(У DiIKF2T%0EHFXFwlD%p1@ _I8F(0#(0*0P#*0UM(h*!(h6(h2r:+h O(0;(0  !FCFFCHY C=@ 0(~58NF53hBF !F 3핱3hB.H34 3'4-3hB4 345z:b@ >63hB5!8<.H3 3:BHCh;C`+گh3`Edvddadydht@?(pH: v1N3hB2^  0h*0h1!0h6 :&FV  F(F%Т. OpG?(0ð@|Fй0.!""H F"[HvH"!FpC0''-CFdVOFB#_/-{ k20#)F@F%p41) F+FJ4## F#pdupF!F"FCFА"!(F"I(FV*F1F F F F.(Fpp'pL FHFB@!FF 0˱) !D<.+``@IHI@pHp'7''p+I @0b"F'H&I @0b"F"H!"FbCF0("!T"IVI FF F0ND '."FH F'FX1F" H")F H N0p!i'%i''6i(']s-O!]LX@Jp (ڎKhHIHc UFpFF3x۹ |#OvI0V8Fp-Bg O:)F aO@F`@DBxI0F`1FF8Fm*rI0FRpKh0DX)F > FF8F ( 23 RbI"O7 |.`X`32BCCOGF "O3!j *FMIFi 0F0FWXۃ | Oq"&BHXfV"@I>HX">I;H@!-Ks*E67KF7K "0 `@!5J# 0zt0+%H*IOph= &Y"#F0zV00!H!l* J2h32OpHrꈻIFXl''dpM'dpdIuGR'ddde ] \@IH:蘱IH4pIH0HIH* IH&#:4:4{K IrypK J ( OAzHO yN\Y(Â@(spJqI N(@\6lJ  C\6HE" WP t !bH*#p`J  (" ]Hz ^ !YH#pVKx+\6C\6SJ  (" OH\ >0sLJ  (" FHJ , !CH#p08J+\6C\64N!0FP3xC\6C\6NF&\6Y)J#m F\6+J#l F.m/@-x#n 2F!J#o FQ 04+E("I<?+3"I5'd ee]de'4ee'ee'#fLi'f'-g'gg8(ػI" @J#p FJ#r F\6ԳJ#q FHDД:JKI FF< F9sF F WsF:BF FFu O6:JIK FF<FqFFWq:BFFt w T(?7pI > #FX6'eKxF*AhIhH FgKh,y }!Fvy wbIp v`I0Fd\J\IF(F0#YJ(FYI0#IJ(FVIVI  (FL3QM+]иBr9S3eJI &GII(FV|# "O1F# ع0@I0FVh)F0FV.F;Ix(` x+51Fq~3F" 0෹4[Cr8F3+I3r(I8F#x3HFHf\/iєW5+S I JI IO ag''Li''dggpM'pgh8h'Uh`hoh'thhhdhhhi |#Op"9F05&x I @ X X#X6?4PF !] 4i-Cy}F F(HIFF 2 ;p&#K rIF8FI:# rqp3F0>@#FppD# "K0F0BLgAIF8F8:4[:C2(FC=I*C2:I(F!6I 7I7HF(54IF 3I F 2I F/I F0#-J F-I-J F-I03*IF F(I FJ FNI #HhP"I#H#H"Hq(F8 C'iLi'gii]wiohi jNj#j=j@j'[j'sjwj'jjjF+CK;,\*]#F,1*j\&O _/9%p0x 04Lx04Lx04L \,9 FKDp8F9p0CDB#p(#(BsېBq O0]KL" hhh10a`i'-A] *F FF#F J FOQ`!CF,OR##TF8F_d5JBJBѝ0+ٛB +F2F I Y+F2FI R ]PkTT)kEk)FFFa%IX!.l#I F 9F.;FP IFTT^ #F*F9F/0F F[k`tik)pF#IhIhiqFJo@hhFho@ih HzF8 ih0F pp Fp`l`tR(KS K(FpGHpG𵅰%+F)FHy040FpF+FHyI FJFOWo0F()F0F(ѥB)F FU I FUT FI0F FKhldH\NL\6K-OL$5NhFLCh3hF ;0`.JkhFIFX@IFF FF8IF9F({(ѫj LKFdF/- F(B, /+ F6 (pj5F8FL3h KRL2h JKFRF(& i'(' ['R7JhF*zr I3 J F0(h0 F0i'k}k-ON& #4hZ-8#JO1m`Op(2h I2 H52hI2| %JHFHT K "! (+F( FB J#03wK"9FPFfO EԀZ)4hAFx(@ŀdL#D#|+aKh2R<3eI.o`abI&*ZI+#b#c#{+@+@ +/+I0h#"kAF0FEF 5jb,/Khj[j XFNjZFF[F "T AF %F7   )%(Fi'`tk{k.l{Rkkklk!l7lq=lElH]'-OmH%IHFIF(FKhFNKIh3F0Fl _)hH ! I FKhj.&Oc1F(BFuzIb@~UF랩H&U@(F|.b%xI FOc)FH(CFOOoI8F:0#B B1FFP&FE_IfF50 zU%6%8F.굱@HzFJF%zLI F$&O9IKh#IKO9hFO9jO &E+i#=Ib a;I\*Y07O+7KSF6KF< +0/////6 ,K+J (F*K *IO(V"U+i+@𷀹?#I F"K.FKF KOBFO >KOBF 8luHlpM'i'lllzd@8m|d@OmH]'b'l{RQlq`tmmVlBFlI hHFoeHdKF :FsFF(sFF sFF@sFF FFHI F FDI+i+BKhS_  L -FIIwF0+6 "1FUF F$. "!UFF. "!UF8IPFp7IPFH5IPF "QF 6TX -I @ 0cE E'I xh 0c 1#Co]AE/L#_C Ct`R % LT\-!F"4Sb(5si FO0KnnHRߒ;WunoL#hzw%h9FObv0FK1Fh:# (F$hObu`)F:;&F(F@ Ki'['-OmO3 t%K h K R? +O " Fh:! F*FII@ d0F@ edFe FFe0 +^SFJ!0Fz F!F@! FF(@J/h+иh+@>e0+91FOc F'FF-FvI$0&tIrl8Fv >.ep/@𳂇9F Fff#gcggOc' aK39FwOsF @F9F"0F "XI2qXF2F3a'Ozs7` sa0.3~cHAB ո6 DNQBEF'F#FF67/x'+w^(.@3FnOJBF!0FT`"!FHLL#;pF#M01BsHXF$(IG#8F0#p1z0mНs1+i 5#8F!!7@F#A! ;#!boo! !0FI#!e,#FJF!;H]'\ ooьzd@`t('QQ`R7oFS] )@F+"!T"boo8F !I#!e#FJF!XF,#!FT5|4-  ncKNh/7JHW2h*t' x Fz% )FL!O| O>' p_`3 1BCLC -+F᩸#ZOtPO3C`#`xK`# r  O3BF  j F F93h+BbK"o`_#3`+򣀫B۟]JFhAF(@#c` |'F3 B3h+ q|""LKQFB`"4!O2+HJ`0*>J*"LBK" h20D"QF?H>;Khbpc'wN'b'xQ'_ppuP'W'O3 A=3( K! J H Kn KJ! HKf ]xQ'apb'wN'uP'W'J#3+Й\ pG pG,'K 0 (\ pG,'K B/"pJ\CTpG-','iQ#0Xh+K\\T ,' N}R 2#HiJ##6"2 J4!"FF F F N}\-H,'L#h+I ##`c'hp-AF)I)NS)L% F9F (Fe(5K I%$K$`K:FKI F%$0%Ny+ La#00030{pRZ'~pc'c'vO'plM'-O$ ="!Fx#!#6HF8pCO"Hx"IH"IH@MMFMF&Fc#2FI"F|?FI#z@F\I@FnF@F/@ x1B򙀘0+ * +xa2FID"FK>J!F!Fl3hFs7LFhh| 3`IF=(hG(Qch3c`kh ++)H(H,*+ &H&H%kh+#I q!I lF8Fp8F~ h 3`!  3h;Kh#I@FKjh I\CT#i3#aCc'vO'c'}iLj'wqqqqb'q,')F'(ML( BF7p:1 8O1(h( O1 h(O1(h/O1 h/(h.P h.N(h6. h@A?(Y'pFm"HD8!0F@ 5lFIupF(Ob)F"oObILoOb1FBo!( F~  F~(F mpO H H(H0 qqq7FpEh "F+FIHH0rpq-A }AH@L"@OF))(8h)8J! "3Hj e(F?hF(FFj)MBF9F B&I %< i#K ! "!KH##")F(F)F0F! 9J!LH{"F B  Lt }7r,'dj'uEIrF][LrHsrp-AF&LPiBjyX8F1FT0FHF(58F~i)!J(1x"HjFO3a te(F@KhF(FFj LBF9F ,'ydEIdj'rF!F< @iF O3]-Oհ@FHtKhH(L"!N FBK"FS \'- S1q])2 3"`#MFnh'.w+h+r0+n+c|K! h2.`6@!ibiY +hO D!hoK ** 0C 00306*".FYF[FO 6rh)*(*3'* >SsF0)O癱`aB YFE (F9F(=5h@JSihB}  r~ #ichcih!h! 2Lc{5I }( @  /I o.I k-I g#{7)H&H.~鰹.#BB HH\8I @IHX.<I 4W ! UpZ'rLj','\\?(c'rrs:sVs[szssss?(iF O3]-C]FkH$uiIFB~dHfaIF(`H\\IF( ~1FOp!%U((RI2F(ULI F8(F@F1FOp9F $O0sBIR 0F1FFFHFp4I8F*FOQF(0=+$(FR8FP0 F`%@v@FO(O4FH@$c! 1FOpY!F `\~h~d~b F(FX ]pls td M$FFOc!F%:F1FDB ڶh(Fb`(FZ F MJrdAJedAj bpGj bpGj CSbpG {apG h C `pG-GF5M*hP4I8##F  "0I!F!)=(`0Y,)N$FF4,7`OFF "JH " #"I #F"F KL" h0dDj!F#Sb(h!FjPL" F`_fa%'`%'i'9f FFE#K9 #I&hcYCa1x#ij+h@`)"{*+ݢj&t"b+ *.Ԣj"b_/ اj *+ *+ `3 +i'k(@𵅰& F#"O13F P'| / I(Fp# // ")F/##`#t ]p%FKj J ! F"O1 # +F FT&pb(FpM-OFF%O8O OL F#F4 #K5 hFF K!F FBjjOB B J`+ &33h$tԡB 7$PL K`! S4X` ` `*#SPaX'i'``FFF$ ';S0 30DJxG*ѤM*KOh7 c+Kh:+`s+O(`+h cC3` i'-OyO F;hF+; #2,`ò3F# mK mK FmOhMlJ!F0F;h "O1J  #  #F#41FV (𝀝M0L0`+B aL# 60  # 0 L0#L t I(4 IFPDAFй 0jp1F 0JF### aFBFOw OKABOwF BDLE8\FBOq FhKh#"O1# F# "2 E$c0Jkh,` l`,s i'H ['X'ь Fi!L"Fs -CFMFOF+hF8FAFF FP+hZ)FF FH)FF FzBF0F)9F*# #KF%i'CjpFFh){KTI )#(1;CIY{(ѓjLLLKFF: jz"FRh;!h Sc{hZCWj? KhQjC EjF  <1FFBjD 5%IF0F%rj"Ij%ljIj%dj^Ij%^jIj%VjIj%PjIj%HjIjp@㼅jE F(Fp@׼pKulYu`uiupu|uuu-OMh F#4- F #;F`0Ʋ(FMXJ!F8FVKO1K "h D # #F#1IF8FT(}НE0D0`+ٞB ӣaBKL!h3& 6DHF0:Kh; # 0 D0 L M HFI(, IFCй 0:ZF XC! 0c#Bq ڲ c Bs ڀaFFEO| .(#`Eq1 "FYeF"h2chDB,[##` e`ьX'i' ['H-G9F$LEڢB ФE {CheB5L6BDFL0 GhF EFEЖX0+l+PwEEwEӞDwEaa  j#C{bB)s )#Csh OOsOc _4OcOS#Cs`pG8 FhF(F)ؿOq(F(!!as(F`88FC{ FhXC((  ``s8-OFFF #;M1F9L P"8I8##Fr5Ib!J! 0|D( E0+#1%M+h**"I&7F*hEݙiI FI 6&z7L360 ASF IF@F(д J (%'`_i1bi'''H]'-CFBFFBL 4Oq0F#=I#ORP:I_T/S7HdD7"hCE4H4HB4HB"ё2+۲_9)KBB.$KBBjCb*ё*2)+"IH@(L ! F( 4 +ȿ F #pHHLIFF F"@c]`/+ FH F''%'RTTTJ ('''HM'('T-G FFl(O+Kh,#0+#BFFP0c#I8"K"hp%0F@#)F$;4O FME56:F<@FV+ "F FZL4?@FlO0 x?(i'𵏰$#FF#E,=!+F`B 8FhꐹJ##!+FL(XBXA FKh0}#0ÿ pGi'KJ(FFHM'RFx x/(/*/* JJOaHZHFF]uG'F!F@ѿF!FI@F YuFX(ڵh$M(h0:FI(hN3h; :FI0h$z FF Fa:F1FFH|-h}z FwF FO:F1FF(Fj `pM'uZ'upFF"FI@F uF9(!F F@} Fn"FhF6 Ff"F@.@jFI }u0} FFO"FhFQ(FG"F@Q!hF04@jFI }0u F*!F@1-AFFFF(F0|xF!Fr0CF:F I xF(F}K$T*` F uG'7*FFa# FI<I*F FF} F 0nL4ӹ'F#4T.FV;43FIF +(F}jKTG'upFF F)FJF Fp@l8FF!FF*FIF @ 8uFO@FO@FO @ۿ@ @ @ K0 pGG'!& ZpGKh+ ^pGK'>Kp}h+p:L hZ-i8I0(Or)F4H2HQ(Y%h"0I0F-K-K:d!3F,J`"F+&I&H%I0 +"IH(F R(F%#h&'#%$C HCCL(CC ,CLPC)BOqqE }pK'i'$['n> >3v=vpedALv*8KhFȱ(KL$h#V-S`83+@0!  8 8K'i'8M+hJ 8@(h"I0b(Op !F t 8i'$[' pG pGK0h,Kd!J F( I FOp)F K$ F0K'HM'ivwvH5H@0vj pG pG pGKh+$$sqy *3B$$|@!FOp F0  K'F Kh! Kh2)0ѐ1 + @v! !$#1K$qah QA@[K K{k@FK'i'! Kh*K`K`i' ['X'OKh%K`# K`i' ['X'p$"!F#jF!F@=0˱Op Mz K!F+`F gkF*hII jFI @pc'evvv@+ڿi-CFQ#0} Fh FiU#0 @CFO0 +8F *ەB Q8# FRh3P MG@KO -G[m Flb# FO8 O1 `hvEO G q` ̮ f5s`320+-Oȿjؿ" Op#*F #O3CFO0) 0F +۝B̩8"[hl&*4':4'0':0'0' 2",'L [ml'GOrF!##`Oc 1Os1# 1#$1P#(1@ F!# "#`8'<7@7-CxFFF$O3`1hB #BrhiZCXB34 Oq?O0KF J!|PM8(_ F<` b' Kh hhOt13]K m'8F)4  'j@P!jOpHkj@AbljOp:"l j@3bkjOp,kF(F8@ 8pF@SFF"FhF .&5UAI]iuOpj7@jbh0OpjjFn@jjFfOpj00F0a@S[#m+1J!hFj@>OpjbmFKm+(J!hFj@*OpjmF/#n+J!hFj@cn+J!hFjOp n+J!hFj@jFF FOpjnF   ~F1F(F#@pPyьpF°@SFFg"F.Q&2><`T4#0V<3 J!F:86BѬjOp,@j=F(F'j+J! jOpj+J!j@ #k+ J!jOpF F#PBp|ьyð#FF0)z>FNV^fnle ,t0C+h34J!F56BѼjOple ,t0C+h3'J!F56BѼj@qF F8jOpD'.j@s,'&jOp0'j@u4'jOp8'j@w<'jOp@'F(F#C|-O FFFkF:l%F&FhBչQhki1@X@h%;k Dykz` FGzh6= @iO0GOmF36 # +FO< FB B3B BBOvC `O3  S`` Or"("BF!FF0F FGF 7F-O$N m'F5F0h D~(3h"Fp#D`Qp21BYXD[kBρ By#008#)h!D Q 0۱2IP 2hI "DRD2(@3h@!JHF#DSD3KFCF++h#Dj+J@!F+h#Dj+J@!F+h#Dk+J@!F~+h #DI3(@i+h!I#D 3[D®#+h"#D_Q1Z`F8082B`R'C23!hp2(ȿBtB'DK4B mzzy K`Kh+IFpGi'pM'zpFFQIhFFP8.&8M^oOpj F'@j1F13 1!>JhFjOpi@j1F   1FF(F\1k1   -J!FhFjOpB1K131!"JhFzj@11K13 1!JhFjjOp 1K13$1!JhFXj@1K13(1! JhFHjOpRjFF F#pWuьlp"F!ZOcc`@#fQd!@ FIzJrF!@##`#bbO3#cQd!@ FIغzŰi ,g%5D:?JOT\b1#"@#O1 OvLj[ bj[ b$a$01#"#FO1@_QPOv*T@%XOv m[ e`@dOvn[ȿ#fn[ f$L`!O4%#h!J8F#"O1+F0F8FB8F `,F FEьF3N˰ F3hZ "1 ""0`i,) $)F0h?$5#"#FO1@/(5Ov ,5@05Ov$,` O4 $+h!J8F#"O1#F0F8FNB8FJ(` FK|aь𵕰ANO3 F FsjZ "( ""pbi ,B $).38=0K)Fpj"`S,K")Fpj` ! { +D7$B@y oe@{4uOve@} J:O:3F!CF7J!2-Kh(h2F2I3&OOFE {hChCF*IP 27缱 Fh!//L"O`65.ϮKh#P*h`O0Kb'zl]'zzpM'{){O{c{{{{{ChFsh##`J0Ih+ h l'BChF{ 1+##`J0Ihh+ h l'^ -O&Dհ4FO5Kh0D( KB i'OL IFO@DIR{{9|Z|-GFDh,EXli'FOL !±0O &F?B,8F04FEıD7+  Hw<|CHGJIh+#+`(h l'-8#"-CF}Skh;+ q07h@a #hOp41@cOpQ:j2F+@gFFs:FIDOhhL&6DFIDCF(F"@sVhL#asCb <@e . Т\J#D06[OpoH;FnJ!DL#CjP&*FeML#OFFC+FDZI8F\J!cD2jFOF"3FDNID#3p"h*g  W/R"AF0F "CI0F#Eѭj{OplH7D7hF(F"@o#h+Ѐ#{j;@R/IF(F1 3OpE3Fh@> 13FhF5#h+hj@cl!JDkOpjhL%#k%FOKFD9F0Fhv|l]'||R|o|Q|dl|&`a#h+\/J!`X<W`&!0FY,*ەB8"!8FO3;`8# sdSC=FPDŔ8F M b'GFF8 xFF`!hFlFE5F3h+0FyO0$$h"`sh;c<0Fyn o F8H"F F!"##` Kcc Kc Kc K#dOscdUhjhx)F F8@8џ7 Fi-g .MT[c! F^" z.Ic(F~Oscd*I(Fv#cd(I(Fp#cd%I(Fh(5#cd2kI(F^HclOroDcdI(FP(cl@"oD# 6#d $ /cc% (c%% `O5(F00 F!hFm(#8"Q3kl8"SC0P"e F+ 00 F!hFI(-c S/ML'%*hl&"@ 0+h+4734707307#,700( 0l'MFObahF#3`$K7FmF`:L"c0641&+{BP&lB"!F0Fn4L7,L Mi'L##&606P6pG0F%s"O1O #>)F`0@L&LF!h2F)Da0D"!hF!hF h#"!`Op! ( h2F(D` O0#h"`%i'0FF FFhF,, ,0jFIIjF kDjFI dD I ^IF YD"O1(FOb!pROb!`J FO0 0g_p F#F = FF0F2FI "PL#E<h+Ŀ3`pq7F"=I F#LX"F:I (ih+dh"5I F:耹"F3I (Wh+R0h:`X`K"+I F"踹"F)I (@h+;X`bRh8`B-"I Fh#F2I h*h+Ŀ3`I Fe+J!P "FI o h`0B^ -#n{l]'KhH"`K`HK`HK`H|K`HwK`Hr K`K'ǀxS'πi'؀X'Bi'['@i'-O]Nl+𨀚ML+h*@  x `(`M+hCOq x(`M|+h3H! x(`MO+h Jq x8`(`Kh %h"L! F`%a @  +5ca"a!wLPO F`%aOs"c` 5caa!mLPJx F`%aH#c` 5afM"ca!#OOb1F FO(F<(POb)F*o3Oa Fg.(?#x/+0 ex%m 3 FF*3D0DoEObI FoOb* Foӱ?#` 8FH(ڱh 8FZ F |h8F88FNr` M7uF(!  @ F! "iF ( F$  ;@ B .-GFFFq*F(;.7F$8Fr`C+ "I(FF(+FRFIZ0H>XN.CFHF I`4x8Fn FO08H-AJmH"F(@+(Hr((Hmȹ(V(FcHObF(z(jFH%(<(%H%(IF FI (@(&}I(`ObF `L `:FXuI(N boI%F FpHiObF(0(lI  cgJhI(gI()ObF `bI( bWIF ^I(ObF `YI( bLIF QI(SIF F(PI(MIF FF(KH ObF `BI( b6IF FjF(.HObF `4I(!F `6IF(0IF0FIF(x0HObF `)I(FX&0Oa&J ` c `\0;F bI 6 .=Op:! F JmɁՁ߁u {l.-aL$hz$BQBuDB+FB(.F4,. `` O0i')h992`ppG2+!*OЁ!!!!"! pG F@2h D B# 2]7F@kjy(* QhAh!`Bi:Aa2jA!aj!b$(*lAl!*mdB"e0umy-=хxx`Ex`x?=5`h `yy`Ay`y?91`hh)D9!`!ha`!h2hDFBOAO0 O0*sFF KhFt3hcB bhB#hDBL"! FL4i'pFL F#h3OsK "!K#6###4 ` hCi)F2  paIp FLboQN#H3J``K "## # #I`g`oC)F paK'y!-OFOpFgAKhAKhAK!hf#F"F;L&FF@01[` #01w4X4AO/IO5P CC \3B0Q@4#=O2-&04qO8Fxx#* !"441$0$@5D04 I=#`4D ,D#"O1#B F$CH Fp-OrF@9F/Fh#B=h hB@}- @!*" 2""2A!Dhsh D`hq*DrRKBCKx~ h2DQF(QFF F$BQFFFCFJ ! FXFKO "O1h #[F@r FZFbxFO{E@XETFDE h* ЍI8F YFL 1 YFB \F,FB(FB/|JhBF3y*+z 2 FBO{mJhh#DDB҃BѥBeA+)dKh+DBh2"DB  x "pv<1+D141DQ.O q 4w(JKh112!D1D"2"Q1#1/?whB/ OԿ;F#3X`DhdD@/`JBGO q w`? """2 rqvR{BA{"," Jh!!"D! D"AR!"! ьX'K'X' ['R2-O+ٰ FŀtK' @ >Fh  (F `#y*+Ѣh B DB' #(sC@F6  I /.CD07 /D ' @FNE@ I X X< @8D"D/ pOO hā9hFF  E1pGCB-Ox KFcJ !8F@F `K"O1h <#Op" 8Fv x+Ox RB X RBhB3 2 !yE*)  "hCDBEF "(B +)@b1+O q wb(%Kbh1[B1#1#11!1FD1112SD2":11F#hRFD` 3 `h`YX' ['ьX'R-GbF F@1F.&iF*|KO oc+yO wJ!8FKF!F"@ JF8FxKEFBɀ6"r`*y)*""b]HxDbh,V,qh#FD"*"!F(F2ӳ!2;20!*@t! D Dq!rR[BA[""" 2w2+ D!(Ri2 +H3O3*KhOp&``$+2,@I3Bр#+p",,Ѕ,2#@O q wxh2 K(M3FJP!hFP#jFiF hFCF+(`Kh#g K0F9Fh*F"FbCBK B0`X'ьhM'i'X'8uF92F2w@"(Fz#1!KJh<%*!"!0bE3 e 8i'K'-OF}N3h#:+@w8FwKh# 1h@1S ' ,q8F#y* 330B+@: F@cKh $aH(FF@\KO0!F"ZKR##F"!F FCFRK2hO O hPKhKC:3h)F8F0b3a3hO *FFFrpq x)yO)D EKh K FO> 0B"0iC Ѿ?  +#CѾ@!OpOp! (](FXU@@F(~(?z8FM$ Fi'H]'pM'#hM'X'F" LxP2?ИB!Do2J !HHaVM'-OFFF@-]/'yFbOp3F1FF0F3K3IFj"82hhD/K0DIF^IFF0FY(FOp"x *b "vDF a B"y* "I" " "RFHF y| rFJ,!F0F"FG;x33F Ij3FIjRԥ ['c-AFJLFF`1K g` bdP=Fu8QZ@jKF(y!1FF FaOpj>2Fh(@j3h2D)Kh1FFh D1FF F$KAFh*8FOpj2FhDhJDhK1FhF FF"@j+x+FOpjh2D "BF+y+`!d!0F"K' ['X'K-OFh FMFI h*`Jhh `Hhh `JOXhO $O:<1 h#E0FyOOc<1O rOc!F8FF'FF )F ZOrJ@ހ!JU#B@׀{XF=*!)ŀ*€!2)*@𸀕!*@𳀕!*@/BO&b&FFz'2s!"XFJ0*)ѹ "D7F   EѹNЕ!/;FCF*Fơ  "RDʡDE9O q vF(MJU#1qrpRBA OF(0;h 8`,8M*hL##62*hL!;hD BUbА`&4L0ML#*hcCbAFO(FB2"H.6I0F80Khg#d'1F8F(i#aL7E3x2F/+II^"jCbvO0 FJFD;FAq D X3X4jB#X4 x++ bZ XD6Kh*FO{2REs FF#igEE#b# g _AZ g#C H43H4X3LBr0 FCCH43H4E9sBE6K.h0AF@BH]' ['AR,X'qi'AF0F|OqKR0g#(F -O# Kh;+Ob!0O ,81O3/";O $+h54aOsp& WkO Tw!POaU9V!7e'o+[t%k &[m%k(&[kf&[k)&k@&g7;u&+kr&kv!1;+拄kK,h"\,o"\>*#,e"`> #,d>h& ' #rJhF)*oJRhBnJh*7c !P1#<2C#@O34f2i#p # C #wVKhFs H;Ft;p+CC1# DaF FBq =c#L;;cp?hs*F #0+mg/?"- 0RF# 3RFg DG|XFaF"CC 1 gDg)?!- >RF# 3RFDOsAqCC 3 Dhs 0 ai'eL%hF%:+@ԁOba d>!#C 0cg#g##C 0cg#{A#Khp0e#####I #h0b 2JhOFOsOrF$ )F #h**x%hOb!`#L"FCEP3L#"?FO h  &*&;6;6#;87";`,"mI@ KhC #B4+ h"!+ h"!`#h+8'i'pM'3H]'Yi'+ h"!`z#h+8'"'N hJFAF`F` cKOb h`3hMS+hk"h#O rF(+h3KAFh` %(F MH]'i'-OF FtxKyNhFC0hp !FC)sKh,zOa 1hBйzqPF813PFt D7KFeJ!PF  O//*p#F\J!8F FuYI8F:XKFFh02h;FVIrTI *$:FQIRH:FMI 2h FKIr3hII F* 2hGI F::*3h F*:JC>I2h=I F:*"6IO5&E/(ya  JF.ISF  F+y ++ jy F+h'ISCJF3 FBLI I FI I 8FuV H]'i'b'_gpM'wl}p҄ 7OHoh^!  b2 !@QFfK"FIFH Rp L#h3 `KhBJT#hXBXAc`m'0%*FiF(F 0#iFa(O0 ]-O?-FMЂͰ !(F`##! FRK# A #iah+2A3##NREs  ڔ$#4KhF?рI  {  t! #h+P(܁tI J:sKh;rJ! 1D$oKg.wEPFYF`^A 0F9F'`eJA q D{{j&vd.d&3F\KhWK/'-?DhZ?/d!SJqRJRJF?  DDNHRF[F'!Bq /Ж O.FV7sF2F'/'@N# ?JLqZ#DwDhah0t#A1s:k{`<Kg.wA 8۵0F9F`(A {Q `DFF&'J!#Bs5)3а @P1/FFY@.Am'Hm'\m'IXm'l@m'dm'RPm' @22@u*0OCs cH2C3O1C C2COd ( F Fs@0OKA .BRw@2O_A CS)FKJpFJK#*sDmGIug.w,۵'REs #(q  O FSF  ѭ7#`. FJKBD@8  )pB٣FJFAF`0 Hkh+Эh#+з(;hBМ (ۇ0DiF"iF #hhh0H9h+)Э|h#+$(FR #hbh Z`abh`#|+hh#``#`+jc``ki,b3h"h08OrF FBF#F Jr)FOr FoCF#FJ`8me #"pCF/KL"XO5PO6B&B(">PHB.F&+hjhZ`jhh`"#h(F(FuzP- 0Fp ppM"FhF+hBF iF FCF F4F F+hBМp(-O)M MFFF+h4$&F7#`O0[&HFBoIF6ZDFB"F$+hBМ M(-CFiFFF@` n`&bCh``id%@=ѭH7#`h s僧t%i `C``#FahJhh(FO05FCO30FhFFnhtB #jC>"9F0dh  H@ݚ8F K F) F! FX F!7KI F-F F8@ F8FQ ["HP F12#Cs2#!0 F32#"cCII"F#F90""b32!q2bd ##@2C!8@P8.7-pCFF #CS #n[h[hh3j۱0O 32 C)CX  P22AQ20FhpFFVFh;F H@320C9C2t@@42#" C (h0H2## 2#7#Fhnht#jSZ *Qil 3 F3 F0 F30Kh13 F3dh"h L(ѫh"hhnhd#jC!F(FZ0Hodh0ClpFcl+ ݢlC;R#tJcl;cdltB#dll+ "mC;R#t4l;d mt,##emm+ "nC;R#tm;e nt##fPaN(F,51;1t`$Q(aN(F,5(1;(1$t$a,Q0aN(F,5s01;01,t,aPp`N(F,5\0;0t`pF^# FFFVFh#l!F FkX g#'2FC32@02V2@@2)F2# F #@hF ##2C I032##C clKJ FI@+FI?jF;032##CCl3 F %032# B +O F F@-GFPy!42gP$&R;F2#2SN)SFO7\  2#'2 vVISF2#  2g!Pr#C2#"`F2h 2gZ@0PO'3&b2#2g PO&B'#2#2g@PZIO02# 0+"2 P#OJ gP ! P@F*JF2#2# 1P;Ѹ>`>FF6Cmh(=0+CD%0`  HF(FFIFF/1F8D 0B=h`2#C1F26m" $/2#  P*И 0; sFeH+"e"h"9F`m0Gmy'hPm Dq2mB@'-CFj+P0O32gYX  r#CC"C (F AX @ $$$IOX  r#CC"C (FX ($($r#CC"C$ Fp ErCC$ pnhrSC0F $t%UrCC0Fx$t%ErCCvhr#C S"C E$T p p p0#F0! #@C,kH! @@C&nh(FB$( ( cK"kbHmh F$( (ZK)FkZH #"SCUH!(#FQJ! #!@C@B#CHH0EIFHxjBF(M@IBHk FrF;I>H" 03I6H0,I1H!"!-HCF !^!(FZ!(FV(F #BB #"" |0IH)FH\ #!C #(F 0QUo) ›̛dޛF H_ #!0C!@YBr F #@߾7-J-AhF FFnsOrI@!0#H# 0 +F h1FF8H*F1FO0"])F@"p*F1FHpP hpU h:F1Flk F 0BЛf( -CFFFg&'! F "b! CF)F hW F}V0#BB )FH! FC4F#j3 F"#@-CF_MFnF*h F(0+32O X j+NH0 Gb FGbcjAA+&pcj7clZv+ ?Hcj F=ILoO3cdaj F F ! F +hBU F C +hBK F Cl.?cl+< %HH0fdñnI #9F2F: FnB2F8FH! FE#h FlkOI F/! FW F, +hB F C +hBЛP (^?oI-O`O hF5+2#X +AlO1& zHsHFcjAA+"# h!#qKpK! bj hb C#h[n FA( h# n@nF_H72#b C2#" C: # !HF z6QFOFNHJF! FnmEҷm#"HFw9F鐱# !8FWQFZFF?H:F FN F 0  7H 2## 2#2#" C6#j+ F72##BC FV2#"#C F{#j+2# qC"C!!! Fg0 H2#"C #j+ F  F +hBЛ6-(] ǜ֜hF ##2C 032#"#C A! F30 IHy F@ƈQ-OF FhFO ,F FE V(HF#j+'BШE.0 FI322F)F F FBFKF F< F E F 2F)F F Fdh(7F F-(" (Z(^7J8I8H Fe-G FFFlF fKOqeJ:7dK@+bJcHhjѫ#`(FsiB?ܳiS%@,G"# !'  # pl/ """# /tgap"ii,H`ri#F! atahl rFO0YB@#;#hbh Z`2abh`3h33`` ga #""##W#" # ##/Opl+F""Csh#` \``3FhCO c`iC"@3h;3`3i%`c``4aͦ$ #F]𵓰07K@6J7HhCiBۃiS!@4#`O0Vbi#*Phhca&a$"'"F@lgB F8#hbh Z``bh&h'`#iB%0%i#`b``ha:`big: ! g*@lO""  F-O FFF8F JK@JJ2IKOqGJHHhh#GK@!CJiF n g?J6OAEDH6GXXBBCEԿ##Bw###"#`MipihEiSECh#b FS``j8 *ѣbCh`( r*(-igb_EVEiE""VEw "":Zh`B`Zh`X` h"j`B`` bO0ɚ;## I]FFFOzqFF FOzq2J (F;FQC1F(@B0KOqJHhi%Fܱ&h'jBiBiB ghw`bgh5>`jg`<`b4F(FЉ0KOqJHhh#dd-GF0AK@!AJAHhR@lBO^CFDO0g8@@F%F5ki 00-h@qFF(FOO *FEE 4 Z%5CCC !C,CC,%O !OH FU``abij 3 F`a$hF#FBF1F8F^F0FrD F80K@!JHhcdAcc8@`-AFF0K@ 1JHh#'FOkBkkS$0;>+٫Z X P,C@<42FiF 0O0 F(?Ѐir`hhBh Z``Bh`hBhCZ`Bh`rh( "ahBhCZ`Bh`ri( "bhBhCZ`Bh`r`j(b`l F@p0 iF60 'P! rF(F%C_`O3CaFC _aFC_bFC$_b#dO`d0 F0-CF0LK@s1LJLHh#%Fdl*Ujb kGL #gBBBԿ!!Bw!!ɱ0 Z`"b `0Gj0(g0g+:"J6G7gD0l0#h+KF" F`lC ѫ@h+Ы<h@B( *k!l G*Zii*zhiGu&ʚ;FLF F!F pFKFFhF((R,;F2FIH+h:F1F F@cpI]pGQ-AmLFFF#h4CF:FOah0FP IF(F$#hBК m(Q R]pG R]pG R]pG Rg]pG R]pG RK]pG Ru]pG R/]pGK@`  c@K"h1 V#`O0cɿFmF$B+n9FS$4  Fر F F} F! F > F h F@YFC0C F&@D0LF"!hF#h%"" hFr+hjF I`%C0 kb#hBК'0(i𵧰MF"FhF!+h% F0O0$p6" hF>C8#hjF I`$0н0cb %+hBК'(ihD F : F!.dhh< F F0dh"DFB;;+ "$ F  FF(Ux+RF"(F(K "!F0F(B:!0FpFoB!#0##"# "hc3`O0=|;pO30Fkc84"1FK FhBF#x`:+ #x8320[#oB!###"# "V(cO3+c `p uKphFFFȱ $h0Fu0N 0dh,i+ F#` +hBЙp(-OhFFF&,Bh+=ah@F(7hkx++.bi5!ich12HFBF! A+z i+kz+rr0 [5BF[F!HF $h8h~h<`0h iB@h"#` nh Cj@hpGpLF F"!hF#h%r" hF3h HjF I-F%C#hBЙ*&p(i~insF+؀h+ԀYh)Ѐ B h`h`FA``nh,bhh `Y`h`-"j+jBblklB0{ZijlZ0+Yi)}Лl+z:0#Zil+y F F F((F(^(F(X F{@(F (Fs(S0h10 Fb(0+8h1+4(FU(.h10[ FH()F F [Ph1+(F9("l+lB 0 ʱ[h`nYh`Z`he``h`4`KmhWe```4Bp-C4MFF+hFKi +F i +CГdh,-)+FlFQIhF#),!ќh.,/,$)   h4TDEFF h) i`tih1%F!4iD%DE D nh$iBdh#` F0BЙ (FC "I 0O0 -O۰F F!KFOrhY OCqFHU(F}0їH8Fr I$I"F CKJF. 0[x+=h= .hmh!ܺ?/h H! q(F(~qH8FmKYhB^@S% E%% 5E% #"SC %%$lB3m"S$[(lB%$ 4m"S$[4smBsmB%$slBڳl"S$[(sl+B%4  *30F(%0FG(8HGvF"H k@FL0 cb"AF> Os x"fOC0#I0[@񑀻0a *؇*H* 5* *.A**А*'#: +5slAF0F/hAF HF% #$(2I  i; +sl3AF0F (-AF6HF#(0  #= D)=)=(0+ +sl3AF0F(% #!H@@ FFC e F0AFH F Fi3#d FU0#H0#ld3#d%b% F`ded#c`{h``4|`[l@XF+ * **FpGFpGXxCx +? +pGFpG-pC680ñ1O 2EX  ZDӲ80D"38 2Ep-OFFFNF AH y=!F(RF;It*Rx*@MK" xh1 Ѝ x1D . *b,`!"hF\e p,FPF5FBT E,ЪN7#`O0M0*b*в=r*3,"0,O , "',O #p"1F" F[0 P2*Fѝ "!hF( p,"p4 "p4nF ##p0BЙ0?U X(u-O FFF>I"(FF (,6$! (!n 0 n0`S03`C03D04``"%I(FR ,! 0!3o 0so 0C3` C3`@C3`D4`` (F !3n 0 sn0`0`Pp4``-AFFF xk%#+pkppp.; 0pppppD/!FF(:D!p " F###"# "!FH&1F (m'F)F@F|f0HAFO050+'!FKHPO7,)@l"FD0d'5@HO1'2#@ @2#5'2#"B2#ݸ,Ҁ ',! FF7p F^ 8FoF0*HO7#F9F&J'02FAFp@Fp5H!'2#C C2#5'2#B2#451#'pI F5#'pZèS]I F05 #'p]I F(ЩI F(5'pL!FHO7D5'2#"2#95'2#BR2#.6#p1l"F#0!F0яH'Fa5'2#B"2#A 5'2#BR2#5'2#"2#5'2#"b2#5'2#B22#߿,ԇ!FuO5F8!F^H O7 (#(,!F/%F8!FF)HO7k=! FZF0p FFF I FF0FXFG(HO7JFp%0I FFH0FAF0(FpO5)SkSɪ ]u2x%I FF0FEUF(HO7WFpI FF0FEF(HO7@FpI FF0FEuF(HO7)FpI FEI FEE|I F(SzI Fz`yI FvEevI FnEsI FfEpI F^EzmI FVErjI FNE jgI FFE@bdI F>E5ZaI F6E%R^I F. EEuHZI F$ EEe>VI FESI FEE.PI F E%&MI FE%JI FEeGI FEUDI FE!F@HsO7 C!F;H I F O6K+@#6H%u:(չ2H2Fg!F/HGO70FF#p)I F(N FhF(KJSlߑ*59GA # GYR!K^êfoO@ǫGEUF +@;,1 F+F7#pO2##"#F# FEF.t8FFF3F1F0F?F?G?ӥHO7XnF(?63F"FIFF5"o1E(?"0Z gx@3W`',̀HO7%5'0#05I '2#C C2#5'2##32#5zI '2#C C2#5'2###2#, F0!FmHO7h0'5'2#B2#{5'2###2#q,g^I F5H[I F ZI F82#'Bb2#V2#'"b2#N5'2#Cs2#D5'2##c2#:5'2#BCs2#.5'2#CS2#$ܱ5#"F!pCF5H\9' #0`,< O7,HW' 8FhB3&HO7+O 6,"HO7=1 F2#Cs2# #;/! FF6#p!F]BF"!FH6 Pyblsc&FX07[m=F X5Y0 Z0 #B1l*h "ym #+"" вE Eђ Eђ E xBE"1mE3meSe#SCtX TY0kpZ0p[0p#qqy+8F"!'$#+v%/!0FF4#p:F1F 01F(HY"!8F,?$+ x"###"#" FFE(v+? !FHC'#+v,,"8h1E @HO7 0Fo0,$8`Z #a#bcbbWlS-OFFF8F&M4 X09F8(6b.9FH%Dij)Ѹ9FHDZF8QFHFjOxO0@L-CF)I oF'HE3%JO 2g!O2FGa2 !. !01` B !  XX   EQF ,oxFXH o0F)FXF RF  4yI@=f F  $   *F!0FSFXF8XD Bx + +<\+y#n0cn1n f`f$1n(1#o,1co010ff g`g000PIj@jJIMHX ob!jD##$F O[ 'F FC- F sF * ** *#*;*8 \ *" TF!x\(2 "(с#( p!2# +!I fpF  $FZ"8D Bx + +<\+)d1J?Hd $ <"9FXFPF~@<"F F FUmF 40LoKո;F*F!F,H*F!F;F*H8XF8PF4x*F!F"H'!H*F!F o JK!FFH*FJ!FKFH*F%hBЖ2'(ޮ'?^sRF"Cp/CgFCx/gFC/0pGpQK{!JBK|!JHd h&ñh2]zBГAPB ]h e`M`]h,`P`]`+`0#FpƯ F0h#mFhpGF( K! J Hdp0x@(K!JHd@L#hbh Z` bh` nFH"! F FK!J)K!JHdneĐۯ8F(K!JHdZhF!F(F8ۯ͐ K! Jmh+ K!J Hd:0"`C``mhԐpFh opmhBCh k`cgCh`(FopmhBCh k`gCh`(Fp FK!J)K!JHdh$1F$hoZo[$8Ft( FܐF0 KOq J HdmhxXhBh Z`gBh@`gp FF0OK@AOJOHdmjh032##C GK!FGH-F #G($A(l!FxpF([oo-mmB?0X:0Y6mmB2XoZ o[@@@$$ 0B p!F 0ѧh+H)F 0ѧh+H(FD!F 0 H p '6E-C.NFFF3h 1+KOq+J+HdmhxF+й8PhBh Z`gbh F`AFpF(hBh Z`jgbh !`;FJ!F Ffp\FF@"AFJo<`{``g 3hBЖ (T-OF   F_/OH=I= / AF0F EAF0F(O ,|#hczBДA0Bq!FHFT(km!FhpKF(9JP SQF FSmmB@@(єa 2 B` `(  Q`igPF `!FxmmB@@  FK`#hbh+tZ`bh`c``5oF-Mkz,hBЕA0BCkh c`sgkh)FHF`xm0#32# #SR__)FH)F 0 ѧnh+Чjh+H(F0k``P%F9FpKro`roZ`sg!@Fc( K9! J HdjCx+ + &/#`  lw( KO! J HdLCx+ + /#`  lwF(Kc!JHd.Cx++ ۱/#` @h@ h@hKi1Pi@  F l!w(K!JHcCx++ Л/#` @hCXBXA"I0@ Fl3wDF(K!JHcCx++ 뱧/#` ChHPBPAhHhSi9PiCXBXA FFlTw-AFF F1K@UJHcCx+ сy@yF"F8DA03F"F)hxAC1FJ FtC F cwE8 FF KOqJ1K@wJHcTCx;Kx+`xkxB 8 F((F ( 8*x#xB(F(( : *(": *(" ) D8@nw-AGMF+hEK!EJsGx//K sF@h(I(O4 ,=# @;@B5Ч#,cEFxS)# #3+@3ON42EF x2)+~/#`O0$Fl"hF#0!FhFp'iF0F90 K@ J Hc F+hBЖ(luưwhm'-AFCxF++#%p # %p,/#`O0'LFF8F,O4d4!8DFB&v43"UFH5 B M,x8F#+p E KOqJ Hc,p F hm'ްw K@ J1KOqJHc#Cp#p hC`lw KOq J1 K@ J Hc#Cp#;Q+B@+lw-AFh$.FV z0D FmF8`U_8Fj9F0FFDBFH FO0 FFVF(FR D FmFH;FJ!F0F-OFF+m%;So.]=!0FF$C0B+HF[;IFFFF]_*x1FD`1FHFF@hn`4O50BHFfhF4@F!Fm0 H8FnzDFD|`O5(FF-OFFp0FIP;o+> F (5%:I0F耳0F0D<6+*ШI0F(ЦI0FI0FౣI0F踱I0F~萱I0FzhI0Ft%%%%F#h ##BC# #1mhF({ FJ PFm(kQFJz0F8 HFm(W3F{JIFf#h ##BC@ mlF(>oJ!FHFJ mZ (,cl3gIhJ+ F FfKfJ!2 mB(#l!_J$ m2(H0!XJ m"(cj!RJ mF(! FJJ!O FHF#hn 0DPFmFb(RF9IP#h  nhRF HFBO  ADCpD[h <0FIrp'Hd 32##CpbPh I0F^p I0FXH I0FT I0FNpH5 I?%.7-:DMhKXdr}- Ѹ0ñH pbH- F -G;o- F !(ѭHpbHbZj*j*JiZIx(03 F$(F mJ&(sJ!KFP& h$(F(#hnHFc$(F$. lJ)(Á J!3FP) 62## C lJ)( pIS)B p0pFf PFlB)( QFP)^JH0+7nI !OrFKFr?F(0lB#(VR#0LJh`y qS"Orn0KFH3-9Ѹ *!F 0fG'(1Dm6( 0 ,IKE D0&J0N-@/𚀻o+o!F"F(@1Dm(o"FIoAӀDoɱձ-7Ѹ~ *z!F0(1Dm( 0bIBD 3\J00J{-!"FF (@1Dm(i"FMI)-s0Kh13 F 8{o!"FF;o(1Dm\(A{o"F;o6IC4D ;!:#RO3,1Dm81S$X%DF%S%0c4,D"C `/HL+٦T#` Y  Q@,CA@<5 R R6"` F R6&`i:I@H,]"(F_0 Ѧh+1I8H##*I2H ( OrB$I*FF,H# '3hP +i c TCF !H#"F (Fm0IH}-h md=Um^mZ,?Ѯ 6OAIQOld-GF'NFFF3h)F .#Fv+x+F kx+HF4jDDE٦f #`BFQF8F*x* jx*]BF%#IF;T(F +"p FO0 3hBЕz((;x˳#K"qF&F=F; +ѸB0y>02?*&"#`4##p#`  #uCh FYI@qԀhB F!!!!B٥T#`O0 F`F Kn:f*oB² *I͸mQeppGphpp6F F!sB@ p%D  FFH#x+.+I F(I Fz( " I F(2#"cC.! F#p Fp.fyr8F F'- 5 chY9HBch7Hxy.O+@+ѥDFB4!CF:FFED7  pCpDF"z#`,eO0cE #4+p :50;,JQF(FC DDEFZ;' ;;00[0;;00[[ X[ J[ L JFZZFCFQF(F   FMьl-OFFF FF?FK!*FF ?ۺhDTF8FDD F-k&F h!FJ;F;FJ!FCи*F0D 00FlP F-CF#KF,{FFhF#, F)hP F+..Х#`O0 H0s-#0nOb! I0 I JHF . F9F#0BД%(-OFF#jd㹥jչch7"FIF0F#.F(@ #hJH.Bch #izۥ7#%`H HF FPF !!(D D(FkR }H #i)FzJ3#aKF*KFuJ)F"%F#jE^YF@F?F .@0dJfH#hహ.@𯀻00YJ\H#hr0# hF0FBF5 V0DJIH#h;  ,SDj+dлa$OFjED#h 0 #F G  , ,3EhGE_h9*.8F  D D D   G8cjOj( Vl%.F1F(F 6ӳݳ;Fi,'$a+j`B4nj$,'j`B4-A FFiF~0pCOХ#g.wۥ#`0Fk F`F2F@FNC FlR,` (`& D8%@ЊBإ#`O08C% x$MFH"!FhF+h[T ;0hb"!FhFjF5I0F0!F2H0 32!@P "("*CCB jF&I0F ~0!F#Hz032##BC(Or!"!FnI0F^0ѤhV+H9I0FN0ѤhV+ H*[+hBГ](liHWiHнPi Oi hGiGpG8F@!hKh"!h(FO3#`chCc`8pF@h{chCc`p Fk`p!h0Hp@pؓ-GJN@F3hch#Cc`chI#:F(F8#!hB  =I=H(F5(.ٝ@@A CDB!+hn(К=0B"F )xi hB66 B2 F(@,0|ch(F#c`w'0#"F #JF!D #"FAF "#JF 60hCi+G3hBВ(Q-C,OF=@;h@(0[0#0#0Os08+,  )0#"FHF \8- %D8-I"F!@F58- @H0F hD7#`O0;hBВv(j-A3+Fhb#4H"##l@#!F2FCpED@!XP(h%K#"##!K(h! iJ&j.&FV*z#BF3F[k{A 9FH6{{Ci!(F<0 HeAʚ; ɚ;Cjs3h+FCb i Jb#1FcjFH JV#1FcjFHi(FF0 H?+haj J K)ؿF"!#p?v pF`3h3 ICF0` I H(h+FJ!F4h Fpy Q 8Fh0H8@h0h0 Hh#i#b J)FFH F8@-CFh0!HChhnh..0 vhh,ЬB"iiBѣh!bjh*ԿBFJF#FC H Phi J9FFHD$hnb(FC K𵑰hFFFhjF=<#0FjJj:F F Hlj 4J^!FFHb+hBВ(Ͼ0ShC hiBњhBh#` F8 FnhT")F F<i[dh8)F F8@G8pF@F j H pO3FCO`,! jNF(Ѕ`0ha0""`(Fhhb```0H Fp&@hF!h"8F豅h#F"!(h#hbh Z``bh`i FG Fk(F8@88 F@h0Bh F8hF!F F@`KipF0 F㱘hбihhB-- ѣiCi;!G[hG0FppG(0+  pG-A4NFF4H4I'3h)>CFP0I@0Cн0+ѽ 0*HC8!F(FGF(2ѐ""  . I F0 I F0(FFhB9F@ijXha`*#I FB=0 FO0 F)3hBВt*(@qB@lBfB@pB-OFFFsO @;h#;`FhMhPFaiC+C`%a"i h3ScE.F5Fh0``h1DBADXFBqD(F*FO53D#i&Dh&aB;h C;`k(F jFIn]gBpFI h F (@,O1FQ)R ""0F" +hBВ p(0"Fa`-OKF$(0+@  h"I)XFFP"IB=0FB:DH224'$ҲOOH O@ )NHBѣ<7#`#Q)0h#LLC|ppzX` ()0#L L C|@pX` pOP# 0xLLX`FC|pp:D DҲ3"#,2Cp2h(@ !3=0!pOp3hO S`O H2#`O0t #i 6hC * #C FVBѣ7#`.HT=P"O p@#p!rFrO* # #tEtFcaX4DT,$PDL,hwFF3B #2"<#<h2##rC Z0 c` `0a`,!F0/K@Q-J.H_"hc`i#*F!;F0F0 h``#*F;F0F0bh#hc`3#*F ;F0FO3`:#*F;F0F##a;#*F;F0F#ca6#*F;F0Fw#a]kFh+F"!`hih "(FG(=9F<9FF(F K`KCaKai[#3`d3ih(F:(FJ FH O0 ) - -AF@!Fyp0KPj Ѣ$h+y *H୲yCF' ,+j!J !H 4y0Hjy Hb(FF(F,jIH0h ##BC5# #F0 Fp"˿ű.آ#$ `,Fmx` hB٢"#` ,F#;`BhhB9`3,1 F03F2##C $1`K CaH H O0 (V8#FxuxxhiFH*F1F0#cU(F Fp-OͰ[MFWFFYI@FFF+hXK2 ZF1F hFP$1FipF0JH8FjOr;FA8Fj 0iP IF =Hi%6#2F [F h4#2F '[F 4FT 0#'0,037'0' @#*JOq8F, EI%KBF!F#H%I| KBF!F+FHG'Nh N EIh3FBF!FHGI^+FBF!FHGK0B (FMOK0BБM(j-@ oy-GF"M FFU HdPFO, ,51, B#B U,XB 3U,U ,HDFHF6,5%B&F, T ,5T,H0F0F4+-OFFF %F$5LEZҔ ٢ # OTDEҢ"#`O0C#.آ7#B\6 "HyBFJOr@a@F~BF5H RFIFBF0F?(F#o3i aii iB(Fc13(F6CF g HOV+FJO˸??'FMjqy4 QX_- y eP hF ##2C F@0(pF@`4 F F` HI(Fdp@4"  20a(Fp@p-GF@F !hI(h+F"!G0O 32#X $r#C )K F #@y;kl+cik`jH FHe(F"!(F3(h!"+F&bh&`iji`&aifci(Ffadaia#biiX0a3&bfb2 `!2K-OװhFFpU0Cl+w7 2#"sC іKS,23 HEJHnm#R"[AA*s@"#VH##2C3fL#jl#!F`F2FCeEDE!XU`p`cl+ք7 2#"sC iKS|73,JEeOTVZ][:F{kA AF_H7{{nq0! FEF UH Oq F0 NHOv 72#"sC OqhF(lt0˱*ٹh( B  "8JBјx ԛh`#+p(0+kp+є= )p~2##RC hCSйPЀ#kJйG s#a0#A)2C3#K D)?Os+eA(d5w"SacScʚ;ɚ;G(`E2#"sCh`@K5" "D0 8!ʱx 2RE=" 8 PF x28!x2D$ *XDBTѹ йmt0;xԛhB +@2#"0 $00 <Q +@|6# 0<0 J<<0+j @c6#0#0<00 C@F 78#0#0K S BB    й@.#h ##2C~ +@SFP"+" F2##rC +@2#0#00  J<2##bC +@t#  <# < `,1d B.BFBF7x2,lB Q(l Q,, ?|BжԹQ,,::*[EQ,,3,0,1 : F "^ "+6pBH Ov <F33C0O !ZF8F  "zp!OBz"#<o@y FBF"8Fo3F8F?@ Hpn3:I FMCFf+ѡh+KHh12##2#t IHm cQ'h#FXJ  QFgF(2F)F# {rZO3;aOCOCQF8x8F;x"b"b;pxOpj@#;r!x8F;FObx FnF8Fh6(Fh+E h !;SF?? H<h2;+"'#h ##2CI F h#F"!#  HKUhBАJW= (J!^i 0sFP&` h#F"1F35[mSK1F h0#A2#! pCH1FF H s"CK H1F JFF Fp@ Q1J! J!! 8FP +h;+h#FJ!'hjHD F H# F+`#" F#8@8- KJ!Ϲ p PF1FH1Fk*kH h#J+`!#F#"c##032 `!2 Fp@d! J! #PF`6+`hh #`+aʹF F(J 1H#h ##2CV,I Fd@69F F2Fx#h ##2C !H@F9F F!2F9F @(a FL(2F9F F0K@JH]hg  %(ah F F+i$h F@zk8h0h+*iPGN 5FH2##rC Fa#h #"C 2##rC F8@B8-OFKFFFh x* HPHh``EF+h+&+GKFRF H= * )PF>똱0#!PFJF FHCF:F1F FU#j+Ղ 1Kl "<H \"E2B؀@ \#Rh@E3sE5#2F ;F h0#0 32#"sC YH?0 +0"FUH;33FRISIzx+h+u+э3F"FMIO "F##   p B_2F ;F h^(3F"F=I  ѝ0+}љ60X6#2F;F hZ0э3F"F/I3F"F.I/H&1F:F hF@F (H0Fh+h +#h ##2C F I2y hI#!#R"[A=*s<"##(*H rj u O F   0 B_2F ;F h@0+V6R  ѝ0+3i3F"FIH:F1F hmF(F Hk(Fhf| + h;3 3i;3ٍ3F"FI"$ FuFPi'3F"FIHY0#"! F!PF h#F"!! hK"!#80 @*h*@@2ijb jd#c 6#2F<;F h?( h ##2Cљ0 O P#:F1F|(~3F"FmInH+iB hg8FfF`(:F/a1Fh h ##2Ci&gki]I Faid+bh`ka+i.aa#h1FnCf#FQJ!0S0" F`GO O 0+A+DI3F"F8H+Ѝ3F"F>I?H+h+љ0 #:F1FP# h#+`5I3F"F4H 9!2#pCэ3F"F-I,Hh"2#"##+iB hg>8Ff`(!HFJ/a:F1Fhl"@ h#F! F6G0 FH+ u ! i ); LI \ŖiG FHhBЏx*pFF hG"F p@FH *U4"F(Fp@-GmdNF@3h5n#Cfn@l(FOcn?F #h+ RISH(F(l@!HF(Fؠ"#,EҠ7#&,Aѝ 0&d&@d 0$0 @@0@@@EР#` h+ GJ!FF%HNG>!FF H4kjt0˱iBѽ| (F3@,_tn#f G F H%3hBЏ m(ՖQ-C!]2M !R D 2&+hF FHF!`2FO S"! .F##0o"CFH#  &脹"F@FF(0+ HX *F9F F !S3h3hBЏ !] (5Fh!-GFHhFFFU ;nh F0ӱh±nBє= *)PFX )FHKFBF1F F.dh_8FP#Fh"! I Fly"##032##Ccl+ F8@m8sFh`qh+G iB*@. B<ib Fy032##Cі@ !(F"(F!L F(h+F"!(hK"!#~ro0hBѣb FD3h+ F(Fp@jpu  F H032#"sC FZ0H F@Hp F`)FHX F#h #"R#032#"sC F'0H)FJ_ F Fp@pQF h032E%tTRobh0Br#CTI^pGI-OѰF hF7O2#"Ch13 #hH ѠLh0+ ЖIHJrPOq fHO3(`!fg hjP#"!y+`K0Fd###F"v 92##rC0F 68g#81`0fH8(nЖ!2>2#! C9b#C#hnf.8(T6p81"Zp81  #h8n0Yn=`6pf8p)( 81Zp8= 02#!`C*"#C 8*# FAH =*#)t F;H:H6 8H1P q"#h#g2#`+a#C@r#C@'=08a #H F"I4 h#F2F!1 PC  Fh(a+:i" FhKFE2#"sCb(  I cSc(?i@80Fg#`+ah*}$+i F1F#@0ki1F( FFر@Ff.hahBF+ing!ax0Cx0 hzHzhK FBgb#`+a>2#"sC7+k34y6p?F?F '0iEw  sHhg.#`+akb +ckkkckch Fy0SEP-+h+`#"+`6##!2#Cal) UH!C Fr#C hjF FJH Fz0#Ch+0SEo/FW$F F>H"9F F!h ##2Cуi[nhsB :h9)ijRjB[h9F F F h"#Fc!2#!CЕ@ hKr#C hK!0#3 FEˮ2#"sC?î(O0BЎQ cSc=Zv y pOqF fF yO3"f!+F0F(FIciaS+{ 1FJ H( I(Fdp@nHO0p#Q8F@ (F{|ig`ighg8g Fg,hnCh; hҹ[h罹K "tO31g#18F@42#"C00= 0*22@ z2'2&V>N'9C0C2( * * 28N'20C9C23&2wV@22#!Pc"C(FI>$Hh$O#!FF2FCBDD!XTvRJ[{kA  H7{S+(h2F K!7eA ʚ;ɚ; 8FP#Fh! Jmx0S h!io h18@о8 -OFMi@,(coB@ RH #(FcgOI (FO(@iZ@p!62#pCо uz#Cu0+qifci aYcia+`kj2K!(hdl(F2##rCL #(F#`#tcpp!2F "uU Fp(@CO `@@O o@ OpXhH hhBhhB0[hJCh BhF8 Fnh<")F Fdh F8nhc ZhH hhb@h"BhF[hHx0+@o0 pG pG@ "' `iSi xx ёհ JB@O0XBXAO0 FcScK-OhFFnh,8#j dhp/ۀ;h+@׀x0+Ҁ{o3KOqJH\ P"HH-bj  ,hS FDF(0 P 0Cg{ohh@IL-IFzoIF$hA+` ]`03PEO @;Fcj$Q hF(uЈ")F !FHF -h -!F@F0W00' FF(K P#0HL=AF*AF$%yo@1yo`13h+` ]`u`5`n` FO|F0`yoXCX0-h3rh`rhZ`s`? Tcj5h-?kz+E(?@@FȻ7hBAFhxD (,B + ЙB?hpbj0>42"C#D0F0-h 0BrЎx0A<"2@F FH(-?2# CїxC2#@F<" FH FF(?bo P D0CCg>O3$KH=YF5YF@#. Fyo1`#khP0khgp FAi F*H 1D)F CFџh1+Пh+Пh+ Пh+iiJ 1Hi<hiki hhhB#hhhBaiPah Y`Q`bh F`f6MkoB#x0kgF0Fp=Q 0Po3'2EvV %T0! pGpF@ eFH0a``Da(Fp FpJ-OFFFFF9Ha032#"C hP0hhB!< F"IF8FF`4 e`F(Ga%a`% ` aFFrJ F!@F*FBF FHP!F 0 ўh+ I H Fft -##`shc``t` FXpF@,ciK032#SR__Дx0S!(hH$(hl(Fp@!hp@7$"1FLxhjB ijB  (H,(1F(F((<0"Xgx 1F"(F&F0 Hp@i[*co3hcjB(F#!x0fg(h~!(hao(h1#h+ ѡl(F0(hp@&h+p03h#iBapG-O F@H*n# FFHF(yF #`p"9FHF-F-Beй4 e2F(1HO"8ha"`` 0hb```@3hhB0h`8hExF0h9 J F ! aai#a2hhB"hah Q`ch`;h;3!F(FZF!F(F?- FOe0-GF h O ܱi'h.hl  ! RF4CF0F>xq:и #"la0+GJ0A1DcjZB8#cb#jX #bBRF)F:H<#cb#bm7I7J7HF7IFO5JSF F)FGbj#jQ Z)F0H F)F.HX)F,H+H!F 9?F&Hgb&b+mcj#j(Fp#Ibj:C3!mgb#&bCe FO FPFʚ; I RD- -AhF%"#f#,Em>"j  F58h"Fh#FemZ#e&#hbh Z`z`bh F`XԢl*l"m bm#H5C1F 1F FDF(F-ChF F#"#g#,`-&h chs`0ch`-KmLգh032#SR__;-#hbh Z` bh`h"Hh~FhhB Fh032#"SCѸ #C9F 9F@FZ Fm-4F𵇰NF3hnhE0h !0Тl;hS@Bl{hS@B "mhS@BbmhS@B$h Fmh(F3hBЌ((-GFOOF"F F;hXO ! dF(vHeO3Xw0O 3FrFIFH0@R_Е Fo Ѐ. Е .#1F*H.ٝ#`, #*FqF@Fl6b{Cs!H.# |P#.! JF` F H Fe ;hBЌ(ʗ7 FFF"11@4`J)F 0mh@H cm@H"@Bњm0h8FP50K030(I" FX0BуmJ%m!CcCeO3bCbK0! h! h~I F 8# F11 |@0%`ZhB``X`O088y pFF(6PMphQhKY`QhF `eH AF0ffKF"FR &Qh (o*"IF oF o"ˠbi`)F(0&H#(0H")F"H/0")FHȱ0n0[hK")FP > .`n` ˠa!;hBЌ#(im'חߗF"I(0l Fa F!@im'80!F d\"F HFC/`0; (F F8-OF4F08<n*FFdF(P-F(,hD"YFH $h.vБ.TmX#CCeH0+0єI *,uD#H0+ FG #"CeI0+ѣm0 Z`` `0 G@FdR #"C:.#hbhZ`bh F`AJF!F0FJF!F0FO.# FOȹj`#FYFPFFC# bcb(8ˎ##`khc``l`oFPFFhLhBhB$h  c(HO0h```C``` FKAj-GhFF0+@"(0!32#Cil1b#Cѕ(0+ѕ=@,,)"FI0F("FI0F V#p7(FF("!NH@"#(FF(|#0O6 Fb3bH 2##bC"QFHF+FAF Fd\0K0d00(0+1ѕ=0+ѕ)0P0*0Q0+0S`R0#T0,0U0-0V0.0W0+*FR)?eShCedvV#`dP0 Fdj# P0>h Fd^1#`O6I"HHF`6h. m[032##bC3wh`H 1 Fd0#`IF.#` |R{h&`1F Fc``|`G (F!(hQ&0F0BЌB( -OFF 0 hpHˆ F)#V#T# @F# 3+$O ( "VIPF*FRP?;bSh{bh"MIPF #`| j#C #C0n0hH"1F(#` Fd ##`{hc``|` F 0BЌdim'm (`hF H 1iF ^iF FiF4Hm0F'030+сhH 1iF 4iF FF H00 F:%8(F0.h-O ĐFFO0[hh,{m2tgj/q" XF(iѺѣkk;D+`d3\Fem#ekj!h#ijhV Cg gA2GsFF#a#BAkjcbk`b#)jhV Cg g+2GsgFBFw+jk#b8 b8kjCFch[hhDF F8 F0hdmH@O)F FR$h80Kh;m BBepG0-OFh O ̱m'h[.hH4,lCF!RF0F%(CMb1 hpFhFF!"h"!h#Fy^#hbh Z`h hJ`bh`)F|"5ldp Fp@DpG!pFo&m*Z"HhomC@em[ԩhH 1!&$hhI032#"C@$\&h0ѫhp@hؾ pnF#0 hH 1#ࣹh H 1#0!hhhI@QC]p-O`ax&xBҜ6#` p``$1!(B hhB`1,3,Рp-OF `2h# FF!! 00B@l@,[#`PCKBDE0AXU#BBBBqژ@ rHO ql@)am nU2C3 eP \BB B Bs# $$|P'-z)j)uJr#(lRPICBD@2CXPcEZEB!!ZEs !!1mթh`?H 1 )F S0 ќZh1+МTh+6H#kb+bO m#He' c G nW2C3 g[  YcEZE BZEs # '-h4/:F!@FO #C C0h!K!0h I0F0F ɚ;\3 K!-O=˰h 29r 4@%`FJ*F0FO O3 0*JF!$"# @DBFјH.#! {.!H_ XFF(j+@ԃ0"32 Cȃzx*@;x+<Ј+@.! H )H!-K.#- !Fh{FX0+!BF rHi1h,𑃣hB"1F P([$h.hH!| +!FdH#z+cz+!_H@!Pd"!(F(\ p"(FAF0! RHwL1hdhB"AF (9$h! cF(CEH0$!CH):Ԕ0!BF =Hc#!0(h9I(F/@ n+ ! FH#mB2F9Fl(RlcV##e#J `ˎ."!^#F"C|/0#F#m+@Ȃ0FbdPH>˂ Fc(2F9F`&eK(l 0j~QI K HAFGX F{ynh0[f+"AFHh8nKB g##gh(0b`g`n# 00OA(Fo+mBeh|JM|K)FJ;++AFtHpx2x rHAFBAFnH0!@G07ɲ?x9B$#(QBhB3,1hAF^HAF]HC03xBl*U*a*f(AFVHF-Ǟxx+LHAFGH1ˇ;x++{x+AFBHpF PF B AF!3hBЊ#(D t-G FRHP]! bFLH513O:"HI CF #O "G$=)!;F0+;F%")!0FO t0 '!:FOs":!0Fb0 $")!0FV00F aCF$J1F\`0hb#s`=0#3C 3s`qh b(0`#p=00h#) 0<=03C3<= +h+?tOzs F`#` Ř0 Fh+F"!q032#"cC(F3@#H"##d!O#!FF2FCBDD!XTvMJ[{kA   H7{S+(h2F K!EeAʚ;ɚ;= KS,"33BFpGpG@pG7FF FF-؛Z#` "F=R Bӽ@BC-<#F0Fp-O`؛,# h` hBٛ"#` `#3`,0BhhB1`3,1  F-AİPF?OF5;hoCto#$BP3 32D"![CF Є?/H  L"F$.GРOS0ZIs0`o(FLp`ooO 6E%6 9 #+FV,VxV,FDb# 03f C;hBЊD( @HO10;mYbBBbeh(-G FF;KF*:LhF:K` FF(FkF "GFlV0+ 0HJ Fl = ($KmF"J !RWFXa`FHRF!F:F# 0l1B3hHI+ FFK HG8FblQO0 0BЊ ( -# CؘXL I l-O*F&Kh؛#`O00 08m\Ceh F+@{h 6,BF6B қ# `HE_63o4D (F4((FO E ٛ`# `H < #BF1FXFB O :6@\0 # EX B"YF B б  +h ##BC  #! FcHv/FB #! FTHV#FD#F!(F2F0ƀ4+@𦀭pO 2"!F0Fm(20 +  ؚ# `8H_Fh3SsE2FFAFFFO, 0O,1,3IE.t p"B S, Z@B2S(, S,, @0xB721,37;!| 39133D#F+hnL04+  ,+h01Eӽ2Z2203 'KUhBGЉ1#ZF!O O +"Oc2 00F 'D +h,,X, C3xЀ000$;20320W(-O'-:FKF@F!h d3hHF#0B30Kˈ("#n!) cn :F! H#kl+"!(Fp0$C0+00s#h+є0+є0++jKˇgK'n8xx x{xF`HZjk0 32#aP#bjjjOL QHXCc bPH!jB #WCLKx D#bJKj+ #b#jAO OCI B"bK9ID!b c+k  {7F{(kձHH,IFOzw FKqLA ' {Q LOzr#FK#'j/c/F'bF72C3# K-Y@@@(t6CWʚ;ɚ;6eN@BwDC IB'bI#K;D#bZ P#E{JOzw##b L6A ' {Q LR#OzrF~Kպk +#bڝK:I;KK 'bBݒK I ;D#bkl튋+"'n 8x3FLzk{A AFH6{{xx{xKFLzk{A 6{@{tKOasJtHVjk'3Fb!$8Fkl+ "an n<F(_н,0+КR#`V̀ 8  IF,0; ;#aFF )2J3#FK D$yFId!# 3OrCyBEOs @FFOp4# ;"$Fع"V)(# )#*.#+$#) B CH O0C"0 IHkj2bnk B&3F!a #eAɚ;6e@Bʚ;yl. H &0FK3hBЈ5(I0 I0 I0 FH9F&@#"(h!#`b# ##bc#+F2F oa&gfg(F)0:FIH@(F@QI!1 7FP+oS032## C H ! "#b+`#! hb#Fc F0  I H0@ F hK "!#B0<Q9 Ia1 I]1 IY1 8F@\#h;+'h+FJ!K# #`!# Op!b(Fbc0 IH8@K(F8@$81 QpFh+F!J @1F#h+HH# "#`(F#bcb# #Or##P02FIHp@ (Fp@0 ^͙Q-C8NF F"7I 3h CFN # "OqG$=#;FJ0@O !JF#0B#0H X h3ScErF–Fѫhi " F0#$")!# F;F0 Х@+FJ!F H F4дO0 F 3hBЈ (0@ ߙ-GF@F mhOO! FH G#h"h! +(h+F!A#h; +:@FLR h1Kh1h1Kh1 "ao oj0+ЈKh0Os0#0O300rh1yKh1h1wKh1h1uKh1h1sKh1h1qKh10S` Om 1j B`IFeHF6h  _H``0{0Z :Gkg{'{{$z00^:@kg{'{{%zIKh1  AF:#h ;+ # F+80AFZ2ؘE4[#00Z2ؙB4[#00Z2ؙB[ 032#"sCO3003 032#"sC(F&0390#020{#0+??I  QA"h *#@A_ Ѡo`#ogcogn#gncg#ff)h ##2CЗI(F<#h OO+ +## #`S3#hIN+ F3F!(#{ S3 ؂K!(h#l P|K(h yKO2(h#!TO `.?mX3j 3h`iH 1?$Ch`dH 1PmQ ճh"$F h3FN3hqh Y`qh `S0F 0FVF#h  +1FMH011F0HHG1FGHGFHF1FG!(h!(h*@1F>H:F@a8FOrAF7Hbo!o8F2p@,8m  *$hZ"HhmC@em[1F$H,h! #0C12!pC2#C!h(F(hk )1 1 U2 YD 0 J_y8FP*o+hZ 22!P+;"+F F # #+`+h++ F8@d8 FH F@ FHs F@  FHe F@>-OFPFFF +n H x + +h++ѲH #"9F0FV0BF H,1, #,01BAY,,   C3x B #9F0F)0CF HhY,,  `C3x B#9F0F @ HCFhd , 3XFFл 𩀻@C+h;+*** ;F"1F F#:F1FCF F0@ F+H0Z@#"9F0F(#:F1FCF F+h0+ +y#+`v+h+v R"9F0F0+hFMK <FB #HH#PkeFEHN S"9F0Fs0+h9K <FB #6H#XeF2H3#:F1FCF F{0Ѩ :CFF )H0F[F $H3xJF H nB ٨n`8F_fHy:F1Fnf3x+k+h+h0Fm@A@1hbDQ'A[u3BF "HFCF`2 H~ h ##2C)#FJ!}0" !`"bb "cJ  !d F0  I H{ FBFIF F0 9 Q-O=wN 2 \ 2  3hO(O F FHF`!.BFO30ZF! 4F #(, 8 " ?FZH!.# 2Fw1FSH h*F 8FLF( "AF F(H nBynLF 2F BH "AF F0?H 2Fa#x + 2F:Hnh-T0;n+CF"F1F(Fwmha n`xZxBѠxxBxxB nbxhx`nPEѐExpEh  H=FNCF"F1F(F>q nxxIxH 7 33h0BЇ =/(&Ff!hFh8F FP"0- h!8@C8-CF@F \H\Kpzп WH:F8F!CF08F>O0O o#I=`IF8Fz#g`g8F$coO6X+h ##BCjє(i.f AF| zvFH?F #0gc(F ##!obo&A0Z=Д *9ИF#O gEy-032#"sC" H\&!(FE o`##gcg+h ##BC є03j 0F+˿p=-CFhP 13 ##2C!dBF  3FJC B32B~I&<˱|B1,Cp:C 13xC32##"CH\cTh+H\B FTC2"TOpO3&0>`0 5\vE-ҭmU+*~:h*h*i jiڱ+Oc F *~"8x+h00#`0C``6#O FFsE Юm f3.! #h O 8X N)K20#CE! FSC јh+:"I#H30 "! `"b!b  !c)FHI F0*FIHCf F hK "!#  FC;@ ,TQd: A" pFh #F J!)FH<032#"sC ` Fv! FI F_032##BC F Fp@)FHp@0 %>-GF,Q FF&,5O, 01, B#B XU,,B 3U,U ,HFHF6,5%B&F, T ,5T,HF0Fh2003mH*h pG pG0p FF p@,2F)F F$h FpFnFh0 mh@,:F1F F$h(F F pGpF)^?] ]]]?h+U(F~Q032#"#CFh*$ +@!)A032#"#C6Oq _`Oab###F"C/0&"`!la+F0"1F(FP H*FI(F(F pO0ppA 0k"l!h++ѼpG F!-CF0FFh#32g g +F"!@,y!h)##`7>#C9 )7kl+0).),)|# #`!# b !b(Fcd0 4I5HC(F0+Y"`(F.ICbAF(F#o_hbo#og"g"gbgЃWV__I(FEIFo_J n_Fn_D F_@#0,hn3h+ [h煹 K " ZO3 1wQ"F?0FS H FI@-Fh#FJ!0;@$ F$hA (-GF FFh!ыm+j+(h ##2C`62g&'V03Ѭ09KF"F@F1G-OFFFF++ؘ#`K0(M,aO O, 01 `E  0O O, 3o0 `3[oE  O ,&0 E  @F PF^([HaO0CFYJQF#$;2t2 ++;Z 2BF2Ҙ~#`}0F0@@" @ao hB0hB1,6+Ѹ )F F FO hB ,a"0B1hB2,6疱(h9FK  D(h9F3 K D f_ F OqF _FH&F'"C!0#F0F39F F?0 #{ 2FIHyI Fh@O0QpFM8(h_N (`h`ph`0^(`0 #`O0p#`Kh#x4;#x:+bF;+^1`v\+x310[:+,FpFpxm'upF :(N(F?KB++@,:*ф:,p#FBBxC@*F pFp:*pK`pGc0FFK0x|+:+#KBЪB T;;:+|+"FF0O00-O4MF\4 + 빵L&hֱX0Fdh`^NF(s41F,D3c\4O`^:F(_c#S (b#"PF#n "On # 0 '>FF,FKEObAFPFL PFWИh(F_D`F 0  + /.#F;FBb'FF痹:+^4F&\+ + + &7F&F':+&F'#pbB (F iTIF_P(F_+рPF, F.܀O:#Otrp+b+x+#+X(F(y4IKh((F#="FI(FxF3*:*O2pF\4  3 SF  FA PF(F_8F(G0F:#=#F :( FCD<:+ F:#0 E(Fd _v_Dg9F_H(F_dPF /DDDF 1F\D8FBFHF _Fxuxm'clPFl aK`B(F^H(F_* #`oF` o (F_O0&pO:&pF& 4M# FO3@]Lh#` a``axm'-C iM#FF+i)aheL##ibIh`(]I F ((h00UK"`IhQFع O0@,ыT0 @ \h, F"D,+#xD L2 @:)#) 2<\+#ka<\+0K"Zao,L hO 8?c:+ш0#0\+;hQ먻h@,zFK@`o AF/ |*"pO32F8FlF+):*+`D  xm'd<u8F F )F F8@-GF="F(d ^F8F 'd O:O B #`T+:pF8k#x:+ (O;4kv+^+cx:++4M\+Jcx:++У0*4#+tE06"x0:*1E+%B+C+#%N+R+F+f+c+e+b+r+ t+n+# # # # p4 p1 0F d^@ Fd 0F^00F_\oF.` FO0F="9Fгd ^=Fd# #`&J;Fp8F/A:*+O5p  Fd^8DFd# F^( F_oF4`(FO0pF#"Xx0+ CxX+00!! !8$/0޲ . ٢a+آWA+آ7B4,` pO0p#L`h#`s IH``0 m'?I<-OFGMFFJzDNOajhJpk7F(,z# F3`v !JpX퐹xhCh;C`+ڋ (0hZ`x +  0IKXFU(<AF('IXFU%I,XFU( "n(x+0$сE+K"FGt47x,(Ѣ p3C,"т 3pC, (* FB "`m'm' KZhF"h* D(FFW Hm't'F0K 8Gm' 8%L`h%`e`8m'8F KhF)*F %F%87 8H8m't'8+FO*`0Ȅ ,`8 88F KhF*)F F%87 8H8m't'-OFhFFF-ȿO ̿$O4e0Eh;S(IF(ѪERF*FBV 0E0EF*  O4d F pG pGpGpG pG pG#L`h#`s IH``0 t'?IG-OFLF0FFF @F k8.@JK"0F` !@F똹Ch;C`+ڋ< (0hZ`x +0"!(FD8I FUT(`.'9FJ(2I FUH0Ih` FUB( "n(x+Ѩ`E%I FU.( "m(x+` FIUa(I FU(I FU(I FUa(?|I FU(b(?t I FUhb(?l:!J(e t'KZhF"h*,( LOcFF08 0t'u'-AFKFFFZhFR"hr3FFFF( #+ +`.` t'FK 8Dt' 8%L`h%`e`8t'-CFFFF HhFA CF"F F%84d =` F t'JOc0 ]u'-CFFFF I hFB CF!F F%84d =` F t'JOc0 ]u'HpGcHpGc9 x` x pGFpGp pGp pGpGpGpGpG#B\ 3FpG pG-AFhFF$CF"14B F# hT#!3B"pFKhpGs7 I K(F F,x, FFh!#F*FIH:0R/Zp(9 xH+ pG pGHpGLcKhB=KhS HpGPdsKhB=KhS HpG<4jpGpG pG F H I FNxH4h IFHI mH@p R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGFxpGpG pG pGpGpG pGpG pGpG8#F`HxF%` 8OqWN( 8L((K7FxF5,`( 0L((Fhx[x@(/! F0  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!H~HH y' (  pG pG -L,M P0 `Upa g? d@@  YXUQ 0WV3* 7#hp 0 0  U`p(  d 0 0K 0P @ 0! 0CK0@[ (K 0L `0 L (Kd@ 㘙\(\, -LQM@ \00 `VR ``m KЫ r 0L00a-00 KЫ`vpR `LQ 0 r`00J p-LM0@`0KPK"PK+PK  BfH\ rPK 1 x *h % P @  ( 5^Yl QPKB >%H QPK     t _KpL <     >Kp PK QPK QKphPKȅpLDĄl|<TЃh\P,  -`QLM00R,PKȄ000@$p0% 48 0<0 40@0 40D0 SP 0S nSl a0CSpVnmBkjihgfedce&`_^\8 =WPY T000V000 ,WPbY T070V070x WP4Y T000V0008  WP#Y,T000V000 VP&Yd T080V0800oS| VP (K VPYV000T000jP VPY7 0 VP  VP  VPaYM T080V080D< VPi @ VP D VPNY< T000V000*V080T080!V000T000V000T000V070T0700 (KV080T080V000T000l OVP gT HVP `܂@0X 0 (~(~ -LP@P@`Md < `  \ X t@ p@ l@ h@ 6$ K`K0 @3@0tKp- TpK  $p@ Ip@  dKp@`X p#XpX PXP$KX00$K@ -LpŸ1M M1MK \ @D` PDd, h< 08"Ƞ p`+ F.K BDp" BK4H A08\ d,@R` 0 X< X<h,R X< $X< R gH@(Kh.K1K;@D B@AvT<SH 0p ,1 0X< a00ppH,K`Kp@ T  K000K0Q -L M@ P0L 0  P03*KLW? 0 yy -L@@`v0 KPP0P p``0`0W`p 0&p` pp`0p0WpW``W 00  p-@PCMLMD /P0 @@yp`1 B^K PEk@W004 t2 0KE@!0 0 4DEJ04S VS440 S @KpA^K PE^p@@lW04@0$00 R @`W040 p-MQL MP@4S3 TO /|PJ QP0s4 ATP)papQ `0P&pH 0@@N0 QP=  p6 Kp_p04@0s%i/@@00p +NA^K PEp @V0#S;p@ V00V@PVPHP LaT -Lx` -LP@K@MK\K&KP. H0j jB0dKF/E!bBAD@d_P H00Ⓠ/I!b !L0b@T_2$&K (P KbR r(~`V p$K 6-LƟMp @P `0 @xX+CQ  f@S` (S0 PC (P )PE 0P(K0 - C/o"0R  P001 0 P 0 0 00 R0 x X 1 P(K- C/o" R0  r0 P(KP@K-K00  .S R P* @0[S  00000SRP00TRP @RP00RP FQPp P+ pb2`0#mMP 0S W RP |rbp``V RP k=0[.S0p=0K0RP ] rpB~0`S ~RP Lq`pG~`Z  lRPP@ 0sS ap`RnpQ YRPXa p `GnpQ JRP ?0[S@[  `P`rnpPQ 0RPs0 0AK 0S .S0 Q0Ap`P`pPQ RPq\h,\ ؁h<<$;@;::L:9 -LP@U 7U P7UP!`0`fqFqP `Ap P E0q1 pP 02P? /-0L@MKK pK P@ @  @ @ 0p@ l@ 0 @h@ d@ `@ \@ p, l0`` Hph0 \ @4?4/00 ,? @ 0 0 p P 张 嬐 QG0S?.1 $AT j@T. 0=S j0S'0S 000hlj\0吀p嬐 !$!R\ UA H" R P0CL:`)r`'r(K1H"P0A 0^U0e\@0Ӄ1 \@ 00(K1QP$zt GDC"LA-vkd[TC,9@[ 0%HL0AS!D+S R00 00S Q 0$ 0h0h0AD QChP ?\@ `0h S(K\ 0S `51Q+ 0Tod0U@*h (K`\  0S=ڐ0S 00 jQHRgA H"Phd0Q*˟P (K@\Uh g`\  00C0 00 l`%p hP\@ $0S‚ "x}( ,0 (0 ,0r$0SnD"xh?0 Q\0 d0h  S᐀ p 嬐 30\ h0 @ (Kg`\ 0P0 Yl00 >$Q:  0 0x"  nK`Vp 0'%$0S!    #x0 0 0"  mK$0S    #x0 0 0"  mK0$' r0' D%D#P0 0 ġñ  ı̡&#̡ % D#!D%!D# & D% #!D# D% r0&!D& D r0% r0#"DdR&!D% #!D% # D ! 0 D! 0 ! D# #| #vD`c 0DDhMd 0`p   (Ό   lK`V pM`Vp 0#MD`c 0DhqMd 0`p`p  &Ό   ԌKX`MX 0#& DS R S RQ $ 0h$% h$ 0$% 0S ! 0!#D$"D$!Dh%0`H`LX\0AS"Dh$$0S"x 000 ,00,0( ,0 ( 0,0(0S  R $ R gpV d 0`pL#d 0Ld 0L%'0L 0$%LQ Dh$%DdRl 0&$D%#D#"D$!D$ %q XK|K'KfP D Hv.L P?& ?% ?# ?T$X ?%0 \@000#H$0SD"x= $00$08  00 03 0000 -00 * (00(0%p h p hkl`dP 0(0, 0$0 %0h0 0$DQ P\ 0S R00 00Pal,lllkk|hgfd 0`pL딀d 0 L$'0& 0%# 0$$%u` -LMP P0(2 PU00 X gK`}K 31C``@P` 0K v> 0c ?& ?% ?# 0 1 41 0| $$%x t p PLtQIp1SFʄ!RC|1S@  R 1S& "0# R0FRYdRl 0&01 CP$KP`rK F80 X, ,2 H04Qc`@02 4 vND8 @D O?K4 0SA R?  UQ $UP PW,2VPQ 1 } P ?K 0QPb  0 0" P0K?K82S 1T1"R1,"R1U10"R14"RK0 QPx QQ-X2% 0!E>C4" 2 @0 K'@``p Q`x0S Og_K0?K E&?KK@  0 x Q0|1S qW O?K("@0 (K82S S01  ?KrKK P9  0v  L`J 0, vnL `Fa JS! R R) 00Q1 WO 0 Q`Pp  0Ew0 Q`PpAO0Sa`p:O0S 㟆x4d./2bcfV0, ./ Π3bc?o2O0  (KO#00O0S0K 0x 7x/K`Q`1 !A !A `V/K`W}.0?KK .R0 01 _6}K0@2 @PgKR`N0HN?KoK@ rKЁp P9  0 XJ@ᒌ) T0"@T͠ @P,5# 0K0 QP ?K 0K KPN0S ͠ @,5#N0SꟆ 0-L@aB ٺp0-*'T0[0T00 R PQ R  /  gg\00DP H0  " /0P/ /p@g4gH00 P/A>  " /0P/| @- @TP E.   P K -LM 0KK #  K?  P K <-LM K00"KHP Kb00 P,0 00 /0 T;4 0-LPCU@ 3K,,0 ? P5/08a 0-LPU@ K,,0 ? P5/0a 0-L@P 00003/0|a 0-LN@P 00003/00Xa 0-LPdU?o@20S 0 003/0 a -LP@QfTUP`Q$ 0 @4/X` 0-LPfU?o@20S 0 003/0t` -LP`E@PJ,,0  @Kh/@` 0-LP@P 0 0 003/0@` --LM  op@ K 0003/K_ 0-LYp@ 00003/0\_ -L MԀ@P (0K`0p@w=(0S %J@(0 ` ,`@:62.*&" x/p/h/`/X/P/H/@/8/0/(/ /////////////////////^6^^^^^x^d^L^8^(^^]]]]]]]p]\]L]8](]]]\\\\5 -LDMp@` WPP00 S S S 1I0 (K>080 X `F 8 P V0F @@ 0 W S R-W p< 0D <L 4 H 0 W pGw pP W p WW  4 <R  V>00ą@X0000 0(K  PP' \< DLPP a0b @V> ̅V Ԁp08 0dW0 0 @V@< ̇<Q2 p40<PQLPDV D ą@LP pP W X+ 0Q(\DLP a0b @V> ̅V 0 8 d40 40Y0 @  < <p4 `0 Vpą@pP W< , 4 P0 V pą @X;080 L;080 X 0T P K<< 4 0` Z% :Jp,Q]= l1 L> XP Y0TPPP a00b X  Q@> Ʌ\ p08 0 du<00 0@Q@<ɇXQpg 0 D A paH H`L l>gH` `pDp\p D D LXpp6̠6D K@ PWdKp`fK5 Y0X TPPP a00b @Q> Ʌ\ p08 0 d<00 0@Q@<ɇXQXd\ 0`PQ0` ,\04<\PPPT T 0Pą@PP FZF H0`P pPW0 X Y~QTPP `0b @V> V 0 8 00 d00< Z0@c0 V p p@PWX0` p00S=0@0D&K 008 gP0 0\Q@X# 2Z6,X 4 HQY0TPP` a00b ` Q@> Ʌ\ p08 0 ds< V0@p00S=00ą@0 Vpą@r0` < X <4 =Z HP0`Xp )Y-QTPPp `0b @V> V 0 8 00 d200< W0@0 Vą@pPZq X0 Vą@<Xp 0` < 4 740<PQPPT T 0Qą@PP H0`P PZ0 X4 Y2QTPPp `p0b @V> V 0 8 00 d00< W0@0 V@PZ0` ,X 4 0 Vą@0` < X <4 0` Xp 0` PX ,4 X. HQ+Y0TPp a00b X  Q@> Ʌ\ P08 0 dX< P0@Z00 QX=ą@00 QX =@DX < ,4 HQ.Y0T PP a00b X  Q@> Ʌ\ p08 0 d@X< P0@00 Q#,4 @U00 Q#,X @4 H<< 4 ,X4 ?<\$Y Y 00-LM@0@$K0 p-L M@`P 0  4/Kp -pRLMP@`  Y1`P,/ua`P d0P  p" 0(K0S 0  PpE0S 0(KȠ E0S 0` P  00`  PpD0SD 0 D 0 <ILP$8LL -L M@ ~K!y #-@Lpᓯp` 0/S /iP g0P S 0 S ]0 = -L@AKJMp @`P* /hKKAPְp 4: SU | 0f`PP KP 0 KqD@O00@jD@00JI -LPAKJMp @`P8 /h@P 0rSKKA┰p) 4: S T 0f`@@ K0rS 5DP00KP 0 K%DPO00PDP00I -LM 0KK #   K  P K80Q 0 080/ -pRLP@` %pT p-L M|0@P`S  I|=4Kp( 00 ౼P0|X -000-0LM  0 K< --L M  K -- LMI4 P(0  0 K 0--LM@HP  KQ0 00-L t 88@ 8 080880088  00<J 808800,`X/ 00-L@@00S x00p0 X d PP P00 ?,<00006P0tD<0 8 00-L00 @x?P80@0800 0-L@k?P80@0800 0-ML   K 0-ML   K -LPpQ>mM0`1  ?P >[K!K͌V ?PH>QK!K͌U ?P>K!F͌(T ?P=GK!F͌(Y ?Pt=K!C͌  0S ?Pa(=K!B͌80S ?P=<|K!̌X |?PPa ,p-1P㘑x!  A10bpaFP  p__W, 00000U e? PX"BP0wsL<11 >,`0 1P0`1 2C 0P%]UQ @0E1 10x1 Qr R| QEࠑpሡ0 P  `_V|1,0 x\?  tp PHQB  D8,00x=p1 ,00P P0?3300wsp1Sz!B,0ADa1P , 1 SH0P?33 @0fD,00x=p(K輑|1S% 1SQ,0q0` , UH0 ?33` I0DpG,00  xo=p 1PS1!01 S 01 =t0 1 0P0|1 @=01 P x! =L0 1 0P01 P=q0e1 P0P01 =P``0f1  R001  T|"!B!  崑21Cp1 =1 V" ,pPpA0 0P  p6^W,p000000 U e?- P @V1!Rp!p0 p! 1 TK P @ 0\|K P @ 0\ PK @P   0UK @   0YuGK P@   0TSK `P   0U1QK p`   0V[K 0@p1 pAp  0\@!,0A10:|q1W|,0BAD0P , 1 WH0P?33 @0jDp,00x@<ph?xq^  Y?K|1 0㈡ p@1W|1|1 / ! Yp!P@?\ 1OK ȁ `@1V11 1 1 X`PW @0刡0 @ȁ8!10b!1 S0x!1 Rx"p !Bม2! 1C1 1q=1 01 V( p1PA,0  P  \Xp1, 0   U e? P @V1!R!0 ! 1 ?Q E/K!  q ؑ p`PV11  dXP`0q Pؑ?#Q  X K0㴁 Q Pء @ ` Tq @8XP2 00RX |1S' |1,P=p1 0 B AD0 1P0 PB\U,P0000  0Y i?3=0|1 S11 S) B1,P AD p=p1 00 1P0 P\U,P0000  0Y?3=0s t1 @pGSx1S+ 1P,qx1=p1 0BAD0 1P0P `[V,0   0  0Ul e?3=0x1PS1P1S-1B,`ADq1`=p1 00 1P0 `[V,0`   0  0U?3 =0[ t1 @IS *111Z1?3pQ00 K|q 刡 p`P`TWP 0V0000000 Pሡ|qex?3pX00tK| `pP@`/WP 0V0000000P p|rP?3pQ00L K0x |q pအ `P@@WPt T@` Px倡|qxp?3pW00`KVPR 0X 0 000000 8 00R80000SV `@ ᴁQء -LC[Mp@p Pt3[/Kx! ?K͌lal (3Q/Kt! ?spK͌DpDq 2G/K|! ?SPF͌(qPQ 02PK ?c`F͌(p`` u82`K?spC͌ ̀pp  0h1pK ?B͌8褠ᤀ Z1|K?̌| | 0MH1TK ?B͌T@ T |1 t!px`pPy(K[?Kx1 !b Q?Kt1 n G?K|1 0{ PK  `K  0 pK  |K 0 TK t p-LPML`@ 00  P`@ Kp p-LPML`@ 00  P`@ KpXX0T 0 H D R #@ R$ 00?H/,L0 D D 0 R #@ R 00?H/, <1-L4 00S7 #@ R 1#@00 ?30DRH0P+ H0Xl@c@`hpT,010^  \ 0 T# pW?SPHP0$0000?30D, 0 00P P0 H-?30Q ,@  Q0D, -L M0`\S (K[8Px@V8P#T? p@00 RPp@P0U0 T0 TP W@0 @p@px0pD0T PX@Ud0 ?3 R #@ R<   0?33H0TpP @xp4,0 000 -S`L@P` 7P`0 ?3Q @Q8   0H0s ,0 00 0 H@-?00S t@03@ 0 S00x0 DS  R  0S ,0 00(P 0-LP S@0S@0T0 0 0 /ᐗ 2-LB$MP@040 0S00 | t0`p:h"h8 \\ƒTTrH LLŸ`b @`< `4"b `b0`0 00$0 0D0 0T00X00\0 0`00h0 0i010p@0 jp4`z2P ``8`0H0b`<0b`$`2`j`T04` D`h0iX`0`\```@04 [ 1 0 %  0 0 W0(K耐倀p `x8` `t|0H` ``h <`  D P0H0D0 @00@0 d48 $ -PlrLM`p  U@P @2Z 0#`` b"" bbdbhb``c ````ccc#`SPV c pQ )p|L 0p RR `b0` ``#'P: `0` `'P/ 4p+ "p' ``0 'P  J%NHr000S :3S $K|$VV$Kh0Sj,Pj@L -jL$@|}JVV,P, P00 T  KhV \1-LT M` + PNO0 S:< >|:^0vp!0#0 'R0111-0_1111|0o1*0!1f0㄁1 Q 81 Q 0S KQ 40 0>h0 U  K(0h$ 00A  S/, <5-L4 M pPk@`+(@{0p0,0(TZ5P. 3kP4!&,@-0.@@*+0@`af@@@ghi@@@jkl@@@mnq@@@@ p <8H0υƅDž8DžDžυυost@@@uvw@@@x~p@@@ryz@@@{|}@@@% 3$`1P5,(245x2523e1d2`2=h@303:|Q R 21@ (  R \(KQ 1 0=1o{hI @@ \  0(PU(`00(K>J<|^yvv8#s:p0'm#j #gH#dp-a-^`_[|XoUpRrOyLzI{F@|Ch}@y$j0h0h 0A-_p `@  @0\(pW(P 8-L,M4  0 0'8  < 7'0P0 0 D Jmp`7儂0H0 70L0 Q00SA  p Lp PP} p:0Q Q Q00S80SW50@Pb  $`00R5 04 0 $ ?>  0c 4S4X &6 0(Kp PP? 4t&P 40 /.000b40P ?!PQ&0 ;0u TQPaPaU 0 4 ;0fp@ @0SH4 @ @ P?>PP0c4 4$R\0L%0 0(KS0 ,5%!E0"` pc 0@P0 8 m @ pV 0 i4 4PT0 ;T0 np{ P p 44 00 $ ?000a 444 P?Π  0l4S0l#0 e00S80. S0 3%!E0"` p K0@Px0 8  p 0$4R!< Rh P00?>PPPcTS{(0@PU 1 `0$0Q L 00+PR040 04 ;0p44P 0/.000b44?>0c4 4.D04H P 0A?o2   `$1%!E0"`, p 0@P. `000`00ĔTnQ  H0100A4 01E00?c p] 0@PY 00@000! 00$4@0s4 44 00 $ ?>  0c 44@ ЉĉthD( |hx 0*- 0 00044 4䀁 -@LLM 80`P$0S0p7 PS0:Ó\>Q A䃃300StA(Kh30h0 X T300S 81 X0`:2S P A2Y (KTPK@ \K 0\ X }v `TpK@ \ 0\KX   p  `K p' k`1JPP00AP0S  BX9! `Ka0@ 30S0:3S \\00V 0*`007 0@l2Y /Pl2<l280S 8/P`LQl2U?;~0l2\8p2Y=3@t2! PX  /P<3@t280S  /Pt2?;~0t2W  /Pt278t2X>3@x2! P\Y w/P<3@x280S m/Px2?;~0x2W c/Px278x2<0c(K00@l280S LQU -80S`0S   *Pp0 D0|4|l0|h0|4|0|<5|20p|2$ 0!00@x200@t2|200S0X0 K?T0L%R+4S 4S$0?o2!0t 0rr B|2S < H5S 1S088 \0 000*00@- $@ P@T@P XP@h@xP l@lB`pT@tBHx’|@00@Jt8 4x8 80 0Q $0X0 / -L M\`@PpT 0S"!0S S0WXT00(K 0  -LKP , 0 S0 2 {m\ -LMPaP`2A$K p `•RA  R 000@@  000 9( (  p,0 q( $M( ,0P ,0 ( J( ,0P   QpG\p0  0  -L@K,pP W`GPH`0 |"0V00"1@pG 0 l 2@  -\`LP@T 0S1 RT0S@@_N0SZNKhVN -lL`@pT 0S"Q0S S0YpT 0S0 0-MLM0Pj@BKP @K~H 1@pPPP@W 0|" QU + P*#@( VW KD 0o\ - PLM  R  *0K  K Q`0 00-L@H00S T:  0m00@0 0-L`@0S) :#RA# # PK0pP :#sS#:# Bo0:#!BA##\0 -LP0 M 00S ʃ0 K K8 80 0Q $0T0 /| 0-LPߨ|@@p00@ v/0ST0P0:3S < <0 00  :#00 85 -L죟#p  3EM< 0 @  3S040 0Pଓ*8 B `P&W[ p p P@W Fp 0 ? @#>  0c 00@0/"1 RC P\ \v \W00e S 8 20<0#`p q0@@Y0  |t" ,@0 ? @#>  0c L/o00"Qp P@0`00(K R` ! 0 R    (K4`00 RG 00?!#>  0c0S0000(KS0@@ `000 A? @#  0n0S  i8 00<0#`Kp 0@@p 0}[(K\008 H0D00clD(kkkj ihg@ 2-@PRLP`0p 80$0SJ = Pc0:#RQ#R ` B#0Q0Si42Y $200Sn _8D `0:0T0 P 00-L@0:#R#R"#00:h0 d 00-L@0:#R #R0#|""}#00:꠸0 00-L@ :QQ }| #ppP0 :0(0 00-L@:#R#R """"|#}# #ppP0]:0|0 00-LP@ :QQ t}| Ã#ppP0- :`0Զ0@ S0-LLP@P p p $0 00:#000 00-L@ :QQ }| #pp;`0 :Q0褵 00-LPP@:#R Ó \0#R "R--  #pp`0:p0: @00-L8@@00:3S 0 0 0 @00-L8@@00:3S 0 0 00 00-L@ :Q#Q& @R"p“ \"p`#\ ƒ`#RB#`0J :Q0l 0-L@@P :Q%Q( `P“p pƒ\Ó`b\Ã` P#c` :Q|d 0-L@`@P :P P# V“hl ƒƒh pp#*` :Pd0 00ꬰ0 00ꈰ p-ZLM@`Q`% 3 |0 `0.|0 .080 |0 <.03KpX X0 0 00 S:3 0 A 0P0D8 0 000:/0(0 $ 0-L00f\0 X 0-L0:3S 0pp `Į`0 \ 0-L0 :3S 0- ppr`X$0$ 000:#Ro/$0$ 000:#Rq/ḭ000 000:#Ro#00 /ᄭ(0( 000:#Rq30/D0 000:/  0p-L@ MP@hD$ K`00ppp 2[Sx000 SC q R 3/Kp0 :#Kp"[R 00 ̬L8, -L0 0 L -LD@M@@,K0  0 (0 $0 0 0 , T0 0KK -LL@M, K@D, 0R0 0 K 80 0hK1 -0L M0AS@f 10 0S_ 1hD, KP00pprp 2[S1X!X1 pL1`0X?  j(100X2  a030pp 03, ppb ,T" Kr[W  S0:`00Wp0:0S0S[JKԪJ8000S/;(I 0-L$@@0S01000I00 0S/4H00 0S/FH 2-LBM@PQw :3SV03a`ppn0SV10 0S#1p0SA   0 BH'\1`00|PG D1@ ,00 R 8 3 ,0 0X,00 < 03,0 pp`K|0`00|Pd @008 ,00$ @`HH(H`X :p-L,PK<`K@$M 8@(@ ,0 $@ @ 弐a 8(@ ,0 $@ @ 岐Đ808 000:3S  㡐Kpȥ 0 000:3S/ꀥ\0 X 0-L0:3S 03pp`LH0 D 0-L0 03, pp`ܤD0 @ 0-L0030pp`舤 00-PQ@L@000 |P t0 ,h000*0xP 00 ,(000*S0`$X$0 000:Qt 0P 0-LP0:B P P 0tP t +00LP , P<`X0 000:\0S,01/\,0/ 000 \///@-` V b `Q3, ( P@ TppTp( P@ TppTQ S,(P @ B p U P@R Q00 0 0@-PU,Q (0@0C 0\S0U080 0-L@0@T0B 800,( 0R S0/ 0-L@@T0 0-L@PT0@T HP K0h0 3-Lʀ M2C#R0 P Ĝ0$ K|B 04Kh* -ZLp3`S@3@S 4S3@p`S -L$M4@ <  H0 32CD0 0 @8 T$ `V" {0Kp` 0 X:0 0S` O0 0Pu (K`800S3 S S (KPf80U@  e`#@VX4S@<_(K80V@ D H0f@ X  @>#PfP0XPE2 PQ-Lpp!M @0 8 < ;80<:D0 3Q4@0S1WG (1P0 00@ P00@U# 800K@P  ^0 ZP  j 0SP 0 L0`v (KP <0D 0C8Ē#2B @00'(K ppx -ZL`CpTB $@P04Q Q&T,ĕA0|a^0 0 T4,0\0CL 0c|0T@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 ? / $`808 000S :3S /ᤘ<0<0 00S :3S  4/\808 000S :3S k/<0<0 00S :3S  /ȗ808 000S :3S H/|H- @\ ʌÜ\ 0  40 00-L0@T J 3$S |B0pQ 2K0h(P jK0h0ؖ<0< 000S :3S  /<X0X 000SP :P@$3C///000 000S :P /ሕP0 L 0-L00S :P p KhD0 00-L0P J 3$S 3S p K0hg|B0tQ &2K0h(0(0-   <000 000S :P / 0-LM8 00`V" [,@KP $0{p :pP 0 0 op@ 08 @?(K긓P  P M/ -jLP Q3S@P4P0@>3SKh> 0-L@ J 0s3# SPP!0<P |2 $R 02S L03O |20"1#400000P :3S// -@P(QLP$ 0S  0T0>,>0|00 T   T   T  P x>4t>T `TT *2S T0P T  V>\40P0 00 @0?30Q@080/ \0\ 00 T@07|8@0Q @Q0@0/Q@0?30R@080/T0 -:LP|b@0T!RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ '  (!R 1S '  08!R 1S 03@0S T@ '|(@ Q0@0@!R@  @ 0 0 0n 0 00dT0 -:PaL|2P`@0T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H00001S@078@0  b`0 0 0`0 008H0 0-L<0P@ 0@ 0  -@Lp@ P`n@  (0-   d Q 0-PL@@H 0T @0*7|"8@0 !R  #@ R0@0/@/0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/ጉ`0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/Ȉ`T @0*7|"8@0 !R/ #@ R0@0/ 0-L@ 0 00 K0h\ 0-PL@ K0hR -L M@ 0P \ S aKh  Kh 0 0 0h -LP@`]#p Kh 0-L0 M,  @ @K -ML K -L,M( 00  K舅 -L\ 0Sl0 2,0!0s0 S>00S l R00CQl0S\0,L0 L000S.p  h R0 \00S0  pL0 P \0S,0 P0 J0 l0 l@P\0,QdP 0PP01` p0 0,01`00 R0` 0P- 0<0 <`@D+Px pV P0Q?3300d ,0000JL0 <d,00T0 0PU0UT0 00S@0 y<00QC@ QTA@,d`LP8  "1B@ 0CDP @H` Xp 0`<@0h0 P 0?3U ,0 F00V*` pȯW <0@d DP,0H`Xp00T*L0 0H0 Q00L0D0 @0U&<03@,t h00 T00S0?3?SO 8}PJ Xp 8@@puP 0P `S @WXp `00S\000`0\ 0 S0(00Q`0000:3s  Q p00Pp0 0\\l00pl PP , @P0tPL0P 0 P!00LPs l9 @08@00900S0@0 0 (P !R 9 0@ 0,@   8P !R 8 0@ 0,@ T!R   P t8  @0;@0  00P 88 s @0:@0  00P 7 d @0:@0  00 P 7 U @09@0  00P 7 F @09@0  00P H7 7 @0;@0 004P 7 ( @00@0 00P 6  @00@0  00P 6  @0 0@0@ 00P X6  @0@0@0 00P 6  @00@0 00@P 5  @00@0 00P L1S 5  @08@0< P0U P BR L000S 0#=0CS a006S 0  @ `D8P T00 @0SD0H 00R0SB @0~, ?R 00TP l4 (4 0@00@0  00P 4 m3 0@00@0  00P 3 Z3 0@00@0 0 X0 X0Sh ?3R< 0XP  ,xP 2|@ 1Cd  0ChP8 `  0@ ?#U @D X* `嚭V 0<XP, dX x|@`S0n `0C1#Dx0 H x0bX Qj:<ASd*Q  QD `0@2< 8 3080 00p 080 X1 0$L  R <080 <080L00U 1P00U R 0C0@0Uz <0 U0Bt L0<00<PAQ 0D0 x000<0 T21C`h `<0H 0D 80 @P\E`4,X X <[8 0 0gp;(KLP< 0, 0@ 0@000cL C1 H0 8@ Xp 4K40 KdtPZL0 00 :DP@H`Xp<080L000S 0#=0CS@T @T<0L  0AP U  CtP0  3<0L  0AP P0C0 20Q L0 \080 c\@,0 0  L00p`(KP \,0 \  RXp8 ,0A0# 0pS P21C  Y  Y0PS  `v`V8&0  08 @ 8 -6&!L00<L 0 0CP0 0[@0 H$@0 R(D$@0 D RL0 <0 @0UPP88 `hP @P 㸫0X @?330L0 %\00S00 B ? h#@@ ! R / @0@50p0 0h0 0S@0 h0,0D0 0H0 080 . Hp p0C< T 80 P 80`80  T0,01 Qh PU @@ U   CP<0P08p HpH0 @ 0Rd0 J` OT t DXp !<  `P < P02`<  t , 0 Qh pPU @@ pU  PP TXp`d 8@D RP` 00H 1V00!@A0 3@0S h0 PP0lbaF @0 P  U @@ 8R0t 0P C10  aX Rnt x ` D1T 0 0|p 0 倐 t0T SRʌ0H0 t0d0 0D0 t0@0 @0X `S`0,H0D0 0R)D0H@0 @@T0Vh0d @pPH08 <` U@`0  @Y `) uP<`V8 D @0 D T 0@0 SH d0 H T 0d0 ST X0 T 0CX0 Sx|p倐L0 C80p080 <0S I`y`5@0p``Wx|p倐0X SP 0lJQ0AP0 `0@ PD@U @Sl(P @T$ 0D30xpL0 \00l0 l0S\0,@0x|pd0倐80 0D0 ch H \p0Lk0`@ 6TB T> `P PEU 0D@D0@c[AP p000 6H @ t0Rdb P`,@R0b0D < t0 Q,<儠  p0 0`` h` | 0 p @ 0 P80 0p 0PP 00PPX   p 0P 0 0 B  P0 P0 0p 80 P0@Px0 0UX0 I l PX0X @P@@ P l P-X0xDW 6H0 @ P lHP B V 00$R D</o"Q Rp P  RH%RDe< /o"T  0 8< a005@  P0<Pf0 @ M00$R_   80 @w< /o"QQD  0 8P *00Pu p Rr $RY P P<4@ 0 8P0 0p 0P< 00P f  00p 0P   B  0<P PP  V 00Q 0 8 P< 2@0P 0 Vk$R < R  Q Rp P  RL5SP@08P0P0 00P p   R P fQ1@ I 0  < 00P f>1 7 80 <9P V p1@` @ ( @00@0 00PJ V $1@  ` 00LP: p0P 00S4V 0@` @  @00@0 00LVD L  0`0;H5S  R 0 8 PP $00@0P 0H V X 0-LPM@P`0 R   K80   0 0 n0l/ ?00  K8p t  p0pPKP0 00 0-LMP@ PdPX\ `0hl \PPP K080 8 0 0 n0l/ ?0K0 -pRL@P `` @ PPV 0-@PL0@T0 !-L 1P00 0SHpp?spR,,0` 2aC@`T:pD嗦x+p0?330 @V D処0Z?#R R  R 0 00 -PPL`! @`0`PU0@ TP 00`@PUTP P!@UP @ TP 0-L0@ T0 -RLp0,S`P P @ T0` PS RQ 0"2"#,,Q/  00C0/`00 -0L0S < )- L9$M@ 0P40 0@80 pP 0<0 ^P40S40`chY80P l pR b R Sጐ```Y`V ) 5 <0 )@ ^ ( PU/ Π   l(` Rf( Ra e P T ^ѹt h8hXhx0dP`Hp00 0 @0 P R( R  R  lP R# OP70 R4  8  (KQU.``pbPf40S  !\g `g 60 R e Pwgp`T @D^P0@0xP @P0S  @PP! Fp@@Dl R\ \ D&@ n<0 ` B ^:&  PB4@1%0  @P40aQ``% L  Q % 7UEP@0 04P[ 0 CS<0 Rz@`(5(U0$P<0 u 5p000 0`@P 0S @4P@0@20TVU00P @$2 1C ,@? ^ 00P e<0@000S P00Q |#4@0<0 !Q@AQ Q@ t@ 30@0 ,  @ c@0@p3`@ dRT#P3P0D0 H3 0< 8H p0 <0`00@PUʪnO N@d d@T"00PD0 0S lP t" fl  X"  RW D0` iHRU@  PJ " G! `!qQ pP@T 0@D@0xP 1@` T R}T ^ R 0S <1 @ 80S59@` PP R q z`T`pdhH@4,Լ8ػ,\L4̺ĺhpD̸hط\HD@ 3-LS M|CP@0p`00 W 0000pVT   p`@0T$CQ좟  0@DS00T" 00lP  R " v20 0Q0hP dB@ i`P 00 00CSY < PT 20  (KPl @ !` 00S&T ڌ1 2@T hP  PG $  8lP @T(10 1 0 0p0 S  C b@ @j@j0 00S00h0S0 1 0 [ @ML0V0S`00  _ Դ8`dXlȱ -L 0 P -L 0 1!0G- @ *⤂Xdd!0P U- U/ 0S(,p`pG@\  \03@0^0 000P 0P  \0`SX@TP,bAaF0U  03@ 0^P TXL 0 00 0Q 2S0l%R h%R //!R!RtP//` 0 000 0/ ` -LUPP 5p0|  % \2̠`sK s0!S@ 1\ p0P\`  P5 0P ,5  5 *l"0@ @ l%R h%R 0 h20 d"2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d2Q/\0S*nfg~rfQ3 S*zo|v`~fQ& SQ" SQ SQ SQ SQ S{Q"[=B0Y . 0 C C S0/nBS p" ڃ=,0,0 C Q@"n 0@8@1 :σ@p"bV, h2hBp@0P! <200P H0Y 0H0JX ,01 0 78 00Q ^`V1 0 *vf㊆po:/f z*`v`fl*vf㮆pp^*fj~fP*fvfB!R 0 h2l0 0 !R 0 h2%R t5S 0 h2`$X,܏ܪPp1 00-LG\ PBP0D Q;\9, 00ʃhœ\ 1:p“ ^ Onpƒ 0n^Onpƒ 0A\ B\  0    $P01@-0G$ 00` PAʀ: nOh0^000 @P)#0000CS 00000000000000000( -PP@LM@'\U! Lnf pvrf 0 P |P 00  ,0 KK`XP`0@- T\ P  nVLpFrPP 00 010-L(0 :h2S 1@0@ 00S 0n008!*?pB00 R 00@S0AS Ȉ$ģ0 000:d/8 |00-Lt@P@00:h2S SL0000P040 ( @000@000`Xx 1- QL#@P`@0# R!@C@@pȠ hQ Q?!*?QFo23 B|20 $1  1Q%*|20t!*?Q o23 |20l 0  1Q*|20h x0 @0780@0v 1Qm 1Q`X/\0\ 00000C0Sp 0/ Sp R00C0Sp 0/ Sp R0 000??-RQ,0 !000000000 0 080 0-SL@0  P 0 na@0S01@-` 0pP0000s0S5 0@P0^000C.U 0*S /SR000 00C0*S S-Lq$Mp`80 Pa 8K  80@T@ J !FD  q H L  5/8 8 @T7 $T <RT! .\  ""1><0 <0P , KD0"080 nY00S PH 00 R0SL0?@P 5/@TY @ 0FRs0  S00S (KL0`0@0f@P 5/@T(K% $ p-LMP@` 0S 1Q 02S0$0R  `@VKp00 -L$M0 0 K( 00-L@M<<@ P@ P .K0 Pp-LHMDD `@P0` Kp$(@-000\SS ^Sq " %@@ 1 cS{8EAED "0 L LLd !DA l0 L LL}`D ! 0b0000 `' CrQ!  @2! { S @T# 00DS2@!0\S# '  00 000 0% @@ + {t00@00s0S 0 1P00C@R00 B Z -LM(0KH =G$P(!N+AKHgMMb"%!n1Sl0 0D/"b2`K  p-LM(0KG(`$k @C@L00C NCbba L 0LD?1c2cKp   -LM(0K-H F(p$ ?LDc` D0aA0e*E4sc!b0 9 0n`0`K 0@-@%@p 0  -L$M8  4' pP 8 70 8  0  |\ P S@  @`< H n m D @ ,S} 8 @000 80 8 0SS  Qw%S080 + HGRSQP8NMLIHGFEDCBA@>=<:876543210/.-,+*)('&%$#"!   kTH0 S\R 0S0\S 0 S000 X Ph0@ T 00$ <0  000 0 f0 />0000 00 0 00 (K8 P0 R!.S R*S8 0P ; 0 S\0K 8K00% +0 @00c @0 000 00 0 80@`fv`70 S@0@000 00000 800 0 SD0@0k   000 00000 800 0 S{ 000K8K @0  0000 0 000o0  L 0  0 e<00 L0@0 @80 0 0 SK\Q 00dX% @0 `f00@@ 0 d 00v`0 800 S.\= 00%`f@0 c 00@v`0 8000% iX0 @00 0 80`f80@v`3T 00\ @0 wp0 00(K0K 0KP 4 ( 0p-L@ M`@P0S PS 0  0 K00"cP h00 R  QH00<40x 0 Kp`tȌH -LM0 S 0K0K0KP0S pKDN$P0 `V$@PU @ 0PfSPKKD`A`P  7 K|` -LM0 S 0K0K0KP0S pK) P0 `V$@PU @ 0PnSiPPKL`A`ZP 48 0PK`` h!-L M0pTS(0K0&K'0KP0SA (`K1P8A'P.0< X' PU $@2QCP @U 0sS  @PUXW @T LdPzPP K@ K@ K`, 0  -LTMX _lpPP P0KX K\ @$ h0 :0R0K @P 3#0 x0 p >,0t0 d 0l0 0SN  R T0KS K`V{ #V =V =ذP```  0`0 00`XdP[  YV 0 0SS |pP Z0 0,    cVP c`0 PSE :\e @PP@lb0Khp``W` @T@,00 0 0cP=0`@0@cWP 00(K,0K 0$0 T@K$Pl0倁'P `` p0``   @xT`K P$們  P, `0@`0 aT`K|1Pt0倁P P 0`0 @`C`0S (K` 4 x0<  f4 , & H \# 8 40 0 0S0-L@*,0QP P2,P,0P0Q 0-PLP@P040, 4P0 -L00 -L0p@`P %P0PpP sP lP0@TTX q0P P10BS 0@B0V`!D00X0 -pQXLsM` Z P] 00S040f yOK$ K H @TzK 0  0R ! TK0 K1 0i1 Q %Qp gP! Q, 40,(KP@%U K!p.?Qi 0EXSWTC'zP iP@0lP \p W p1!0E]Sfdcba^]Z}X{VUTSRQPONMLKnmlGFiDCBA@?>=<;:98[)543210/3-,+*)L'&%$' =9 . RP \  01Kp^ -0 0Bixd:0000{ 10E07Pg0p!1Ktpi `10As R0 pORWP (KpI@`V P` 00040 P, 0000pW/ 0G, K00 !p!U ~UpOS ,K000 ,0K1p p 0PU PE,0K0P QUP pQ ppQ %Q0 0?R ;RP@pua0As R~0 ORc,K,K1p ,0K1 0 ]1S101 1SQx1p0x1 O0PU ,0K1PE0P XP0 0OU ,K,K!P0p0P 00300S , K!0C00 XX% W!P{PJ ,04 Ӑp 40p0400PU| PE,0K0P QPa0As R, Kp1 Q0PUf PE,0K0P QP Wp pJP ,04 ࢐p 40P4 0pWA pG,0K0p 1W` G,0K0 10&PEVU" ~}|{zyxwvu00pOS ,K,K!000 000'SS 0S'S'SpcY00S 0C, K00 10SKQX ppQQ %Q0 0?R ;RN PeR`30000s0S0 0@!0 0 0 OR,K 0 , K!0000}SS 0S}S}Sp P 0Q OX ,0K000 ,0K1 p A0ASpP@oA0AS3ApQ,K1 0 PT1T000OS3A ,K,K!0p00 00Q ᷬ!SõaoSaQS0or00p00000p00 00 0000(P   00 PR pd0 0P `| - -LM 0  K - -L M  0 K - -LM 0 Kp@-p@00/V -`QL MPp@ 0S! WM  P( OX' x00 X3T  G}`PT00g 00 KTd KT-p0 0 R0S TH T0PpT hD, K3[p 2[S "[R1 000ST00#P 0 `thP 0 Pt<Ҵ0δ (  D $ T    0R -L MKG@P K -LPp`PPP |ᤪ@P0e V PV o -LP`pU@  P T  -`RLM@pPZ 0SW%  p  0! p 0!p 0FQ  3 P  ~0 "K"[00 "K"[R00  "K"[R00  "K"[R02K2[Sx 0 "K"[RV "Kb[V$ `P $`0$K0 $K ` 0"Kr[W $ 0 p$0 0$ep 0S &K p0 ` @$ `[0 `  nPy sPh fP0/o`pS" R0 0~^: 0"K"[R &K`0[02[S U Q  B0r R0 2K2[SQ Co`&K|p 0 Ⲁᰀ2[[0᠏p\h 0"K"[R5  B&Kr   U S"[ ^ṖSGp`p002[S`U   `p`00"[?U00S p0@,$ -PLALH!M@0 㧌$qpPB;`P= 8@K{4K0 f;p 4 R@;(K80S 0P@P Q OP@T T0 00 0 0 0 ;P84 ,i& H,h -LB~KM pG` M0$ 44 0P:SS @T:T@@a R  Y R  ,0K 0$44 DLwP P`0:S (Kd2 -LXŸ0MP MH 0@`p04 pP2 0/Sr P~ pP 0 (K0P BK! H P0 0pW |0 d0P 0S/SpꮨP G X | Y P Q# PBK  @\p 0,p,  DWZ 0$p000(K0  p10$4000(@$ $ $ # # X# t" (" -LpPSP` h@d@ @ @P Y , 2 C 0 $Kk}̟"  --LM@00  K 0-LP@T0S P0: -L M 0\@KfQ00\ [^ nQ0 sQ0\01[00n0 K0K -LM p`0WPKfR0pW @00P![00P  nR0 sR0pW01[0;@00K@K -L M@`p&P9PU+*0<qP* ,0K< PcD0D0<0D0yD <0nWP D p= sW' fWD0< DH00H0(K0 3(K<P0PZ 0  !,0K<  cD0 D0<0D08D0 0D0,0KD <崀c00D00D0p  X -L$M@+`Vp %`PP P$040D 0<P , K0qb , Kab Q   ,0K `QcQ00  ` R' ,K01`!a0  ( R 0,K!a 8 R),K a H R5,K a `(K,K0!a ( R ,K$P!a ` 8 0R ,K4P` a `,H 0R ,KDP<@  ` lu00 0@- 000@ 0 00@R" 0S  Q \T  0S R@ \RES00:Q00Sx  00   0-@PL0< ,K0h| -L,0KMl ,#d0 ,h:00 @@P | |PP0P0ᾥP`0`0LPu 0<0 80 P V l0U l0,doP 0S l  "! h )|  0 0p0t s`0 [ ` s,PU ,dJPw 0St h .S  ROS= = jPP# e@P, P 'p`Pv  nP @K"o@00S@Pv pP , K,0KRb$ Bc$0 0$0$ (0 $ 0(00TSl0 0@`4` p0 o<KGP < 40儠 0p删'\`  0 WP W\ 0&\W00S< p`@PW0  40b4 Q*<0 Cr` r ,Ps '[,0K,"c, K40440,b0 40 40,04 40<4 804080 4 IV&\0%0S0^W0Sz pPW ?Wp ppp@\p p5p@0 00@ p00@0`Gv0S"0x0 @u 00Np \|l Ux0a0`F@SVv```H`pgE0G/S񏐨zqo}|{hd[L40000  0p lP @0@Sl p@tP ` fdPJP ,0K Ac00 00P000| 0 l!d 0 l< (Kl  0s0  o 0p l1 0\p 0`p@\p 0\p 0\p 0\p 0\p 0\p 0\p 0p`\p p@@ Lp@t p @rJ PnP3P8 , K,0KAbc$ e 0 lP"P0l 0 f0  l p@ 00  n0 @< ~(K lp @r% ,Ps`PP , K,,0KAb4 ac40, 0404 80 4 080 0 lZ0 >@lX P7Pꤴ       T 0p-LH`KP4M2@P KpU0 00S  R2Kp (!-P Q1LP@ `p7 0$0R0  ,0PPp|0P`Q  XQ  X0P|00PE00pg0`P00`p 0-@PlPLP QOM K$I,GE(00 T 0004`0 000/ḧ`$0$ 000P/ /ᔧ`D $P0!B0//x -LM`00K ANKA50,pK tង Dh gmM1n1%Psb00  f?@Bc$dAP$K P0`0K?// -LMp00K kLG@40,`Cp0ᑄ0DCNC bKnl " 020DOAdB@d1dP$K( 1P00?// -LMPF(0K -H ?LD4($0dcD gB e?N*CE NQ$lP2c 0 00dOCd4d1PK,+ -L-@ h0h 000s@ H xPJI K KHKH  Kh` 0@0-L-TH@@(M  S~K49"]Kuo,JjQ)pH1 ~}|{zyxwvutsrqponmlkjihgfyV1|Vt1oY51 D \4 ;:987mM43210/.-,+*)('&%$#"!      dcP0D0 ʘ$ 4@ P0S?"7L"KDK+ P0S h!00 $KK0cP0D0  $ \4@ P0S?"7L"KDK P0S4 00KA!00 cP0D0 ʘ# 3@ 00sS4 cP0D0 \# 3@ P0S?"7D"KDKPB0SL3 00 !00 cP0D0 " 2@ 00S?"7D"KDKP cP0D0 ʀ" 2@ KP0S DKP#0S h2@@@|>$0 "00 fcP0D0 ~! 2@ KP0S DKxP0S 1@@@U>0 "00 ?cP0D0 TX! l1@ KP0Sd DKQP0S 01@@@.>0 "00 cP0D0 *  0@ KP0SL DK*P0S 0@@@>h0 e["00 ?ԣ P  4 p <   4      `  `   T cP0D0 4  00@ KP0S DKPX0S l0@@@=0 %"00 cP0D0   0@ KP0S DKP/0S 1@@@=0 "00 cP0D0 T! :{@ kS04F{ { 00S DKPL rcP0D0 ʌ# 3{@ kF{ { 00S DKPC ZcP0D0 0# {3@ k k P0S DKlP0S03 00!00 7cP0D0 ʬ" {2@ k k P0S DKIP0S2 `00~!00 cP0D0 g(" l2@ P0ST?"7L"KDK%Pq0S2 00dZ!00 cP0D0 Tʠ! 1@ P0SA?"7D"KDKPe0S1 P00@6!00 cP0D0 .! L1@ 00S?"7D"KDKP cP0D0   0@ P0S?"7L"KDKP!0S0 t00!00    P     l T  | X    H | (  D   ( L cP0D0 P  (0@ P0S 0"KDKP0S|0 00!00 LcP0D0   0@ P0S 0"KDK^P0S1 00!00 )cP0D0 [X! @1@ K00Sz DK;P cP0D0 ʨ! 1@ @0S}?"7D"KJDK"P cP0D0 " 1@ P0S?"7L"KDK Pb0SP2 T00KA!00 cP0D0 ʌ" 2@ K00S DKP cP0D0 " 2@ 00S?"7D"KDKP cP0D0 0# 43@ 00S?"7D"KDKP cP0D0 ʀ# {3@ k k P0S DKP0Sl3 400!00 sP0D0 4 ~P 20@0 3P0S^ 0"KDKP0S2 00!00 NcP0D0 p" 2@ 00S{kF{ { DK]P 6cP0D0 (" 82@ P0S?"7L"KDKGP0S1 00|!00 cP0D0 ʌ! 1@ P0S?"7L"KDK#Pq0SX1 <00bX!00 cP0D0 ! 1@ P0S?"7L"KDKPa0S0 00>4!00 cP0D0 |  0@ K00SDKPH G   4  | X L  @ \ P cP0D0 0  (0@ P0S?"7L"KDKP0Sx0 |00!00 zcP0D0 ʴ  0@ 00S ?"7D"KDKPH dcP0 D0  ! 4@ P0S DKuP0S3 00!00 @cP0D0 P# {x3@ { P0S DKSP0SD3 00!00 cP0D0 o" {2@ { P0Sb DK1P0S2 00pf!00 cP0D0 P" l2@ P0S)?"7L"KDK P0S,2 00LB!00 cP0D0 Z! gk1@ { { P0S. DKPP0S1 |00)!00 P0D0 r P <10@0 D1P0S  S:{k k  DKP>0S1 00!00 cP0D0 pʬ  0@ P0S]?"7L"KDKP0Sp0 \00!00 i H 4   \ | ` \     cP0D0 +(  ,0@ P0S?"7L"KDKgP0Sl0 p00!00 2 0{Sk k !00 &# SOK"00 `# X# SOK q"00 {Sk k g!00 " SGK`Y"00 " N" " " " " USGK<!00 l" d" \" T" SOK%!00  " 3SGK"00 ! ! ! iSGK"00 ! O{Sk k !00 x! GK;JS"00 |00@0 00@0 A : PI S @ ,"00 '"00 ""00 "00 }"00 -DT! @ H  , 4  ( p < X  `"00 ["00 V"00 Q"00 L"00 G"00 00@0 n00@0 (:"00 5!00 0"00 +"00 &"00 !"00 !00 "00 k k !00 k k !00 "00 !00 "00 "00 !00 "00 !00 | 2 00o!00 nD2 H00!00 a&!H '@0 ?O"K !H @ L0K0 !H @ O0K ? /+S0@- MSL_AQQ-@\ @@ 00 Q P0 +CQ {7@ 7 Ѝ03Q Q( +C Ѝ0ALL1 ^ S\@d@$FkG0+C{7F{7{ ?+C 0 /P 0S $0S 0S P /? @4@P/ -LPp`8\8 , R V *4f `V@1@! `V40,0 0S404`Q 0 ( 04"0V, :b i,0400f 8`,04`00(@ 0 (3/P8 0-LP04_Iʃ R 0 S PpTP  $ < @ @00 -Lm0P ,00040 Kh -L@[PQP@a`Db/T`@0DTSpp8Q (0T $0(3/8p `(@$Kk R-`L@3 8S1R  -P/ 0 S ($ R +3/PP P4?@p08p`P($03/p@  $ 4  (0 0w0  0-L@PPQ0 Q @P U <@P<0<@00? /-0LTMT 0X0 000 0PH0 N 0S@0 J 0XD0  ?/DP0<`"S @@=d 8 P P/0 < "-\ ?00S[ &L ??00T00CS0STU 0PEd@ 0S Sk SW A?0"a@Dn$0SV$   0z@6?`0Ua 0PEd@T$0S`0  0@7?`0UL 0PEd@T$0Sv  &$    0^K8?0` @`U1 0PEd@T$0D`S`< 00`@9?0 ldph\*X P" B010T :50PEd@010P+UL,0@ S80 0P<`@@< R 0P/ST M R S00S <0 8 @ bPR?01@<0 @dP00"1D0 Pe 0 0 0$0? S@@0R00 GBRR ,H H @0T ,0TRPP0SX00 0R(K0 Sd *0 N?6b@0PU 0PEd@T:z H ;@a6a H L?08 Rt <H0 bRQ*0 bRz;S ( T0SG?0_ H?08 1UR00XP z;0T :0PEd@00SU8LQID0z;J?0\0T 00T : 0PEd@00SU  # D0Up1p!W $ R P  0cQ c G  0GD0Pg0gD0S 0D0:?00LP0   U  Hp$0pS Q D0S2D57YU0 YPg 0D0;?0:$Q$0;80S @H/D0C80 0 @ LQ,  R=0 U 0PEd@T;0c?o20)$0Q000 4B@s0&4 a """bSz0SN % 0  G$0SO Q  RUg 0PEd@T 0S- L Q?`0V0LP0 U QO?0UL 0PEd@T<08 L bQ1R00S 00 00 0S@0b  L 00S9  R,&4 &,<0 04 S 8Q#0<  L  DpC?0W U8p1Y p1W  @PgKD0@  g8  pg@ 0DpDpU 0PEd@T:zD0@a+106aD0`l0Q\   BTU PEd@0Ql0@DaS d 0$0C 8 S 0l0S> 0X p0/P0X p0 t0PP0 + ! X : U  Hp$0pS $Q (D0S2D57YU0  0YPg~ 0pWU hph U 0PEd@ 03>0\hz6n@l+0.S5S S  T:0PEd@T*U 0  ~@`M4DR ab,080b80 R0 1z@6c@cy @" U l 6`@`7| T D?0QU S0h 1l0 0390 ^Uw p hhp lpUp 0PEd@0390 ^php6i@lQ6c@cDM?0U T ?/0;0 MLp@ < 8 P <`@@0?/ S Pz8 <`@@@ +2&8vp<#0#W0 $ $ K?HL0w@`TD4Q 0XP00T\0G?0La@D LQ0$ @d $ T0DpSB?01 @`  $ @80`<0  Ra0PEd@T[*U 4K&44`K30K 6`/0/O ` 0@c P9  qr0 Sl RC0PEd@T=*U k 4K&44`K30K&8&l20K1`K^FI?L0\ 4K&44`K`30KO@ gLP?00P0 \6`@` 0@D0&aP0l0F?0T6`/0/O `0@a(0 S@`0(0  4K040Kt030K5?0O80@`<0 0QSF ?0S$L0'  p; L@0 080P0<`@@@L`( &b0@DR0"S(0#( t0h0 p0l0 彟S>0Xp0XP0 0 0PP0 & L0|(  pSS 30 ?/=?0L `@00 4K&44`K30K{ۏp d\hT \ l0h 0PP0 m L0T)  pLQ/l900 Q?@L`LQ/900 0-L@MPP08Q $0(3/$0(3/000P -L`P2pP@0 VR 408 c4 08bU000p -LP`pP@ 0 S>? R  P00R   0P ppR?p0 0-L@P0  $000L2 H"0-LMP`0(0 Pp^u 0SSv @0< 0Q3@<0'A,K 0R#4 <0@ 0 Q00cS R#2Q SQ0S0l0^@P D R 00cS  Q # 2R S R0S  l0S 0@00a@@??0( 0R $K@0Sl0S꣎Z  -L=P0A/Q@o -pL@*WPO 0+(`3/PPI 8X ( 0(3/P@ 0 0@ 0Q@ +P SpR *S>0p X a0p08Po=RTS>0 aa P T(0 8#($03/ -LP0 :+ 0-L@P0Q    00 -LPCʁ0+S(D LS;D`O -LP0Sp0`@G-M@`@$00 SR 0`P0U0SCP0tSPU$ @0P 0 P0 Ѝ0@ 0QY ^`0@0tJVS 0U0P0S@\`0d0^s00R0@C 0S0S`bCRP P9S#0 4 8< $ @ (0 0C,00 00q` 00R0 0 R b80`0 0 0ӗ 0<00p080an 1 p Rp`00J 3 0S C0 4R0Cs04BSZ{ 0 00᳠0Zl,00 Sg 0X0 @hZ 100$*004S0cS   0bS@0 R:(0 4(0 00R00S:40%R00S4$ 1 A   0 bB! tЍT @!Y10  080@0<00 c/o9"0 S  R @/o"4 %S  RB Ѝ hK08<0P @!`0$ (0100 d G-@@M XP\`aUE0&0 0 N @4` B8,pP0C$ 0< @PT,pp ``(4p8` 0@P@0P@3 00A1PS@2%e@30C0@a1PS@2%es  P0 U0؅ 50C0e2%0P@@@D@D@@aAP`2%e @T pPT p؅%tPpGdpPe2$@T@|Pe$@T*0@KT @T,@S(`@e@ p0e`N<pTp@<@dS`P pU0CS@PpF`pUpFpUpFS PSP00@ 0@X^1a:@0 0a@\ 0  0c0 0a0c0^0%01n0c 2n"< @@Ѝ@ ??01Q00@P`@E a@Q100@@d@p`0CPSppppVpES PSP00 @T$*@d<@`4@S@eP(`@x`0epPN`T` @  4< 000ӗ1х1&=  6lx 0Ct40 B6bxt00 8 VAl:80Hp0XPD0@ 5#Tp4P0H0P0PppQx0048 Sh ` Bl w\0S c80[l0\0900S9 t ^ft0 Sa@ R. S\ SZ`0p S`x0d l wh0S" 8`ʄ`6vVP`!V9096&0CR l0t 0Nl0Rt-(Kt`0l`Nh0t"\ l0R8 bl0\0P`0Sl  P x0l +l p00c Sx0%x0`"h Rl0@S 1 #P&) &R \ R8 b0l0\00(Kl8& VP0P V) )h0\ R8 b0l0\000S(KC<L x4-L0$ML 00 t1Yl80H 0X T0D"#40 H 0@ 0Q ,0 aA?C0CR`P@p0FpP 0cs0#00CƊ0s0S !I.p# 0  30җ1Ӆ1&=  0`PtU& e00 BYat0oSe l0E8 @@80 H0p4 `H 40 T0 XD@<0 <DP P40 `4 `@ l @P9, 0H0  `@4HDP80PlPQq \ 0lR8 bl0\000S](K8 P6F !PƊ90960Ctal0oI0tl0l 8P`0lP0XT H0< 0H0t0!S/L R S S(`lA8l` 0 c ` V:& 0` `.0Sx ` V* 0`j f 0 ,0 S R j0 ^0 0 ޾0 ,  Q R I   R.   0` `0S0  0 P,0SQq: R)00, R  Q*0 a000 [  $ R,  $ 0` `0S0  0 P,0SQD: R00, R  Q*0 a000g  ,0S 0 Q0S0  00#400q00s0SJ 0 a000 a00 0 `t0`0 0  R ,0S00Q\$00P0 \s0s000 0 0#400 0 0 S0 S00P0100 0 R  00 0#400, R. E  P20000 #4P tP&`Pl8P 0@ 0^, *6fƒP9096&0Ct0bl ?oA t2l SL Qt QXT Q Q`Pl80^0^< 00`^`^`^`^{`^v`^w``nSoob`V `^  0b001&=6&0C`0btl ?o``P 2tl 3 0 00003X X 0  X  "0Sl0T 0Seb:X4P 6S \ R8l0 b l0\000tpjl 86`v!ྐƆ9096&0CtpRl0pGtp0l0 WEt0SX :Xv 6S \ R\ R8 b0 l0\000Si 000000  00#400 03 0  0#400 0  000 -<L0 0 0 0 0 0 S0 S00P0100q  ;0S0  j0 ~00.\ R8l0 bB l0\0 00S>L D0 !B +t0S*l0\06\ R      -LP`plPLu@F U00V0B0V p: 0S: U Q 21CP  0 |0`2 1C @0 0 Rz6S S L0D1C0 060PL D!B ` 0-L@ P'0PQ $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/qU0000 -LM`2 080 0\Pp00 08Q1S00P 0Q $0S xV`f0V`F00GQlFQRh0 R XdFSo40 媢Z\V @&( `4/@Pq * *J"@0`,jP$K 40p@wP 020ɠL0AX4*C T 0(3/ 0 ,8(3/ 0 L@(3/ 0 Dv(3/8&Q 0( @Q% DPQ!  00 60儀 $0(Ko(Kp080( 0$0SzT080$0u(K"40 8 0000 -ML 0 0 004 K -PL@ ?o2PPt`0 0@ 0Q@ & 0(3/@P&@> 0 ,P(3/ 0 ,8(3/ 0 L@(3/ 0 D(3/8P1 @0S. DpYWpp( , 8 , @@ L DD  0&&0a ΄0 0 &外0$0˄;RG-   0 R 0#s01,# R B2 p⪢0≒  p< 8PPdPHp lL,a,4@,0,\|`,l \ǎ`& `& Pp` \ľPa `&`&,,\\H|P,̠\ LQ,A ...^^D~P.\LQ,@   PPp@ ĽA  (@  PHPpP ̠L\lAQ $ W   PPHp ̌L   ,| R@@BP@@P@0,Q\4\|`,̠l< 1,,, RP 4 0 0#Ts01,#  RG-Mk| 3P=N0'0S|`M0Se @.0Y0SZ @.0 V0S; @.0 U P 0  0  0S! @.0 V P 0 0  ܍ U VY V/Ț 0Q /0Q /jiR ȠG-p0 Q RR  Q0q/HSpGQYPiఐ%V `VX HzX`dLK.K0 000\`0S` R ,K0P@ R0000F` V(K ` @-\`pPPa@@Rp0 @00R" R3 pP@0V 0 Sࠣ࠳ R^S\ \ 1>>R pVP@0 S++=°0Ѵ0°0ѴpP@0G-M0S0@@RYZ= 08ʀ1 00PUᶠ 0a?o20S:UA0PU`@`~`@``!apS>0v >0k. n0 `cpC ^0ʰ@PU 6Zs 0Z  @00Q0Ѝ0Se S 0> 0bQڧ>kBP@ p`!r p  0P#40&0b T3s00&pgQ} @Pk`pGI2s00`0 0P@@#40&p0b^3Ws00vky@Pk7 Zs00 0 0@@#406 c0CY" 6 @ U+-6Pʲ+ hSk.ڰpH@3`s00`00@#400aW3s00ἆ Xy I@kr P8s00P00@PP#406c 0CR. 6F @J pkWI2s00vk.y70/궀+ hSk.[ڴpH@3`s00`00@#400aW3s00ἆ X8 I@kr P8s00P00@PP#406c 0CR. 6kN  01s00&$ 0&0Ek.q803s00ἆs Ek.q803s00ἆG-Z M6 S6F0 $ $  |$  t$  l$  " bQk΅` BpDt@@@0`@@#40F0d@^3s00F& Y*ƕ \ `, !paWpk.  AD0 t@@000@@0 #406@c0W$r 0aqW tA0gSknd~!0pGr @ @  0@#40@a^$r L`\00 03ӕӅ0@0dS_pkn0@D00q00 0#40&0b@W3s00F #Ry `bQ n|B`kp4 Bs0000`@@#40 F0d@&\3Ys00FZ: b\- &40 Ѝ k~$r uk΅4@s00F90@kn0q00F4kn@s00F)!r z B`4@s00@00@``#406c Q& Ѝ质 :@-&R Rڸ  &&@@ "$ :0@-&R R0ظ @@&  B&0&@PP@@PP!ƃ00G.p@-0PJ ;&̀f,(08;0 $ˀ0VP0S  0 Q+0Q 4&&&&px s0-@ PL&` R:"pr   pp"$ &b BS1&0^ u00u0#d0  S4 ```000PP20V:0@- Q0ڸ@ P q  @PP"$ &b B^& R Ҽ&ڸ @PP@ @PP"$ & B&0@ @ & -LMPpQ00 ,0S% 0`40 &Mn@i+(+^8 0N  q/ ! R0CS j&Ɩ  &  Q !P  X R&  00 G.0 0R ,00R>+ 0Q 00S4&&&&(K \R &0 Rʼp"r  Q(˕< 8  @pp!r p  p"$  a AP"r ^ڸ[p.r   p"$  a AP"r Q0Cs0p!r p  "$ Ɩ l LS2Ɔs l0pM0,r   0#406 c 0CQ6pk>Z0ڰ Ɩ0 \kʶ0̂἖(Ko $0 S&Mj@030#X0S-6 SM0  Ɔr 30,N.V  #O0  Pu0Q;S;S <S IE/Q 0 S 0,0pp"pr p  pp"$  a AP"r 0  r 3s00 00#406c 0CR!6 4p< 8  'J6Ɔp!r 7[.r <@|!r 0D t 4 :Qp@-Ɠf@PF  AQ D !!ѕ"х  &0B`op) )Ę -LP`@& y1r1FP t3i4FPV0 @T 0 @ò0@@0 -SL@P`y!r!FQ0  C t3i4FQ p_#W pW#Vp -L M K@P @oK -LP  -L$PKM`p( K@P @K :#p (Kض@(T  y rF0-L@P Ƕ@o0 -LP 躶 t iF0-Lv@P @o0 -LP 衶 0-L@KMP "p y rFU@P0K0艶0@K0胶0K0 0-L@KMP "p t iF5@P0K0i0@K0c0K0 -L,@KM`p0 KPP "p 0t iF @P0 K>0P K80@4P0U0 0-L@PP t3i4FP 0P0 0-L@P l?o2FP0 0c00 -PL`-@PP  P 0-LP@ r2m>FP 00 P  QP P 0 0-LP@ r2m>FP 00 P P0 P 0 -PrL`M @PP  P -PL`rF @PP  Pr 0-LPH@V r2m>FP 00L P  0/QPD Pt 0 0-LP&@4 r2m>FP 00* P] P0$ Pb 0 -PrL` @PP  -P -PL`r @PP  P 0-LP@r2m>FP 00 P # 0!QP P 0 0-LP@r2m>FP 00 P P0 P 0 -PL`y @PP  P -PL`r @PP  P 0-LPt@r2m>FP 00x P  P0r @P 0 0-LPT@br2m>FP 00X P P0R @P 0 -PL` @PP  [PJ -PL` @PP  GP6 0-L@ Pg>t3GP 0A0 -PL`@PP  !P 0-L@Pg>t3GP 070 -PL`@PP  P 0-PRL @00 0-L@P  00 000h 0-L@0P 0P -L 0R P Q ǰo 0 -SL@P T``PP Kh<Kh[B @B -LP@P  p`3P   `` 0-LP}@P P000 0 -@PL 0 0R ePP 0 00  00`P Q "`#8 -@PL t0 0R 6PP 0 0`P Q p"`|p P/0 0R /P/0 0R /Ƚ 0-@PL L0 0R 0 0P Q 8"0ꌽ P/,0 0RP///(\ -@PLM ?o  2P0S0S K0 P 0  P`]pP 0 S  R H  DR PPp q00  м d X -@PLM 0 0R KQ" 0   PP` pP 0 S d  R PPp 7,00$0o 0 uл̭ | l P- ?o02 ^0S0 S кP -L<0 0R P .oꀺ -LM$0@`SPU  K KP,0K P ,pP  (0KP (0, S 8P nP P ,0 0; 0 // 0-RL@P 0S$ R:   P0P0 0, X0T T0 դD0@ @0 ͤ00, ,0 Ť똍 H ܍ (  h 0-@LPQ P0Q0 0 -SLP`@ 0S @P<P QQ P>Kh 0-L@<P{P0/tP Q mP Q>eP  K0h^ 0 -SLP`@ 0S N@P<FP QQ ;P/5P >0P  Kh) -`L@Q 2>Q# &Q P Q' <QP&PQ  PhPPQ P@P  :PP 0,0 0 00U0R -PQ@L` @ 0Ls0S)<\10S- !S00-S(0F ?o2-R0S 0SS -S00-S0>S 0-S>3  0Ls0S<\ /S `(`  0Bs\000@3<00#/R>R  R `@R  0Bs0S>30 00#/R>Rpp0aU0 P ᆊP0/Sj 0$00>Sn SZ 0`S 0Cs0SE` 0As R000@3200#=Q00S Q @P  @r R<"   "=P  R0f`00"S 0R 0 "R= R{  "Q@ Qt`FVq0Sn 0(0u @23  0As0SQ] 0 0 ୢ(0SQ0$00`>SK0``000 0 0`r  >R:00c0갃  @-P <P RQ RP <PG &P@aT lT gTtP4 @mT' pToPsP;P'tP;P<qTuPoPtP;P"@pT@;T;P>S0SQ 0-L  ᄉo |1-LMKMMp0H1 O?KP1 N?KL1 QKDA P`@H Q/  RbPT% D  0 3/P D1,@K PLaP1$D<18S  0-S0>SSS @93@@@@訁 -PRMLM`phP5 @T2 @W /R ~/R 0A QW/R 0CW /RW  C/QW0 B0gC0BKSH@1 l$0K@04DBK.0H0n 0 S*,100 0 &p@0  U ֭PЭ0P Kʭ0?  Kí0  Kp PPp p0P 00H -LMPU<I@P% ,apPD KpE dKV?`p0 0P `p`gj]p(  \$K0 `PTjJp  I ` 0 Bjp 0 $K$K*  0-@L'tK0h -LxP 0 0 =y @| H{ -LMKIM@ NK U 5/K00 PR @ATu 0 R 2/0`Pw` P0K 03/U@ 5/T wT T@AT8A - `0S1 03/P Z :/`w8AT 0 R 2/0Pw P Z :/V3 003/(K 0 0C/Ɵ 0 0C/ཟ 0 0C/ട 0 0 ૟p 6l0l 0 ࢟X T0T 0C/x pz ly w \z Hy w ,z $y w z y w y x `w y x 0-L@PP-  P $0SP  R @#0l҆P P F@P 4 0P@0x ( Px P0/ -LMKMMH @T! L THL0 00 0D! \@! ,mKQ_KNKOKS/KP! RK T%`0P! P4 HL0 @04/@PSoKR_K@HL003/@0 P(KT@D1L!HP < 8D! 0H SL @! (KT!R000 0 0K/מXt v u 0/0/ 0-@LK0hy, (-L Khip H`gc@g (0-@LᴢZ0(g 0-L @@90f00-0  @ UT:0/  RP00/P0-' 00#0  A T0!RUT0/T0 P00U T0/ -`AL@pG(PP (P PP \X(0?$ $0 LLeE̝s s s -L(M 0@a0,p0P4080<0舖d], (-L; Kh(=4] 0-L$@@ 0]Е 0-L@K0h p-L M@P4 00RAS,0 S R 1`V. P` 00 PKpS 0b 0 ЛlKp40, 0C40P `R d0q` `0 ౛P0L L0 ਜ਼<0a8 80 ࡛m Xk Xm m j l l j l Xm j l -@L`,PpP U 0 !ؠ,p0`5,p0` -LMP@ pP D!0 <`P (0S; 0 0P (0S `00(K$`V 00K  P 00S`  P  P X 0` P ( <$0$ 0 @i xh @k pj 0-P@L@0S 0  Q<0  0K0hP댑0 -SL( $0$ 0d Khg j i (0-@L0X -L M4`0 V! ,@PᄁQ" p `Fp¦@T` @P煁Q  ᕤP00S P(KP00SP0(K z0 0| |f i th 0 -SL  Q< Q  4R ,010D c@0@ 0 n, (0( 0 e및e h g e 8i g 0-PLP X0 0R @P0 {0 0 ?Ԏe g g p-@PL MP 00\ R WP P KpKp`  EP@ @T Kp 0 0 H4d g ,f -L0@`S dPPIPP Khf 0 0,ޙ0 c \g e 0-LP>@P P L0 0 |UP 00 0R<0  00 -pL MP@O40S6 P@C(K ?o2S*1 0R0P00 00 0SR pp 0`P2 U 0 S 00R 0@(Ko` ,P P 6P P 0 03/P0~ 00C 0S 0`S BPH@4 000 0..Pb ܋H la ` ` d b 40 -SL , 0C40P Kh@ <0< 0- ( $0$ 0-T` Hd Lb 0` b (b -L4P 4 R @,0Q q`,04 Pq@T`:804 80y -PLM@`n80 iK KP 4 0Rp` S"*,P' a!>4 <0 B4 0<0jhAKd F`0` 0.L GH0H 0.4 H000 0.x^ lb p` T^ \b L` 0^ Lb (` P -LP@pJ `0VHVP7*440Q `V/ ;*000,  0 0,0 000, ,0P 0/o0"00\ R RaP 440Q`D }@0@ 0^/, (0( 0^/넆\ ` ^ l\ ` d^ 0P 00R /ꔅ0P -L 000RP80080\ 0-P@L80080K0hz 0-@PL <0 0R 00Pi4@f0̄ 0-@PLM h0 0R K0K0P N00S@#:G @l 0-P@L9T ,0 0R@@,0ԃ -PPL 0 0R 4 `40S @40S ,0@ pP)舃 -@PLP L0 0R `  @Ԃ P ?o< 2 R  R00 S /p -@PLMP" x# Q (K40 Q8 `0 K :pP @P(K䂟  pP@ 40 Q1 4X , <0p0P<04 ,00Q~  80 崠80P+H c@!U0 ,0 4<q1 P4< Pu_ ,Y<Y6Y@S0C00 ! *,4 <0 pP04 <0,pW 0 080 - sP '%z p<pἙWup| x0x 0.Vd `0` 0.ML UH0H 0i/DHh,)FxU XW pW TU X LW 0U Y (W -L`SPp@ T  P 000 $Kk 0 0o/0T X (V P- ?o82 ^0S00 S h}0P/ 00R/ } P/?o, 2 \0S/00 S/|P- ?o02 ^0S0 S |P/0 000R/`|-P <0/o0"00^ R R ,| 0-LP@P P 0 03/P P P050 0-LM@P K0  PP  $PP   0P PK0hP -L@PP  @P `` 0-Lu@P $P0P\P 0-L⩻@P 00 000303 R<R~J<P < 808 0X R Q Q Q Q 8P J Q N P O -LP`SPU@pP  Ῐp P* 0-LP@9P0P0 @00 -@PL 0 0R %`P 0 00   pWŹPP  剘P00 sP/0 0R /drP -L0 0R PU `V ᘹ@P  \PT BP0P 0x , F(0( 0x 0rL M |M tL M HM P -L`0 0R 0S P 8 W404 0 ͒PLqK |M L P- ?o02 ^0S0 S pP -L400\ 0Szolp -LM$P@`U P' !0 aP 0SKa KPp$ B  0 P0"S !B1 0 e $0K P $PPpP   0KP $0R t P @P PUp $0 0@0"SPL TJ dL (K D / 0-L4P4@P@ 000lnD50SC C P/?o8  2\0S0SP//m H0-@@L T(@@ @0@@`4D4 0-@PL (0 0R 0}004mP/0 0R/lP- ?o02 ^0S0 S l0 0-SL@P 0$0S 0 nP 0 fP ppl@ @ @3@LLL@ @804 40 oA A 2XT2H H I -`PL ǹPPp @@P@ٷ@Pp DPPDP 0,p0`4080<04k 0-L@ K0h P -LP@p- `0V+VP*  440Q`   V *000,0 10,0 10  `804 40 $0 0 D 4G H H G H p-L M@P400 S<R,  R S 1CaV( P` 00 bP400C40`KpR f0 0 ଐ_H [KpS L uH0H 0 4 d000 0 A X@ -pL`n 4gP 40S @,0Qt, 40Q@T:8 408 W  S-Lp@P$U `V 00Q ec00 7 U` 1 V R $Kkt 0 0F/~`= \@ > 0P 00R /_0P -L 000R P80080_ 0-@PL <0 0R 00P0@0P_ 0-@PL <0 0R 00P4@0^ 0-@PLM h0 0R K0K0P 00S@#:@^ 0-P@LT ,0 0R@%@0] 0-P@L80080K0h 0-PL@y8@@u@$0 -@PLP 0 0R `b40S,0AT Y@ R0 0O/ઍ8]4: h5 ; -@PLM 10P KKP$  08040 $ S %,0qW $ 1,` $<0!0<0:`-`D @0@ 0S/a, (0( 0S/X\9 < t: 8 ; P: 0-@PLM T0 0R K0K0P @4[ p-@PL M 1 0R KpP  4 ^"80, 1aV# ^, 0^<0N40<0KphKphD @0@ 0W/, (0( 0W/ZT7 @: 8 07 d2 8 P- ?o02 ^0S0 S |Y 0-LP@P P 0 03/P P P0g0 -L M@P K  ;P  $0SKh P- -L@PP  .@P 4]`-Y` 0-L@P $P 0P, 011/ -LM@P P"\'„ 0 0K 0   ̲P  0  00 0K80A4 40 ($0B 0 d7 <7 |7 7 7 \7 0-L@\ ^ \)QRS  T000 0QL R S "  T € 0000 Z0 0 ۋ6 6 H6 p@-M `0P@ & ed   SЍp@-@0M    SЍp@-M `0P@0& ed   SЍp@-@0M 0   SЍ p-@PL,M`P5 0S2 R00$P Kp0-S 0 0 0 0 0 0 0 0  0 d P0 R 0S U00Kph U004 R 0-PL P S  kro Khb KhbQ0000 00/ 0-@Lp00T000 0 0@-EAEϠDd2 lc!  S a b A!0S0l `P000II/@b``0C-`0F \| |L@ ^ࠃࠓT^ `G0L0F⌀጑ @SA* S\!: R-L Mp0  X`BPPX @ڒ P00 P(KY  ,1-L$M@p`P0S0 5 #K@21K \#3@!! 00SR000"[@0000 0R(K1P @ 0($ 1 0#KS 4k -LϟDM@0 oL @ 0T0 0H0 t?p P0X0 `?`P 0\0 P?< 0D `0 T PP (? 8  0ಐ@ yY%P 0<0 Rv@T R R (K@<@ 000@Y`%0HUS[TYXWVUTSRQPONMLKJIHGFEDCBA@?J'V9;\L543<16/.YSN><$#"! *nbaW$ESC .(c0<0 Y%R (K@<@ 000e@<@ 000@Y<@Z 0 0 S<  Y<@ K0 A<  <@@0EΠ80 呀/#bb  \J<402#  R@0 E㒌a!a   #10c0 0P) 0 P0R(K 0 S H0s H0v P0PHP0II 0C1c`A`a a000n0@0 08K 4 @<  QT80Y"1B00 L0 #K000C SA0<0 0 B?#K#K<@ 0 0#K< 0A ?\#K 0A QR04Kz/P<@< u@0Y0 @< ,K  0 !80A0C0@< pY Y ;0 A@< ] 50 8KA@< U0X0H0 80P0 MY\=0 Y`,K n1 !}80Y0C0@< 1c0 8Ko@<@ )0 gA@< @00 bB< @d .zX<@d  0<0 + B/R5=],Kl'7 ! 80Bv>C 0C0@< U50c0 8KD0S@< h  E80/d"b2#80 0@000 8K80A/@II<@ A!b!b0b0#@0 0  Y@< ,K c0 ! 8 d0DQvB L8 @<  E/"bc8 B0D0 c@0 0080h Y@< Y @0 0/0 A@< Y 0 |0 S@< 00Y 0m< Kd㑌?"cbR#c0c?o2K/dP?c.n^3c #c/o"<  MRm <@ \ @P 0 R#\ R @ R @ R 00@ 8K0  L C0P 8//O `L<0 @($  d 8 ಐx <0  S8 0 B Q00Qm QϠEdl `;P8 3.1C1"\< TR R @<  CR R @w X0 @(00 0$0z d  @<@ q0E㓀Ϡl10@R9d0<@S0 b 0$ (02pNi/ / , + ) 8% `8 ABLB^p^ P)Y@ bPA bNB QM B$ <0 @0(0$ z H/o<K"PzX @<@ 000@8<0 8JR @ <0 (00c$0 < T D0P 8 ObL<0 @!0 (0$|! < *P 8 @1 0!< 0( 0c$0 0 0 0XX 0-L@T 0 0-L@T000 , 0-L00S BW\00 , 0-L00S 2W\00 , 0-L00S "pW\00 , 0-L00S $W\10@-0?^"B R  0-\ 0 @S^ڤ  \ 0\ 0 ^#@0 Ϡ,͠ ? lH"!B@P  P00 0 0 @0" !B00/0"B0/0"!B00/0 0-SL@1/000P0 -@D0L M00S   劂 KhpU\// -Ly- -L/00 , 0-L00S fT\`o// -L KM"vH K w-LM KDPp KQ -LM Q Q [0  K H K0 K^ B0($/(/$/ 0Y.<+ < 0/(/$/R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@r P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P܋8U33a83 ?8  /R/  BP B0PrA0A/l1 h!0-L,MP`@0T(0  pW ?o2T0S= ?o2T0S f( 0R4 K HK⽏0@0!$K @S$R $B R $K $Q  X0$K $Q   RfKN  h   ]: S S  S]  S0w    S  SO  S 0?    r-00w-!-@RQ G RV ! Rs  0   r-00w-$ R= * R2 Rs  0  r-00w-" R5 0: R* Rt 0 C   /d 0 s 0 R-  0R-  0S 0 Cx 0 Cx 0 CS 0 CT 0 C- 0 Cx 0 C S A 0 ~c 0 zl 0 vb 0 rp 0 n0a -  h -L M0 PPP5 $P0 0epp! 1@ !ֆP =R Q@` 0p PU1`@PW00(K0ߎ 0 JL2 H"P-0L M |Kt l lpK0D; -` BLV"RM 0 p4 qP@eP-Tr +TP@0@ Ɵ  0\H 0KVHp8 0`DK .(0 ?0Np QaNPWNANP!7NZ| SRP \ " 00T/ VS? p `$K4\P P8 r00P) Q0E(K0 0R0, (K0P@40 00XS00 C R @ 2Pp$K` A BRVq 2p$K`w 㙙 0 0 0> A; -L M@PQ4PKT0@K婌 00p`ឌ囌QXW QV  WV*"00(K WV: WV 0S"0 0(K WV(K(K (K <0-L4M @0`@0`K?- -L$MP@`UH#0 00@ 000@10 0K0~`p(0"Si 0Q+ 0b CR Z~ f 4RFp0 `0*S xS S& (" 0@ +(K0PP@ 0 0@0 0 00S+! 0R`pV 0H R0O 00(K4$;R"00巋/(! 0 M+(K!0 C+(K 0 0R?/&1R5%&;R:*&6Rh 0 ` + ` 0,  +0?  p   -LtMp`Pd @PPK` P( 0[S( 0R K nQaG; \ p-LM@ `@` Kp RQ0-LM@@  K PP 0K0>0K00P m>91D #0/X00/8 -p``aLP@GQ# GQ ieX1P  U g P 0Y -Lɟ4M H T0 @ȟP 0L X `H 0S0080S ( (唨 D ( 0  8 |(4  < p(L P@ \}PC0+0C? #R} Rp #&R R! R  R _ R Q R  R *W   _Q R(KR a>#R  xR R R<0 >3 0QP 8 `P fW  ,`P80<00 Rp0RY qpR  Rw  R W R 0 >#0!> Qy> Y `  pkQE  R3Q*W_Q^Q Ry R+ ~ R zR| R; Rt>c 0l `cK ``P0CK@_W ^ G S # O  RIW ^F  .$0C>c@0@>C @!>#"R@D @ 0!P# > Q 01S; >30c`q @P 00C000 000q> `0 `f؀`P0 0 @00P>3000C00Y  x& -L%M @Pp4 Sh*%4  Rv kR R4Y- p0TT>#R} Rp #&R R! R  R _ R Q R  R *W   _Q R(KR a>#R  xR R R<0 >3 0QP 8 `P fW  ^P80<00 Rp0RY qpR  Rw  R W R 0 >#0!> Qy> Y `  pkQE  R3Q*W_Q^Q Ry R+ ~ R zR| R; Rt>c 0l `cK ``P0CK@_W ^ G S # O  RIW ^F  .$0C>c@0@>C @!>#"R@D @ 0!P# > Q 01S; >30c`q @P 00C000 000q> `0 `f؀`P0 0 @00P>3000C00Y  G-RM@ <`@! F@HvPpPP PQ>Q@ !Q CQw VQ QV SЍV>SP 8 Q`  Q >&QJ Q V8 Q  Q Q Q >S Q WQ Q >S< 1  eB̠QuPU8 "Q>S > Q  V8  Q8   > ^ >>S U  qWn8 jQg  d -L3Sw S6 Sr S@t S S04  0@ 0P EY4 0P 0 p0T:(K0@>3@1># R@004 8P  P0@ 0 JU8P0H4>SP1>SP1>3"SPE P0 Z0P  px>S@04  0@ 0P{ EY4p 0lWP P0  ppD S S S p| >S bR? sS 0>S R b? hpSrG-RM@4`8 FvHq>SU` %U 0U fU UV SЍV> R P  0 Ui / U\ F&U U VU |U U>PplPPPUQ l U U U U>Pp PP P Uw\"UP>pPPPQ>S U  P  ~XzYv P P>S UP >P>s WP b\n [ VXiU T -L4MD 4 0 @ 0 P(@80 l0H x#`P <  4 d80A/ 0 0@@  @0 0R V  V ZPp  Z U 8@ 0 pPU@1W  V- < |20 000_VQ  Z < <20   _Z R| V 2< 0 000_`FoobS00S+A?G0CS6 0P@pS40` 4 YD0VP[  HP000 `w0 w 0@P8 @}1W  Z 0_ Z0 S R q@@ 0p8 o@pp  Z  Z0Pq y0\ Z,Pq\0[ !W1p00Ph S0N Vq4(K  -LM`0PpV;*01>#Rv R5 Rq R@s R R0 0@ 0 HZ0` 0P 0 p`0T:(K@>3@1># R@0 0@ 0 IZ0 F0`00>3 ` >1>3"SH0 0Y0  px`>R@0 0@t 0m HZ0`0@ @@p 0]WP P00@ p0pC` R R R `}p`z >3 ``2qR >3 ` b? fpRo -LMeԟ@ ^h l0  (K E2 | R|0(0|0`00t0 |00h00 Vh0 0 l0 0 p 00 p0 S l0 0 p 00 p0 S|0* 0@P 6 L`P h0Su h0X SL0lb b\`? dp@l0PhD " Q2A1(A1( X0PV 0\0 HP @5L0p0 |0HPX PL0l@bb\` ? ᭓PH \ PL 0 !0 vP\`d0DᏓP\  0Z0DᅓP\  R\00 \` P `pP`\`PpP0 P-Lh8Md P@<p ( 7 S' 8! S# Q   ! \`K2?u`T  wq( 0R+$K u`    \`K2 aqt`l`h` X  qvP8 0 ,`5$   4 \ -`pLW * S\ 0 0S:00S000000]\R*l@ghPP qP0S PUT 0S00pt p@-@^&* 0 P0  r R 0  R00SS `n0L R00V0S p 0S 000000p0@-P `Upb0 s@    c0U `F`Q  00C 01>3 !/0  0-SL@ :0S000000 R [R.Q00?0 S*R .R 0S00(00000 ]R000 0 0-SL@P*1 2!2#S 0S 004000000 sPP0 -pRLP@`P ! p0pp 0-LM0@PS0S*  !K0 P 0  ;-LPM000 0@S40 0 0): q210S `sP pYsP0W 4\  1#2\d w40 壑)B@ T 020 T p`0V o P&  o P WD %:9 0<0 |9080 W+*0]S$ - S Q #R  -Sd [SQ%:0 S`*-Q  00000 P0p`W:0S008000(K0:S< =S R:0S00d8000 0-S]S0S0048000= 0000DR*0V0=Sz 0S00 ` p0S 00X:0匇S000-S]Sj ``w`p |  nP0S Z0S0000S     000S`0Sp8(0 SH D 0 0pCor0S hr 0Sቐ 00 S DR *0V0:S0]Spp0S00z0`S0050000-S]S %0 0  ,  000  R `hp ]R@04 "0-0-00-00p0W*000]SQ'  0RJ0p sd  tdld Xx `0C BsD0S! PJp0 `0 ` 0000`0P0* @04 " 00 00 0C0 Rv @0p4b0s0pSWg00  0Ss(Ko/0^S D  ]S -S@ pEԓ0S 002000(Kpp] 00]00]00p`-RN ]RK -\x #V0S 00<000\:p`F0]S 000(Kpp- 00-00-00p` 0 S00 **`0T0j?o20S R4 p000Q00Ss! P `Y00 cB"(Ko<`O V0pD i[Y0@00 0D0S!.0pD0  TPDp$@Dd X,X$! 1 -LM@`08pqP 0  qP00 0S 4040 0R K t 0S p$0KP0"0K0] 0$K# K"0KpP 01L , -PL`@  H0Da R % T \ !B d@@!` 0` -LMP0@p` S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjihA`Fp0:`FPEp  g0  g$KkC`0 g   g70SP "00SC  PE(  `p 0 g ``0 }  g0S "0S A $Kkp$K`0  000$K  gj  Ad   g^@ :-LԚE0CS_00I x R0S00 0HR *Q R\Q 0 ` 00R C  f80 S 0 ft  fP(0 `P\UC0 S0000P)1\U90Sq r*U P0S 003000u0  8Rf 0 f8 0  0 04 K 1 K ^ H0 4 K 3 K] 2 K 1 KH0 0 00 0S 00.}1U0S& ' 0 R 0 d H0 x H0 0 O {RY000S *,P 0PP0 S:0S 00P` 0Q|L000008<R\P@ R Q\P 0R }PR0S 00)Q000 0G `0(,(, J0)S|H [H R0Q P}P0`0+\  T~}|{z0 S-L|MP p| vj`S@P s  ŊP  0KXK `@ ` 圀  Q( P0`K80 4 p(,0<@DnH 00C 00 0 S*  0 S: 딀X0A$0I8PI0S R  0SQ0 P X, P`V`a *(K4p X040wpp ` R 0 P  P 0^p \0 0iPV `P0>#R ,R0 R R, @0P@`Rm >310>#R R "R (( 0>3S S0\>31SARP SQD(E" e2L @ 0 P| R(0DE" L0e2 @0 0100 0 =c 100 )0S00 000 0  IV@` @pW( ⸇P<@( p0>#R0P 00R ( (E De"L00 @ Lut -ML K 4-L@!MK 0C4 50|4 504 504 504 04 3t4 kPPC 7 9Pl8Jk00St40Ct4  Ck0=S0pS@ fTD0lT dt 00j 0Pھ0 4CKI@C  Z34[$S; S9 df Kd f Ddf = KPip$[R :n ,p4[ S  7P t4SNPM "V0p ` P P  P0!4P@@j 0 0  , GNK4t4 >!j0S.44d$T t "&t  ؍ ̍   X  $ x -LdM P@K0`qppKP x0 0p! |  0 ?s0s  i  t0Kl h p 冢P6t0Q @,@K@a@P 0V | 0t @t刡x00 0R(Kp\|0 0 0 {@@e ,a%ܵ  hc { -LM@@|K q-L4\M0 PP@Kpp`K!q0 x  0  i  t0Kl h p PtQ @,@L@at@ 0 @tx00 0R (K@ 8%ij ܤ dapy -LM@@K  -L+KLM @ğ `0  2 ^K"  0 " 00 Al-0WP %Px 1[ S S S S @#  S Sj  000 S S S S]0 S S0 S S  0C  S00S 0 0C  S00S@P 1[R @+SM -S51[Sp @Sg2SQ 2  02 p`0+S' -SF weP00W0pw00\ WP|X17 Ppt v0+Sp0S @S52"t ?o21[Sp @S!2SGQ5 2 a 02 p0S @S2"S `?o2 >p` 8peo`0W" 20 0R(K22 p@>1Kp m@8i @P $ , -L`h`-PPN Pa@L1`0H1 ႂ0 i@P/ aPOKKPN?K<0 =KH0 0^PM/K@8 @_81SZ30MK P zaP3sd0 L10 0R(K0 T Lo 4u $u 4u 0/LT0 0-L MP`Q0 0  0@K pK=x0 P" C 0 0 0R K8 !}8`P J 댟 s 0 0-FML MmK@p0(0 ɫ!PPBNK@Dͫ+ Pʈ$ d@d$R@( 0R K Ğ p0 -Ld0dM@K Pp`0(0 叫 ᛫|( 0R Kԝ //L0M0 R8Ѝ/0: 3!P Ѝ/q  8P00/  8P/ጞ H0-L@@PKM @%u[ 0K0q DQ0PM1SppЍ/0 0p-L$M@PQ0 0  4K!`Kx5 K0R!C0(0 0R Kp8 )}8PP p  q -LM M( 0 0}K` pG0@00 W `P?0? X0 0ZP0:+R00" T 5CK P  FT0@T_0 c@c@(0 0R(K+b@bX@ QNK @DDEpF L  -ML0 Kp0 -Ld0dM@K Pp`0(0  B( 0R K뀙 80 4 -0LM@Px p@K00 000    @0\x ipjE09@ pn @! !P@l9`  :E0$ "@=000p `gqh , @P Ydc1` ZEmP0 @ #8 E'0f!`吀 \M.0 Y<Ͽ8o0ZEP0# PXdApPi=a<_p jE`p"p$Ti P'jE`8`P ,c P]଀ 0.EL 0<Ͽ-@eQ0#8 p` m@ Hb!E0%,0p 8y| ͌#@ D0zEpfA|`p" E(lP@`3 0$Y06oZEPnᜀ  <0#p0`,a!Y=`p  ZEP8P &E8@ !㍈4Pc1 4O`" ) )`5ϿE@ hAp )`&p `#m' aqYZEP韠 *Y|ZE㄀ P , !0P $ %P圠͌fa.` ! "P'`傊E P@0*lᠠP% @$P]ฐ " 0#@nᙙ0# 傚E @$ ,( @MeQP P/( &y`()zEPp .`菠 `*P?{%P~Fp(P`& dA) `%P{韠~F㔐 p(|P͌ p`&)Pn)P菠F㘀 `P p$m p'(Pl )P (P韠FpPp (p |P*@P%)pP}@faF|`  )@$菠] )|@$ 韠gq`p 圀@, p((࡫` ,)ٮF ( )oᄀ@$  @eQ` 填|`@$(ٮF ͌@$`np (࡫p`韠@%| ٮF【 m @$pl) 填 )|菠ٮF  pP@填 (@.} )@$ٮF (P@fa 韠|@$࡫]@$ (gq ٮF  @&@$)菠儀  ࠠ@eQ) ࡋ َF'*韠` `ଐ͌n ࡛@%ٞF @$p p!ഀ @ "ਐ!F㄀@ "! "@P|0# m0#l .}(Ffa ᘠ,/)  P0#  Fఐ]gq?0  " 0$&@  "(eQ0#F@'@$`  ` @0#ࠠ+.F ( @( (p@; ͌)n@>F0%菠Pऀ )0+㜀m .F)*ठl .p }! (faᠠ,P韠ᨐ ] (gqᨠ|L  OH@  )0 @ ) (eQH(韠0 (` 0菠|, | ͌n)0 /H 0)` ) pm| lp韠 @ ( 0@(H ഐ@P}fa (P@ 菠 ଀ @ࠀ |@)ܬ )]@gqH  儠韠 0H@* 0Ԑ( ( 吐eQܬ @  -n0 H 0)@ጀ` 0#`@ఐ ( @H p *@p❆ba0'p p   0#Hp P0#Pܬ Hp _Mp,i|0 P  p' p'dP͎ _@堠, 0 /H 0P $`@*`P*L p`OH@0 0O `'P`&@]l `&L pOH@@ ᰀp ࠠoᨐ` eQ` *0'p*l * 0@oH`p-`)ꯠ n@)`p< 韠$?H@0 ༐ 0p| * (*b!L `OH@ꏠp0} `ሀ)Pa)@ԠP ` HO@ @ 0&`0#@]@gq|0#ଐl oH`M , ea_|P (P  (|P 0*Ƞ  Ϡ 0#HP- 0#dA ̀)ܬ )ༀH P|p͌)0 p韠Q 㜐 bᔐ 0#bZLP$ 0#pP` l !!  p'b*L o` ` p'༐@p'` 0) 0#`P.֑ `0#P%`bL  P @(p p  ]aa@$ p'*Ȑ@p'Me!.|P 0 0#bLP  ̀ b L&Pd,@p p%0#p'@ bL@Ƞp'@` "**p p͌`?* `(nᜀQ bZL)P P !`&lꏠሠఀ P.ऀ P%p*A `*bJL@p @*`&! P @,b*L ]o@$a! )ꯠ删 bL|)   pb Lᐐ @(*)p *bL)p)ꏠM.|eQ ("p0#,! dA(| %pb*L ͌韠  Q n 0#$p'bZL㘀P @ !Pl ( .| "(?` p' (@֡ 㠐P,bL  $P%A `&PbJL@- a@ `&0)*0#]菠b! o0#ਠ A p!bLbJL@`) p'' (ؐ͌ eQbL"А la ,@% ?ց `q@$bL 00&!P\x0 P -@`]p` p `P (K-  v4!20AEFNI#L 00 00 -LP`p10Y00>0ّ 0?S P a$Kk%U@@i  Ui V0@V@1 -L 0M0pK` @P 0(0 R0 0R1130 0~? S  0~? S V`F  "0 0R1130( 0R Kp뀀 TU 4U 0 0p-L$M@PQ0 0  4K!`Kx5 K0R!C0(0 0R Kp8 )u8PP >X XT -LQMM0 0 0I~K`pG0@00 ~`P?0? X0 0SP0:+R00" T 5CK P  T0@T_0[@[@00 0R(K+[@[X@ RNK @DpG~  -ML0 Kp0 -Ld0lM@K Pp`0(0  B( 0R K| 0@-  v$1@PEFNI2 A3LA 00G-`M @@P`  @0\ E ; 0E @4 ` "*   .  a[j X !0 " 00 ,$a  ;< + E    j (@lɁ .n@ ! @ +E,@ p@P,pP%p'PD@{c;pEp0@lˠ eZ p@ !(`()Kb+@E@艊 4@a靎pp@%L`p' @$` p@E8`xdLe[0*0`);h*0E0  <0iꬁ, 0$T`g{ # ̀0E0dK #@0+8`nP0*#[0PE 0PjP#D0 lˠ\` 0"P# \ 0ᢐE0 b+p#H0艄@`a@0 p#pKi0@E0@`  @#L0gy$@0(*e[;0E0P@h 0 ꨂ@, ' "H0 Ki@E@lɁT@g{ 00b-@ #0*,`0#n0K@E@j` X`@P P<"P%*PP@lˠ㢠E eZ\@ b+<`*苇 p@#E@$ 8`p$A ic;MLE@g|` @( %0`!. IhJE@L`@ ' $  "ME T` Ig{JE@b-e[ 0)@! @@$ , 0,@i$`$ ɀME IaJE .@c< @")@<`@$$A MLE@H`n,PIb+ JE@艇 ` )p@#P@$ @$ME 8`\p c;lˠ@ E z @(\`@$ * IJE@T`h$ i@ME ' `   %,` " * IJE@4`g{$ n,@ME0! e[0 )P`0# *0I JE@H`8$A ˀaMLE@"i @. @*@$ @b+ᙩ茇E @#X`@p@$ p$A MLE@D`n,PIc; JE@gz\` *@(P@$ @$ME 4`\ hႪE  'lˠ@  (`* @ @$ @E @`g{$ L+ME0! ` 0%X`0# )9a:E0P`ꪈ$ 0"n 0ME e[0# $ b+L`)茇 9* :E00`)p$1 ̀pM)p=F\e[g{0 000#pF 40dKˀ  >)n$p=F 0 )PP,>lˠXp=F0@00` 0#pF@<0J 000#X0e[npF > p=F)dK 8l̀00 00#nD0pF` 000#PPL0lˠeYpF >@` )p=F@@dJ0)P>e[p=F0 00pF0#dK (0̀  >)nHp=F` 0 )PP >lˠYp=F0@00` 0#pF@00I 000#T0e[pF 6 dK)m:G @0̀0. 0n0#80mG 0,P00#lˠP00mG ]@  ` )6@$m:GdL0% 6)e[,m:G0 0$0dK0# L0mGlɀ 0. 00#n\0mG ` P, 6)lˠP m:G0e]@ 0 0` 0#@40mGdI 0%00#e[P0mG n $ 6)dK (m:G0ˀ0. 0n0#T0mG` 0,P00#lˠPD0mG [@  ` )6@F,0 jl}[0D 0#^F0Ph<P\`P%+P.F g{ e @P! F⋈c; $ ![^FPjPy( !PF8h<!+g{.Fn  !  c;b,F ! 8` n[ɇF b!T ࡋَF `=L!+lˠ.F 荅 4P Fbc; P "[hp^F,Pp$`p' PP H=nP"PD`bˠ " HP#c PL 0#ܬ H h{a(H < (?H 0 0n[jɌ . H.0 l@ 㘉 ,H,iP `yH) g )0`, ܜ /H0' 0 p'a[ T H<`쫊 0!, 0!j{ Hn<  *?H 0* h\`ܜ +0(H0bˠ( X`aY 0"H0e ", /H }40% 0P%g 0 8Pܜ c=H'0` cp'  Hb̌ # l[0#(  a , j{,N-S)J 0 *0 *h NSJ j0#04 n;N  SJ)DPc;N-NS)J ,S 00 00//TXH -L4@KMp Pv``PW0E>S 0!31 00 0  ^K>SL 0!31 00 0 LR00HR00W/ -p-L MP@U@ `0 ` P a 0 X0X 08 R;0Kp0( ( W,  DXQ -Q =QR-@+R 00/+QqoQ uQ gQR     +S -S =S0P00@/     0000000@-I0PXS oS; uS7 gS 0+S -S00PXS^ 00P r  R  @@PSPQP@R   # !0  Q -LLM@P\T <@KLK0 L0 H0 D0 @0 +㿼pὼ #@k`P 6 00000s0S+X0 00`` \ 0d0 a0JS  'C +Z@ 0 -SnX0=Z0X0 `pP@0X0C S񏐃~}|{zyxwvut%rqponmlji dI`IppX 0 |X 0 {IW R:d0`P0h d0 僑 lP h I `  e \0  00 =Zl +0JV?o20S Rf*\0XX 0B00` R:d0`P0h d0 僑 lP h I `  e \0T p0 0 tW6X0=ZS0X0 R:d0`@0h d0 僑 lPd h I `  d \0  00[ V R+*\0XX 0B``Za ,Z3` PX0=Z0X0 0X0 d0`P0h d0 僑 _lP- h I `  e d0`@0h d0 僑 MlP h I `  d "P PK0  P00S@tP0"S 1Ds `` P@P`mPP(K>0S^ @@-0/+0 0(K`` X`+Pp-@ +0B XR R0p0 +0B0+R XR  -Rp    X@PPQ`N`@(KO00O00(KO`` 00@S 0-ML K    p` KP -L 0 1Oo`/00/00/00/ 00// ///00/ // / -L@P`eh P% +c Pu 0  劺PhPP0 rpsP x000᝺p0+= Pp 400O@N0@x q f -P@L`rP ]00pԹ80p0 ` @ N00pŹ 0 -0LP@`T 巹@T0rS 对PpKh覹夹P e坹0+SKh[D  -L0K$M, #P1K0(0 @W0P$0 J 0100SCNp@$ P C 0K$0( 00S.$00KF K  @,0*㶺fN@Ch0( 00S d+$,lDBTN0@K,$0H\,  p  -LK$M, 0,K0 4 $10(0  0P$0 A 100S4p P 0$K&0( 00S($00K K:4 0,Z N|0( 00S@ dл$kM0@K, ཻ$0F\T`1 \!0-LMp`0S581PU 0V90S P@T0S7MP00000S `KM0S   4pP k PKykKdp\0PULh@40 0 $\E\Xt@ 0-L,PKl`KLM D0%0{p@ pp@lM0S &wPpp0S@#W /k(Kp hpP 0  Spp p Ÿp@DM0SvP᷸@ -LDMp 00 `  xD0/#K@0040 0PD0+#K@ 040 X@0 0 QR000 Y0V0>> R0P"@ 2 =L 0`p 0a3P0H0 gH0D0 0Y:0XXCK 0 $H X00Z0S`p@#0 R!0r 0o D00Y:`%!E"ORdL0gfF40lH 加0  00GAd"lϠ Gl@l@0<(KPB0+#K@040 {0/#K(2040 t20H0 D0 cQA d@P A0 0@P@Pq2@TPV0P ܃K 0 GP`0pZP (K\@0!@240d H0 GL! 00L1# P@(Kd0P@0 0L0 @ v0P P0 0 0@ `P0p`p`L0 p$p`d0P@0 0L0 (KGzGd 8 )  ,  $B 0 @0!2@PG-M@`P]p-*00 Q:T0 0? S2 [ S3 S S+  VZ \ V Q@*T0? S [ S S0S;P0S `Ѝ? S@ !0R00 00 R P R0 R0 SR R# 0 0P`ER 0S0 0 R pP/// -LM M BNKp 0@D`P+0(0 P0@$( 0R K03/Z;  -@L`P ``a V00"5JP4 EgpPI 0SH  p0S h0@00dP/ T h  P 0  0  ! 0`V*o`dpP T 0p 0S"p`0J 0 @ -KM`L\b M@`0p0P/00 T7 /T 0  0@@T/T  U00 0Rj(K^@/T@UU@/T p 0   R0=K@ 0C 4 $0P0   0S00/ 0W/S 4: S S 0 00%0CNK+ P 0@P4: SW/ 303 101:AJ/ 0@@ X(03/`9  -` LNM Mp  4 0P@4 0尠$ 00 JT#*0*U@$@0 R R0$0a?o24 004 RU0 S400E0 P04 04 4 4 40S 04 fCK+ A 0@ G 4S 0@3$04 =K 0C4 :/P 0   R  * S .R V[ R   WT: R YN4S] 4S 4$8P4: S $P 0I GS/ 3 I1$ 01 0 PG00K 4 A$0P4: SU 40 0R(K  .R R .R V R  @" 03/Y! 0I  LP 4I 00fPl 0$ .Re u (<Y+I0S4  04P%0S1 CK+ P1 0S + P@I 4/P  0 3/ 0 H0/ 00 0 6   6-LQ KM@  U H'?`  0 (700 700 700 00K0S 0 K0 A09K09Kp P K PYrr [0[BqQ Ru l [BqQ Rn k [BqQ Rg f [BqQ R` i [BqQ RY j [BqQ RF s [BqQ R t [BqQ R u [BqQ R3 p [BqQ RU o [BqQ RK n [BqQ RA m [BqQ R: x [BqQ R w [BqQ R v [BqQ R00K0V-:U" 0 0[Se`pB<00`p0SnVT 0 0S}0 0 0R(K0  ^P ᨐ 0[  00K    30000K     30000K0`0[S  @p T P# 0 0 0[0S+W 0F 0B00 AU _p B 00K B0[V00 0S p` B00KB0[V0 v0[S V^ `F, 弐 A ਬ^2@@෬p ,@K00 h$g 㑬0[40@ @ 0 @K0 X ` `( V& ̀ |`V c[P% ;0 k m0[A00 V   Z0[0 A`Y0p0;`p0 ``F t B`p`p`p`p8  ,< P L 0-MLˠ0 K 0-L@MP@Q  0ˠ0P K0@K0Fkp  ZP  H -L@`@0S&@@Q)pPpPP ^@Z P p 8SN@*`0000 Ӭp ˬp X -L`@`@ᷮp0P@T `0`0 R@@<hP00ᝮ( -LPp@`P@ኮ0@0S @@0< V"@3*hzX9P00@@l@k` (  -L0 00L( -`TLMP3pP9 0S,L0V " U@ K (K]0P (  Rā@!Rd T᠁L#a0R @0pL00Q*G B&R&>$#"5 . ᠀@`000 `00tF+dK&TA 0  D        \ 0   5-BMLM0씟L  @  H  0    +0H*P08   40 4寻P BnKCNK `F@D\ @` P 0S 8400#S $TPP\ N P 0S S3P0P\ ? P 0S S3P0P\ 0 P 0S 3 0   \ ! 0P 0S T30\  0P 0S $303@Fs+0c,PK `"7p2D%0D4 \  @P( 0S :PYY '<PD40S p<P] TX2X0T $_R@20P,RCNK@DP\  PX 0S 100#S9 \  P 0S 1a0`\  PPG 0S a`P;P | P;P2 d! `1`Q0P \  0P 0S ,10\ u 0P 0S s 0 L40 0R(K0 0 00  00P}0|  p   l 0 H `4  \ L  3 p X 1  0-Ld@@ 4P ܮD`D`PP g / D0 -0L0S fP PxT 0-LPP 4@@(;P KP00 0-LPP 4@@;P 4P00 0-L@@P0% 000h S-L,M80 @54 00 (KP%< @ 04p`U 0|  0s0?S [S \S<0S U @p\0 o  i0SD0 X /S D0U0Lp ^S!S6PX00X0 W: X1P % X00X0PPKX E @pXP0<(0v pXP000npl5P 0, ` XdpL5P 04 @E X@_P$$T350TV XIpP0  D `@Xؔ80< LpKD`KpX840P 40<,4 0pX[Π!t4 p0pX[P4 L0pX[ ,4 (0pX[4 0pXPP3 0pXPT3 0pXPʠß#3  @00DK$HK.B@K>K3Ka#8` 20KpLP8#K,Ƞ K:K @6K4K Xp6 P [R 4 0@sqY?  X3K7K;K?KCKp   L 8KX<KpXP   p P R H K@KXp   H4  XxP` TLTU 10@!`H0 0\p⺈4K#8B0K XC@KT@t@pP005T0pAW5XV2H@00Ud00 0R(KX00X0$! ,00 X.10p%[   jT hT t  C/QU0 B/T@/ PPP@P`; ``00U&* CR0 B! /QU 0C/Q0U C:0e#@T@!HP@P7<;:58570 0K0P20S`p 00X 0S60"S 0 ᚗ) 22WV0(KV0 QP060 (K6" 0 , 㡡 0-@PL@ 0S 32@T 0/S0A /RS0C0/S% @@P; P000T*0Q/S0A SC  S/R 0SCc#@T@! @@ l 00-L@M4 KTKD L0 @@0 P<0 EK١p 0KS K0 -L`Phcp@ Pp V U ㏢d p` Vޡ@T 0  B 1/R/ 0b01"/  B/Q/R/ 0b0Q"/  B0/R/2 b0 /0A-% Qoo @l\L\5 \ APOP@@@P$!/%1 0b l @L,R Z`l Pf8& @F%pL8$860G 0 g0H:`L1F1W0G-1 O ! PP0Soo @aQAQ: Q!"apo0`  0"aoCq$00 pf`aq Ap 0a2saV`A@ Za n:n N`:hA:~2 ``p3: A3 0  0 [ 003Dk{{+C{7 Q/ A0C A -{LJ KhG{ Qp  -zLJ Khgz pP -L ` Kh#500 ?0/R_//R_/?0S/R_/P/R_/ 0Q-L4M  (00V K0R K Q -00PL  do -L# -LPMP P PP@Tt$ | \00*-K0`0p:`  @ ` 00 R pRܠ갯80 4 0-LQ4 KhUt4{0 -@0L4Mp`P0(0 TK PLL Q Q Q c4 0  ,H㴠0( 0R Km4 !,0@P/ P b/ -L`pPV! @/0J@S  R DJ0U R  RS0@0D@R-B0S0 0\ RN^0  S -L Mp'Pa`WP@G (PB  6(pPB 100 X/!0 aV0 Y(0(K4 00 (004 P0 'P 0 a0P '0 00 ,=00 ,03 0 (0 -LafM M`?P 0p6 000 X cpL 00CSJ9@GK @Y>KD 0CD 5 *_^KOPE#5TAXA\A(SE CKp   0 U  E E @P#P060 0R(KK A␟p 6: S 23O000-3 0 (3 0 Ad L 0-   --L M   K -- LM0 0 = K R-Lr M`@p R00?`% #0 P @0P P0 00P01 1003V^P5 0 K4K#YP XI 40Y[VP0P0 i   0 00% (K4 PLP$ 0P^qPVP`C0 PP 00b%(K4 Y .LP  0` %LP 40l -LßKM M` p$ p @ O 0  G@T PRPcE V/}P J200F2@0040 0R(K R f R42?00 UXRY2FD @0 XRM>0V  D TD0C.K4 $  c;0 V *0/S0IB 0C/R> V0hq =Kp 0C4 ԔY& -ʜp'10S4U ܔ0 S00S0 U  P100D 4S ᔝp @K0 A0 /00Pz4: S 100r፝P 1@@DOoBg t ȯ -@LMh$(0S@ !0 # e 0S  0b`[$0Q P!K00 0`VS <0`V (0PP1/0 Q`Pp04$`^1`T00`*$V100 -L 8MPK p@00@K8! sH L  ! R Hp` LKP` D` _ P@ 0R K$1@ 001@U008d  0-@LP#P#0 0-LM00@P !R ! !R R50Kp4 p& 0P  0 l0 K0 B !K0 R   A 0 A^ 0 00FP 0@00 0-L@v#Pz#0 e2 R0-L0 @T0 E2 R0 00R0 bNP ^NP ZN<P VNK0hRN -L4@`0P@PE 0zKh=\ h 0-L,@,P@P10zK0h*<\h 0-L4@4P@P$0{P0[ph1!0C-M0 P0@0S0  XR0`S8) p@&  X0@I 0X   A0a0 cB! T^#Q.S @80CSЍ0! T0^0#S@lN1SS  S00@ ,4  R  *4 8/0 0X\S 040:8 R РS /xB -Lp`L L0 H@P X   ^X P-L`@/0 2@- 4H@ | \ 40210/,+|qP^񏐽] _GJ=&0?Q0000 U =U UP,̰@ ` (701 0`S;UPcTwpq@dT 1\  QQw0 0SUx @ <0000 00 0AnSR PONMLKJIHGFEDCBA@?>=<;:986543210/.-,#"!      100ES0100C0;0004-Q0 ^Q00*,000 0  ;U 30000 00 C10PP #U 0 `0@\A#o@@,%Ao &Ao =Ao#4P 0030000   0070Es0 00Es0 20 U U 0000 e 00Es0|0W0Cs00 0000ES0100C000P00000PE0P00000 00 00 00{ 00v 00q 00l00g00b 100000W00S00A00PKq  0W0Cs0l00000   00E70Es00 00000,00( 00$dTS4 ܤ , -L,KBpPM<0 0D 0)10K10K80 X0 `0@0 <0 8@f@0S T@D( 10[`0FpP@0V 10[08 8-8 00(K1- 00(K 8;P W D0 c00-0 0WpG 10[P0E0  00  ࿗ꀥ -PAL`@Pg /.=#C"##RcAqT@ 0S$ U2 10 R |1003/P= p$P $0000_)00[)00W)P00 -@P$aL`3 $QP00BP6 0  0^ @:^0 S \S 0@ S @ 0:S@ P0P F@0 0 ) 00d@-:S 0S0\\ @0\ \:R0S0@S\@S :RS:S 00/(>A -^ 0S:^|^^\ RB|S 0:SS  -LMǟ Mh T$  l P4 0X$ 0`4 Q000 ^Q PG@PU P   -B`P T40S ' d$ \$ C.KH$ PP0 00@ H$@p:Q9 \Qp Q Qpp pPU*`R @ Q W :Q +HPPH4 @@T QW PFpi L$ PiTDL$P PZ `Zp`c #QQ `X L$ NPUx500S h5 PL 0H4 0X4 = HpP 0:R P0R0CKpK @ pGP4gT$H8@P pP p 0:R@ @ Ra a 00S:S:0 00f iYy e P@| x8 `EpdL$`HDd$W0 00 PT4倒0PP4 0\4 6\4@S$TZ@ `0P4 T$0ST$ PdE aE\4S ' 00P`40 0R(KPjPg@ AP 0``\4 廖SX4 \4S1l$Vi0A0$:h4X4PP PZL4c`c pcPcoCPC `pPL sX \:00e0X4 2L \CP 3P!P\4@S PLPD@DX4CnK}K`F@4 "< P0 5/p5 P. 84PU4$0@4 0B<4 LD\4S38DP& 00tPE_ov"Rp @`P+ 03/Pl4ph4`[P03/VP&@ D&@K&P 00GP庑&P@D&@<03/P& 004갰 t H; 0-ML  0K0 K 0-L8@@ P 0 00 0   0ww t3-LlSMh# MP @ H 0HCD8 Q0@8 00 @80 0S Cs c@p`P  R K A P} 8( B8Qg " R#:\ #\ RT RQ00S\S00 Q|dRCNKnKP `Fp0S6\S4 00S0 :S: 0 088 Sc04[K ASi |S:Si  A:S|S 00S 0@(AHh0@SBD8 00QP(K F P 88 0 C P\R    0S `P  `` P P   P HP a& 8 0h5P D A.K \whw9DCBA@?>-<;:%86543210/.-,+*'#'$#"!   00A 00A 00A{ 00Awptq0lB0@0~$ 0 y -LP= pP. d>P, pG`d0 :SS Q0@fd@dP  `Qf@A @P 0B00$ 0 0-L@# P! 0R  <, 00BaPBs QU70BABW0BQ^0 0XS 0@3 -L4ß0BM`M 0@p84 Q000 v /< PP7 䂟P  <T$00CS Uc C K0:S 0$ 00840 0R|(KPCK0S:SR  0S:SXh 0h@4 0@$<D   RE D4 ࿎D4@$Ẏp ൎ0:S Z#0S#00UP R0 00 R!010@0M@> ᯎ0 @$ 0@$;CKH @4,KH$/0<$C#D$,0K0 $CQ00 @$ 0 ` L  Ё d \d c 0 00 ꐜ -0-L M0 P@\00 0 00\100 M\   0S0,00 P 0RK0\ 8 0-L$@Wq@#0T jH -LŸ`4M p@ 0P000 kx20\A D0KdK 03 P@U SP0 %U! 0S0 U 30 0R(K P07P 0C 0 S 0PzS*g\[ZYXWVUTST=PON*'*z~}|4z P0/.qo0)j9fe c 000B0H303 0SOX3P0 03 P3pp03 ;003 PC ,KP0C0?KA ` K0p- P 3SHH0p0PSX3S303 303 P 3Sp,^W003 @3 ?Kp@3 W |: $xZ03 P03 0# #[,0K0 #C#@0-S ]S S p,0K#[0C #C303903 0S P03 0000P 00C0S P 3;3 303;03 3# #   # 0# 0#S)# 0P3 0 0P} 0C 0 S JP p3:3 0#S)# H 0P3 3:3 303 ~0#S # .P0#S,# 0P3 !00C∀g303 c0SYP{3;3 Z<0#S, # P #0S P 0S P 3  Pc00P0X P0h000p 0S P U 0@003HS3@C0SX3P_ 03 K3P# C p03 $6003 PP ,KOK0CP0?KA ` 0S p P p0S PXUCSU 3S0303 p ,0K3PS 3#HS0p S# P3*3pPS 03,K  #RR    B X 0S 8P 3UW PSa #s  # P 0,K03SS P0X 0C B S P U:7U7@S 0 奾0P+ #3  # 3]Y 3 wppP3@03 @ T  ptP P3#[ p! P @ 3 # 0# 尐 P P 3~33+& # 0#  P@ U 0C PH uX# 0# P P3  0  Up U0H S?K3 P# # \003  E1 C  @0s s 4 0GpSWf/b(W8 0p B R T{ pPX$0NS0AS w w chb`b^i WVf )W _WoP CPERp1*U U 003PR0 3#3 K # 0# 000S 3#bX303 X3P 03 C ?K3p3  03 <1# C003 0@XoP(C C3S#00H堁q/KSc `C ]0!p0# # +@MQpnlk]\`_^]\[ZPONMLKSRQPONMLKJIHGFEDCA@?>=<;:0/.-,+3210/.-,+*)('&%$#  #S\@ 00C0S000pW 3 T]#@@TC @cyS XRr   g0#[  # 0# 3# # #0b# # *T\@  ]@ @PX@]@+0G 0p@P S, pPNW= 80W IW{0p@PuS pX# R $ R XX BRp \T C0`@#0EQ00 @`3 3S 0pAQZT p +0G T p P  0p B Rp 3 3PT P 0p B R TX pP03 3S PP3S3Sr0#[AQ hT P0p`@ 0p B R*T" pP0XSc 03 .P C @3cPQ 3S P=P 0pAQV p P# J3'3pPS 0sPX0#0C 03 00 0S P 3 s 3 Pe0OPP 0X B 00 R P # 0# 0# 0C3 43iW nWB0p@PFT pPbR 0@`@W ,KK0C P0?KpA m` P0p P p Rp/ # 0# Pp @p` # p KcP3HS@PPp)# 0# Ry  u # 0# WC Cn 3pPE wUe-py0F `C `C S Cp CP 0p @ RT  pi CP#C#i # pe Ip`p^ 0[ B R:T &  CP0p@PT Pp03 T )3 CP p# .#S C # S- P2 UC C p -L@P`p 0 P  0-  $vp02 0-L`@z "00S7  0Pu 1S010a T00vpP2 0S@0P P5PM 0 10 P0@0`@000 9 T30P2 0+ BA@ #0Q 00 Q*0RW! 08 @ <  B`V  P00P0s0F pp0 B 00: u 0-L@P&  P( 0 `-L@pPt t p ఀ ៹T  @0 >ၼ$ ⌹UPsH ] 0 -Lhǟd7]M px  ZL @0D! |1 0! 00 b z P40Ph1  b`40Pp1 o 0SP1 01 n 91 @ MK  U' haPU`p T U 0 1 #P0?0Si PqP0@PU`p0h1PcEQ U P!D181 ?`E40Pl1  0K t1 h1S V 81l! BSl1  p% 0S 00S  D% 0S 00S 00 00 00 "00@\0000) tpU* haplPU% 0 7/PbP00l06p.6h,6*6|10 0R(K1S@AV  tppPPpL1S\ 0ST1  \1SP? p1 ㌑ X! pTX X1 `0d1 Q?Kq SOK1QK C c:_QOK@ P@@P@RQ! R*X1@qPT1XQ U*\1p0S\1 P10P1 !0lRQP00@5p5h5d@TQv*SK` 03>1@- 0@ 7T0@ S\00000@ 0 00@0 )@a 0\ @0 !@b 0@t 0@n 0@v 0@f 0@r 0@s 0H  5\p \0P 0 Gr R~@\ 0 p@0 H0  00000  0F VSH0  0F VS`(KP ?000@0 X  j Q-L@Pp`! P= D!0D/o"]S00SlP X0T"@=0 !1 V V0 $KkWI I -LPp@`0P_T !D Q( D,TRT0T"@%0 !1 I&2! 0 0Kh)XI -L@RMP`p 0 ! K0 p-Lt$Mp ( `@P(K$K#0K0 $ K`@  P(00RKp? c  p-L|$Mx ( , @P(K`,K00$ K$ K`@ #K P(00RKpb  -LM K00,  K -LM K K,  K -LM@K0,0  @K 0-LMPK@ K, P@K0 0-LMPK@  K, P@K0 p-Lx$MtP ( l@P(K$K#0K`0 $ K@ ` k P(00RKp` lb p-L$M| ( , @P(K0,K0`P$ K$ K @ ` #KC P(00RKp| ` a 0-LM K  .  K@a -LM K .  K Ka 0-L M  K` -LMK0@0 .0 @K` 0-LMPK(@.  K@K0(` 0-LMPK@(.  PK@K0_ -L-@P 0P0PP `80S1 -LM @P BS QK0`K0& p0S   0-PPL0P Q 0S @@l10Sg1K0hc1 -LpW P@PET `@P`` -L Mp0 W$ @PJ@T `a P00SQ *A@QpGp(K (K0 1p0  0-L MK, ,K(0 $0 ~ K 9-L,KZK< B S,PEMM<9P0 @@,@ L R% %< R8 R$ T R , \   \0 P H0 H0 ,H0 8H0Q @PR  B8 , \   %H0  00  ]H0PT Z ,0 P  L 0  b0S 0.S4L0S,0 00 XSP00CP0 0P 0\0S X0XSWD0L0S,0 XNX0SU p(K@W `u.V4pD @,0%<,0(K00 00@_.0 8 \ <  T D, B/P S P0 0 D  XH`@oo  @Qb b@8  v8 0\ <  T (0SX  (KoD 0p5SD@05L4p0$04 D @8kPQ ,D \ 5057,00 < Q 0\ S  0b00Q0  R   a   R 0L \RCD 0$0WD0 t0@80+{PF D ,0p%<,0[ T w,0 < \ 0cu 0 -L MPp0d+@Pk `P(V,P  PL  UP1RP UZ+ 4`Pmt0, Pb P0L0U 0` ``PU# % 0PD  ,PPA ,0\L0 P05YV0P 00`0P PPUYX003x!, yP , 0` 5; X @-(KP `UP1V ^00V P*-U &-$-@!-(K  0, `?P;@00(KXzp,00,0 0,%P `N M M  0 -SLP %-L R.@T@,L 0R,P @,TP ,,,@ @,zp` y,(y0@py,W @p -LPU ,,5S S+ %RE ` ,L0SA 5SePU@`T`},L0s  ,0 @L0S,0@ $0S005`5 CRS@T d!WVO 5P @S,T05S,PPzP00\` ,0/2P V P p 0p$ !@S 0/ \, 0@ ^00  @P   ,@,TP,0 5 5 @005v,0@s l2@804Pj ,0<,0lf,0@(yPr(xU xP5 S(xb0 @8 P@ @5T0 5$ 0   0SyP,  ,NP 05s]0S\d,0<,0,0 xp(! 505,0 vxp($ 505k+ @@0 0  0%$0 P(mx P,0<,0x  0%$0m  8* (* D* R %-0Lc 0  -LL`PEpU @,0<E% R0 RP @+T V` L0S00/S ,0@ 0,0`<,0L0S  wpp@0 xP x0 0 0w0 0 | 0-LP@0S0`0 0S (z(z(**Khw(z4B\ P-LBM R   hh ANKX  P2 P|w  A p' 3 `' B 0- L -Lß@M r Mp`P p( O RH ~K⸂ pG" 00 ( 0R KBNK@DP"p 0p 'w0 BNK.@D !0 ( $  ˯100! 48 0( 0(48P Q AA+Q-<+*)>'&%$#"4   p Q^c^DO@ & 2 Lh& @ X0A % 0 ) 0-L@PR T00S:k0cS0: A 0 0-L -p@PD\Ml0  1 pp K0-S, U0x0  px0SPK (K@ PK (K0x0 p 0S 0S  |  0 C R` @T0`@ځT00C p @00C PZ  ERE|  00 pp0p0 0+S -S  00 0p0 00 C Rpp .0Sp  p 00S 1 CR"p  0 Cp 00C P  p  00 B0C P`R^ P b0x0 p E Y  jTpjg{ @Y  Z{ 00fk1[kk Y 0j0S { !k{'{ 0(0|0 0 00P W00g0 ?0 < ?O @0 P ˟ @??=$OcQPa01 0 `|0WPP  U R`bPbpbQ $@P l P  l l VlPl  0S  P UP W@P{ lPv P0 0P  UW 0` ?C(K`oG `GVp |jVQ {Nj ȋ:S㠋 HUH{+S+S (K0k0f0 dK! {{ { ` 0|?G0SQ l YP&    !v\KhK Pl  4@P h0|S\P  pp c0a00C S6PeB00 00 H|   R-I0C%S)'&%$"!  {e x N 4 UH{kWkW "`hKPkG {7!{ [0XS xS p 00S S  | 4 A?|pWP d0S` R0S?G0kS0S0S P` |0S?G0z 0?G0kSu7Sl 0 P9C0 00 ){?G  ` 0SE "00 U ppP \0  Y\T p 0  0C P P0p  S  !0IS`ځ1Y Y\Y1сp p 0p0 0koO`c6 0 Wd0`S~ SC 0 ?K㦋(K0s-P0 ?Gd `0 Z lqom k i"00 &KdK5L!` *KF{0?GG{ { ` 0Si ??GR ? ?Gd `0 @ 0 h _MS#2Sj#{ 0 k{'SP{ ` 05&B` {?G Gk{'{ ` 0SGS5&` ? ?Gd `0 0|0 \0S  ^0C C?KCMH{^+S\(K0Sp 00S 1 CRs 5&` /p@KP p00(SH 0 ?Gd `0 p@K\P Hp00Cp0 Pp00p0 0 ?Gd `0 {U{G8d0SR R{NjZlP {NjJ{NjzP"W Wd2{0q 'p8 0`DK .(0 ?0Np QaNPWNANP!7NZ| SRP \ " 00T/ VS? p `$K4\P P8 r00P) Q0E(K0 0R0, (K0P@40 00XS00 C R @ 2Pp$K` A BRVq 2p$K`w 㙙 0 0 0>$; -` BLV"RM< 8 =<;:9876543210/.-,+*)('&%$#"! _u"*<Qf{K '2r|x00 0RC(K 0Sn tK ᙕ0 Q@P] •0 QPN P?  0S<  010-0C?o2SY 0S0 0 R  Sp((HŃ BࢁIda"OP(Rd0#QBHKPe5a  S#m0SrY 0S0 0 R Sp0 SWLY0S0 0 R Yp0p lp|0 00  p|0 00  p0EII@O l 0 ` Cd `P0垅dठ p 帐  SA@ϠNslgpm@ǏdŢhzjZnŃhNnQxhmAX@0@Nllpm@dłghXpn sgNlnA\mpp  fNOPEAdAd @d@DpgwppS` 0㤠p帐VR  gR 0 pKH@K(0  យYBH0[S0> 0 R 8 Sp40 BH@K8(Ϡ K l L S0l 0{YH0[S0 0 R  YpH@K'0  dYH0[S0 0 R Yp|0 `00  pH@K4'0  @YH0[S0 0 R Yp|0 00  p0II0HKa&L?  L1cYH0[S0 0@ R Sp H@K0R B0  b4I2I? K%  L1cYH0[S0 0 R Yp|0 Lpw0 plpn Qk0S ᨒYd0S0_ 0 R Y YpU0SYN0S0I 0 R C Yp?0 SY80S03 0 R - Yp)|,K0 H , Rt0 S0t0 R 0pH@K# 0  fY H0[S0 0 R YpH@K# 0  OYH0[S0 0 R Yp0H@K0# 0 7YH0[S0 0 R SpH@K"0   YH0[S0 0 R Sp0 BH@Kt"Ϡ K l L S0l 0YH0[S0 0 R Sp0H@K! 0 YH0[S0 0 R  Sp{Yy0  Yp  Džpp0 S|00ŘYh0S0c 0 R ] SpY|0 "pM tKH@KtKx  㖗Y:H0[S06 0 R 0 Sp, H <  l ؾ \ t 8 8 | \ t \ t `T Y 0  Yp  Džp0H@KL  S 0RYH0[S0 0 R Sp|0 00  pH@K0  /YH0[S0 0 R Sp|,K0 H , Rt0 S0t0 R 0p 0l00 pp| 0 |  1| 0 W|  =2 0 0dDIBI`D 0ठpC1`ฐ0" 0 po((H BIHPKa"O.Ȃdd0#B h5a  㞃#ఖH0[S00P R L YpHH@K #  ᜖Y@H0[S0< 0 R 6 Sp2` -LM$Kp`0 @ ,`P (0耟SPVd00$K+P 0 簀Q 0# (0Q Q \  nQ< , < 4 4 P  -L M@ K` -L M@@`pP],@0   K -L M`@PpE0` q KR\0@-0 P@0P R 0@0@0T c,A-P`^ @T@0S^ p \ 0TU0S@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S   @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R  0 R   S0 @  @R 0Q Pv Q 0Q  S  0 @  @Q ^_0 j00@-S  R 0 Ro  R| @ P QJ  @ P0S0 0S0 0R 0S R S \ ^ @ @0 S 0 00\ ^  Q)  @^ P 0S0 0R \0\ S0 00Q0Q S0 000 0 A-P`^ @T@0S ^p   \ 0TU 0S@  U@@ S @ @\ 0 0SW@% @Q   R 0 \00 00 R QmQ ^ 0^ 0S\0^- 0S  R0 R(  R QQ  R  000S0  0S 0 0\  0 S  @Q   R 0 \00 00 ^p \{ 0Uv p0000S0  0S 0+ 0 \0 R P R 0 R  S0@  @R0Q PvQ 0 Q   S  0@  @Q^_0 j0p@-S :Q :y  R 0 R R| 0  @P\J @P0S0  0S 0 0R 0S  R \ \ ^@@ 0S p^ `V- ^ 0. @^P  \ 0 R00 0\ 0 \  ^0  0p@@`Q 0 Q  `V0  0 00 0A-P`^ @T@0S^ p \ 0TU0S@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S   @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R  0 R   S0 @  @R 0Q Pv Q 0Q  S  0 @  @Q ^_0 j0p@-S R 0SQo  R| @ P QJ  @ P0S0 0S0 0R 0S R S \ ^ @ @0 S  p^ `V- ^ 0.  @^ P \0 R00 0\0\ S0 0p @ @ `Q0Q `S0 000 0  -LM@P< AGTippG 002 Y:`0=z/00 P00 4 80  E*Ta j  B002Q:0 U U 4 \X8 P1`1p1:<0 p`(K8 -L@`Pp J[  D[ >[ Kh6[ -P,@L@`@^$0$P0Kh9^ R 0S/0S P0S Q  0-0( ,013̠Q0!0a $00Q  ^ 0N 0 1 $ $ 0@d% `5- XUL,MP00 P0 0R00 P00 0RD(KEe@`0 p7/$0 @4/10@S4020S$ 4030S 404/$4 04 @R |4050Slh4060SX$ T4070SD404/<$<45`K 40g@ pfFL8P040K(/ C1b!00cQ00L3#g0 ēfF4/#3  0L<@4PK(/ C1b!00cA00Ld`S\PX0 :/45K08 4@KP5/ 3 0 g@PfFL4@K)/ C1b!00cQ00L2"g0 ยfF8/"2  0LD@4PK)/ C1b!00cA00LT2T"T0 L8/D"D2g 0 fFHPL4@K./ C1b!00cQ00F10a `8/!1g 0fF@L 4PK?ᒌA1c00c!00GQ|!Px 04/hh0  @4/H@108! 010(!   0 [\ < \ d  ȡ  Z x,\| @T pZ  h Yp < XYt ğ D ( X0 X@ < WXW W t ` x d <-LXM @Pp :`0@ p@P dP0" TT 0RKZp^`@K@ H0P祫@0 <05/00010S %0e, T ` L0 -0LPL r# Pؐ(0 ppPp `[p Z(@H0@@dU@ZXLP@[lp@P[U@@ @t0PP0P Pl0pPD ?0-?@lPLP[lp 0R@!:D  l0<[0Pl0@ @ę -@LRLPx[HX\ T:$RPL0sR P`[pJ Y(`PppYXLP[00W7 100S( PP0S  R$ 0SU 0W@S*D0W S *`DVPxI[PPC[pPUP0S p` !0 SP0SpPVD00H{800 pPu`8PD,2 -0L M,`0Q1S0 P;  XJ @ XE X@00ST* 0P= 0P!$q X 0Z1\ ^00P0p{0S PU 0 000@F0(K@0PF0(Kp``HP @0PP!@0d0 0$0b,`D -LQ M0 P 000@$pPP XZ@0T0 0 $P`*  ZP10``T*@RQEP ,$$@( VP@00ഐ T*RDQE`fP $("$, t@ TP:`00 00q(KD0@瘩<0<0 4/10S0 봔TL P H8-M@xLM8Hp@0X0@PP4 000 Y`VC>K 0C C 0Cd$ 8 @``` @ H DD 儩p080'P P0??o@0,0|70T4 p7t0X4 d70\4 0ES SH70@T 0S(7000S`40' 0$@CQ$0& T0àPD@5>00@00>, aA@  0B2 (00t1H 3<000L(KCNK<@D+$Vp ,0K04@44[SF  A C9R}xl`YMD=5,%0700SU P0ESb@P FWP0S3 06 3 05 3 04 |# $0S0C$0d# 0S0C 0L3 00 <# 00C0(3(0,0 0S B 3 02 2 03 2 01 0702 06 2 05 2 04 20,0$ 0CS $ ŋt2t0,0 0CS ŀP2 00 {@" 000u," 0S00n2 02 i2 03 d1 01 _T$84K074K崧C.KX4 B\:/S< !00S X00X044KA`XL d0D4 @4 <4 *V(|X044K*4DKH3P<0P0 0< ? K TK` X JXHJ$؏H̥ D@x ̍FFl\@hF̌EdE8(??op .嗑' @T=0SU* P ! >P;0S:pL2Rop!"' 0z P3  pR 0@R@0! 0c130I4??op"3$0嗂'0/P/op@  "A'0pCpCtX8~7 0-0PL@P R*Kh 00SP ``(p TPTU P Kh}Kh(4T(Q uT0(0`4|\(50 0-0LM0@S T0050S@PP 0040S K0@ P 0 !RK0P T006PU& 0040@o,0,0 4/\{4{ { z3p < 6 -0L$M0쥟`S@ P 0D00T0S 506@T`5040S  8K04P 0@ 80 Q(KP X506@TC `0Epd0pU(50 WI TD50tp@pUp0*DWii@0 Sl*H0WU( W0cc P @P  0G L hLlt@px kS  fS2Q-70S  BT@`0W300S# C@(p S@ST| Py @3@绢30 4/@ @l30@b@ @0@  0c 300S@  (p aS@ST Z "  D ,083@0 S  @0D @P (G@ +,lS< @ p!p 0S  h 02! @$R @! 9 R202Q70Sik ,p`@ @S b2!D D@  $  S 07!DRb @$R H0 !@0 pgpWH0 1D  9"D##" 0 0-Lp`WG_[C NSH@@O ᧁ0A`1c#S1C\0L0H p0W 0@`a`@T!"h!" 0-LL@P@ 3O0S 0000P$ K0h&O!!  -L`q Pp @O @DR0a @1100XSX?X+X!0p 004`0` 0y00fC1100 0 0`   NX X p |0 0 p0<0` ?0 p008 N0A0J` L`0 00Ǚp@  Hp JTp @J RH KpH400J(\| -L M K@( 0T KdJKd2 `" Q0-LM00 000 g @ 0T^ 00 0Rm(KVPK @ 0TJ `I@K`p`pip Xp p):jZ?p(3P C S   @z000 S000 XH0 cW#0 @ pK p0K 0 p Y0    0 嬠 0IIp0K 0 A000 S 000 w!p K  C0 + 0 \ P -LM@` pK`P 9 V000 U KI   0-L @S 0T0K0hI -L`P @@ 0TKh|Ix @-&/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/000/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp 0-@PL L  0( @ 0 0"0 g G-0M P(p$ D2,`0 00@0 $ppP  P p0P `0 i! @! 0$^ 0&@, <Ͽ f!"0f+"! 0  1 P0p@N`0 $p @P0`00 0@ 0P0 E00d!l ! 1 @U0 0 *  0 , (Ơ b, 1b,0   00  0 `00@  `0 @00Ѝf te -@PL M`P" $qW"(8 0(00 0` d0%! F!(K03?(0 Qh  K 08R()8 b(@R )@ b(8  -P L`P @@`(TL "( 0"`d?Vp@"@pG@@,0?W"@0F?`?0@0V (aX" 0"?V(p@@ 0@ 0T "@I,0?Y"a2" 0"R -L  C 0-@PL P Ό 0( @ 0P 0"0` R -L p[  -`PL \0@0]@P\  0 P' 0$$` -LAM@PL3؂`p@0( H=1 EK0C@ EKKLKAЃ, @B4 K$! #  GKK#K = ,KEK &KFK@ P-K%KeKp`,KGK  $1K$'$9&Π70 ;40 K%) %  ԌK+K  " 0#ԆK  ԎK()K2ԍK̠0 &10 -K ' !0܅K '  K K̠܌K 0 ܍K)CK(KK/KK܏K !(,K)KC?K 0#CK " G?KK  0#KC?KEK  0ЀK #K 0 1Z$K -K #KaK D000kK20 ,K &K  !KK܎K?, 10 o!>K20 )10 P3`L0 ܅K+K() 0܀Ä  jKJK`&p'@ P@P 0MK@PKK@$P%`pMK@$P% 0OK@PlK`p@ P܅KP^KԆKK!(܃KcK @bP@DK!@eKPeKA KDKKK@PDKDK"`pdKcKC`p#b#K%K 0DK܃KAFK@ P܄K"C(K -@@LDQ'$U  0pRPQp bP`P`p  0P0 0H @ 0 0KhR Q bP`~  -@@LPP ``PVe !0SR$ 0$PPf0Ucp $ဠJ‐+0$SR$ 0$Z0EP00U PQ`0SU$ 0$UP`  `FI တg0# QPVQ2$ 0$QU$ 0$R -L t -@PL M PA'8p,`K@R0UK E K -`PL \0@0[@P\  0 P* 0$$$T R -L 0 -@PL M PA(p,`K@ 0UK  K010  / ,P0-L`M0d0 `  P 1 P hPz P EP PG 0D @0 gCP .8P7 2P 5P q3PJ 4P1l  0 ` KDKPV`h!P &P P KPg P 0D @0 5ZP @HP WP0 'IP VPi00@ 0 K0&Px )Po 'P (P 0D @0 .Pc P P P 0D @0 d0K DK \ K)p \0S0yP  57PY 3P  3P 0D @0 d0K DK \ K p \0K0=P :P 0;P <P0  0 ` KDK]P`\P ]P ^P>0@@P?P B0D @0  0D @0   0 ` KDK5P `  0 ` KDK'P9  0D @0 ~<0  R0` D @0 v 0D @0 qEPo FP GPD0F.P6 /0P;@;Pv oPg P4 0D @0 tP Pd0, P& 0D @0 f P P P0D0 @0 [ #Px q$Pi %P  ,0D @0 M 0 P P 0D @0 AP^ P 0D @0 7P 7Pd  0 ` KDKP XP YP<*P +P D0D @0 P P &0D @0 6P 7P  0 ` KDK{P 00AP BP PD 0@0   0D @0  0D @0  0D @0 DK@PD0 0D @0  0D @0  <0D @0  0D @0  0D @0  0D @0 0@ D0  E0D @0 @0 0D0  (0D @0 zF@0R  0 ` KDK P r 0D @0   0 ` KDKP ^|2Py0K\ KP#DK D @ r<20p\f C0D @0 5 F0D @0 / G0D @0 *  0 ` KDKPb (  0 ` KDKP |  0 ` KDKP  %0D @0 DK?PE  0D @0  0D @0  0D @0 d0K DK \ Kd D @ p EK? ፎ0 +0D @0  )0D @0  *0D @0 xV T S S Q P N N HQQ$N N @M -`Lp+AV^ A@0S @PF W`U l 0SC PPA XpL @ 0S? P" V ! 0S01@0@W 0 0 P PX 0 0 @T T 00UU |@ PT T  W@XPhNXN(NXdM 0-L@0@T 03/@T>PP |00@T 03/@TX@0H00@T 03/@T$u@0`$ -L\@M@P K0K #K  pKK0c/ 0-P8LP@04 32C0P*T 00S84 3`@2C0T:C08002 -@R"0LMpP`000 Z 00S{80S 00 0R(K4P3 C P8 K`0 !  4`0嘠K0 08 Ġ0 0 姏 R) P38XK j 1jJf0` 'à40  Hn4`V 80P@  R88P`0X  -` @PLp0 s 0P 0-LMPK@cP"P 00S R Q R PfPK0@PP@@ 0-PL:pp@@=00. SAA0Cq .S .RQ P _SQ P-S /S /p@-0 SV RR @\Q ^@ S@@Tc RL DPD0UPQ Uc 0S8 DPD U! R' @ @0R-"\\(^\ʔ 0 0 0R0b?o20S 0RpT R DPD@U pR 00- pR ^S PU 0S0S U 0S D`D V PU R0S 0Sd1@-#2$M`@`  000  0S  Rpl!hQp R  d1`@#V0000$Ѝ0 0-SLP0 0@Z0@ T @K0hN p-L M0PS @K``$o 0`$@g0S  0S 0STKpKp `3-LK`QP08LMDM@(KH B00000 (K3P BK00J0(KL B0 p0(KD B0(K1< BP0$1K@A000 0D0S@ 0+PU 0 0D0Sq K1<A!j 01h8K80C 0Ƞp PPP P8K80C LI8K80C 008K0H0C00Qc(K 85 P0 8K@0C008    h P 0?s0S 0(KD B0`V8KL0C0S8KD0C0S S S# I0 0 8KP0C(KL B 0(KL B0L0C H8KD0C 00H0 0H0 0ꙅh7 ( -L pQAM ` 0P0(0  @@T(0B^K PE p h 0( 0R$K4 RP @@ .RBK @ P$0Kt@H 0 N3  -L0S S0S 00  R  R R R0 S 0 0/ 0S S S S S00 00S0 S000S00 p-PQLM@`  R R Kp RRR Kp Kp00 Q00PPpV0S S p  0`  R R8, K P 00 ,$"  0-@LP01 !0-L$MP@0Q00 F Q5LK 0 `V' D[p,<0P?*,0S#  QDK; S 0 S P 0S @Q `V 0 0R(K Rp`V < L 8 H D @ 4 KKLK:K9K RpDl0 P/ 00/  0-L@PP @U0 0-@L P 0 @t@0@0 -L@`pPP  00 0 00 0 N -LLŸpH"LM `0@ h0 l 0@D@ 0 PPP0S S! A@@@S P@h00 0Rc(KT S@ K p p P0 @@TA@@@@0K p0  Ap0P RQ P@D 2 0 0P(0 l0P 00SP0SQ cP@D  0 j0P0 l0P P1P00S`x- l -L<ϟM8   僟K_K2 08 OK 00  2XS20 0Rv(KZ( 0S fpP "000S0S0S0;0Sr^ 0.1@0SK 0 hb0 V?K2 ?K2  0 PR d]PPTТ R @= 02 4=R 02 (=Ȓ 02 22 ?K h@4h5xl H5l @@$X@Rh2S "   "S RGd"R ? RQ<` P[ 3 P\./oSh Q"2 Rd PP` S 2  oP8hQ5 Q 2 㼒@0Q  R0" 0S" 弒 2X2 p2 @ȒS p2"0?K2 V0h2 P%0Sr "弒2S l20zjPpਂ W?2 ?K`༒ آЀb r PUU 0e8ec 0E9c0 0 h2Sd2 S  RS`P  QP?oRP,R 20Sd" 0 0P0S2` PR  2S  R 0S" "h0 1P02  Ph"R R. 2弒@R 0SMS㼒 J 0"S@R %征PM R0P2 ; e0" P 0P2 02@T, 0/K" P?K`@T" 0S pRC  R* R1 \ 00T R2,"R/ R,Ȓ82S Ȓ02 "00[ RP  Rꨂp2 Т弒 S@ R S Z " P@PTU 322 0P2 : |v, K?K@p@ hB,2 lP,P(p2 R"  2S B5 㨒0a"'K0 0 P003p2m`P @@ 24P?,rHpW *H HH 2W @B :PN@P 502 n2bp@⨒ S  U@ p[D|p(2SuKp 0r $2 0 2 # 0"c 2 u$ "(0P"C/P50D, K 2 l"{02PpD)2 2|0T S. SpP*0\030 03P(2S /Ȓ  qW0S:Dp2K"@ 02 c?"02 0LM@Pvs qpo02 ,P# !02 02 ,2SP ]S  0 R PUP 0S0020P2 Q㼒 s lRP  @Pm 2 0P2 Ȓ @P\  22弒@ UUK.M>"QK卓I L/PjD1x00x0d2@0sq,2"002 JN2@    X 0 +  dh DL (   0dX 0+l2 a K p ,P 0 R   B bpbPF 0  RS R R R0 T@>P0LKL p0K L KP0p0 pY 000 Yp0S 0PP0Sx0S xT P(K@0 -L\MPpK@EfP0(Kpl`K @700tKxK p 0 ;fP P0S00A 0 x\Px2tKڽpxK 0 fP x LKH LKx:P P ``0S 0-L KM@ŸM0 `K ,A 0 S 0 K*K(A, BpR KA*K0 BP K AL" K@"$A K*@u Po 0#S[ =K 0C=PU =K@$0C@=PL @I  RF p p]P Z; R8 R R  =T @0P ]P(=K (0Cp$J$p (0J$ JzP(p W1pW) 000 P =K(0C0(=K0C00 b-K B P0q=K0 ,0C00R(K=K(0C0(}  | 0-LPDK,M H0 xx$@Ka$$ 'P 0SHP x(0S0 K -LK&M,L M] &KL(@NK N͟ KP@K8N 0K0(N-K4 B00 00 0S 0!S-K=0 B00=K0C P0?s0`So=KzK0CK,pGN 0Gʈ=K0C:00?P=K 0C00  0 PSS00R0&,KS0&0P  f -KP B P50P -KK BL$0a=K<0CK =K0CAR0 dDe $Vb-K< BU R V K@P P @0=K00C03/Pd> 0 &K `1 ^W800T0 FP X0 PLP 4 @@0SW X0   8PN L4\10 0R(K0@h1 k@<000Sk  .S 0SY@Q5@!.@D2Oo1B1R\ d10R:0  Pʨ<0p1 x0< 0t1 ]0<0p1 0t1 } DD@Q 0l1 d1 0 P(0=S; <0S S" S t1Se p1sMd1SNl1S' h100Sl10l1 0  Qd10d1 <.K 0P  PP`A^G<00d!8   0 aP<5<00Z .<00Sp1s '<p10#<00xDD@Qt1 0p1 0 l1 p! d1 0 6Pʑl d 0 ,P<00p1 DD@Q0t1 d0l1 d1 x4  -LM@`pTP 80 S* @P K00 K00 00000 0 |0 x0 t0 p0 l0 0Sf S S ;00;0S S S (KpgP d0K0 儠K8 200 200 Ġ 0 R/ 0 Ki0$P& 0 KpOP K 0  ! NP 0S0S X/ 00p 0 0 0 2dpK P᪻UHP  d1!H0S 0(K0 p p 0 |0 x0  0p  0 d1  h0SJ i<  -LŸ`M @ p 0P000 7 "p1 P ᢸP QQ ᖸPW  司P0@S W 0@S0@2 Sp 0 0Ra(K@ #.K1D"  /K0K^D2 г/K @"?KD P42@"D2 0S82Z@2 0 @20 SH2  @2ŕH2P@"0DZ: 0S ppZ "H" % *Z 0S   Z:pYH"៕PD2@"-w  -` @PLpQ0 ; 0PR-A00  R.CCC0G-PM@ 0A0P0 00@0T T`T4Q0<0xT  jWM@ 00#P 0P0#P0,V' \(Np0`,@L 0'p p0 4B0gz0`@% `&* `> 1L0g @' $ @@?|5O0dEP D" &$P p0"0(p $0Jc:P` %,p P!e 'FmOP`@%0P@#x nyF@pP$P4p"G\DKH@0p!8@p0.gz)D0OA #<@`%7 臇\9H 0`"`@@0'"!fe+F0 P#D@0(!-O  0.0Hp&Cc:yFJ@ . LP!!H'ID@`@.P@bP! "@J " 0#O `kb(KD0#@0@!,P4fO!`` "8ap\  "^K PP0#*D@0#0BGc8!JN!@@ "P` "dM ``0#b.(0#]0T@P4@:P!9 !M "a@ "I  FN@LP$@0#l0#oA``!nP!e଄LDR ")TO "P P.`b8,@ . @ৣ$9` )J$P lOi` p0 "  @@PÉb+[Fp 'L OH@P p!8@`}O e@PP%P0ѝ0e]H@ @$ @O>LpdK?F0! 0(P,O  " sa%sJ0p0#0pDPnDc= @`*` ^j< )SWOPB5B阊 4 ":MK @ P%N  0 ( @P `e] 0 "p@0dK0 P% 0 p@$PЍ , v420AEFN(I 00 00/ -`!LP0ّR00@@ip0V>0*  a$Kk薰 i⏰8 V10@V@0 -L0M(PK@ p` 0 0  h!7R8 bx b   0RX Kh蕷sH |(2 -0LMŸ 8 0 0p004K1K $ 0R` ( 0^ ., 0L0`r@CT%PP^O M  A@a@d €8BP800 0RI(K 0XS ``RV 0j0S S S Q <ϿT 0@\*40[̌\3 [40[2[(<4\*30[4 [8<.R\ X* 00ns  -LMKjP K -L(sM$ @p`P|K@ 0g/K@ }K! 00 $O$1 TAXA\A20P    0  \pP 1@*P 0 0R (KP 00P 00s  0-   -- LM0 0 K -,-L$ M0 0  K| p-L$M`B@| P@t04 ,` 0 P $0 0( ,K0 8 @X@v8Kۥ`yV Kp( $ R -L Q0P:Q:0Q: Kha%r r -LRϠ#\ KhArH1 -L<0M` p!0(0 "pP @K  @ L"p D!0( 0R( K;!KP0X @@T PU 0S9P@OT 0I, 0 Er  0 0-PL@ P0 000(0P(P,P 0h0PP 0P 00 00,,nVP 0P0 0 H 0 0-L@   0 00 00 0  0 0 0-LM 0@P 0 00P 0 3?o02cK03& 00 0K0 0-@PL U 0 0-@LPo0PPk0P(h(P,P0 -p0L`Pj 1Pd 0 P S S@@U0 S S@@ t10PO @P-@ PTppE @a1P$ @PPJ 0SG PT% 0S" S S@ 0AU 0A@1 PP@@ 0000OP 0 @$10P` P@`PkP@ `@`@xز -LM` P@W,0Sg:( ^T( O0@T2K[qqE 00TA: 0Q;@c0@T6 00T2:000P@c@D pD TI 00T!:0 !0 @c0@Tp 00S0AX00P0 S`@듴@$K!00$K(0 0P (0,@0  0(0"P 0-LM 0@P   p P K00 0 $$ 0K KP K0"p 0$0 $>K0 -L@ULMPpK@P0\ @@ qP>P`P: @0@ qP/P \' 0P0\LQQ2 QR Y  P ^ QpApppR  Rp A@ R ^ QR@   @PQ A@0\0S Rc0PX0  iX0P0 ` 0@P @ T* R RJ RY R  D PHpp^ P@Q  Qh d` p`Wd Wi Pp Wo R' RBW  ˫  R4   LKd0 弐`P HP D 峫   @ 0`0 姫 d0RB d0 4 d0yX0 JS\  0(KX\0@@(K   yQ h0  ᱲ0 d` 0K  bh s 'Q -LMP`VP YPP<w0@0P0 000 S 0P00 $0p 0 0 $p,Pĕ( SP3P#,PW-ĕ ( `  80 孯80QaU%PP VVPV`U ZAW(KW3#-ꇲ00V@(K~@00(KPWK %88SX` `T`FR`FQ`FULPF0 g`dmU4U 0:0PFuP;P(KPZ, %88SX` `T`FR`FQ`FU.PF0 j` 0 0 0-SL@ 3/K0hA-IM= Q7NIࠑP)7NI P Np ^ @ ` p@b`g PV%@e eD$ dPd&"Pb@b"V%@e eH$ dPd""Pb@bQ%@e eE$ d'"^ b^^i NPa Q7NI`P p N ^ p@ @b`PV%@e eD$ dPd&"Pb@b"V%@e eH$ dPd""Pb@bQ%@e eE$ d'"^  ^ ^ , ($@P^7^L ^H ^J @P D N@$PPd@bPbV%@e eD$d d  `` &"bb!a a  ``!" bb%! b'  Ѝ^ ^ ^ ^ PpN P@LHD7NIP\XTp :6 -L00s !R !Jp@T/ZP*Z0 ` P Pe@e @储 00ޢ0@f@ 0prZ 00̢` |P @0 @0 0ṢW 㲢<1 8!0-P@L0 0pP 10@ 00d0.R0  0  0P0 : S`C@ P ph0q`0 000s0S@ 0 B10 0L@@ 0 (l$C-Pd 0 ~^  `0pB A`@pP<  @~^pP1 0@B @pP  @@t@TpP 0pB @@ppP.R @ @  pp@@E B2R񏐕~#~}|{zyxwvugsrqponml^jihgedcs`aGcF@`2RSEQPONMLKJ(HGFE#CBA3?>=<;:9876543%10/.-,+*('&%#"!  0 @ @  @0 saGcF@ @a ppP0J 0 Bd p0A  0Hq႐p0 B0p0 p1`< -LMPgF fFFU2璄xDud`IqEE aAn@0 0G Ml@$K贼 -LPAM M@PBnK `Fp 0( -P,4[S ( 0R K..j 0, -LMP@ P`,pPyP0U K00S.SK0000 -Ll`hAM B^K PE@0 pP q 0RKi  -PL@`Q @Q IPV 00V00 p-L M@P`P 0U0 R POH0@P0 V00KpV 00Kp謹 p-L M@P`0S 0U0S @0SOH0@P0 V00KpV00Kp -@`LM KQT:8K, (0@0@Kذ hPQ 0 0|0 0w\ H x0 -0LM@ KjQT:<K0 @$0@0bK( H -LMşM\  L Pd 0T4 @@0Q@@Tl$ 00  l40 0RI(K$5z0PP4 { Ld0 0D @pD CNK @DXD KNH t ` D4[SHDD@Xt?^?`0 LH4 LPT$?oR20S \40  `4S>   LU UX4?00)S- C0P$@HL  'PP  )`0SP.P 0PP4 <0 Uo$X$<?+ 0 @Q(qLT2x 0|T h4 ptL fIY54P@ 0`$0Rd. V huL pL TH0 P02d$@@000 .T f0 IYx|TLȡ0  V0 ܫ0S7 ث$Ot /Ll40 0R?P(Ko 0 ̚T PtD L U0 T廚0d$P@@000 .kTT4SY\40   ꔫNl Kg UX, p ܵpTԴ $xг -L\@KlMp `딥 PXLK0 0 LPK 9  /[`!5[` R[Ẅ[d [h  P\ ğ l0 A l0 00K`!R   ;`!R   |0    P  P  P  P  P  P  P  Pr`!ReYT R ВP_ `0 K d0  J h0  J P0 J`!R   ~0 ` 0 `|@0 `v0 `pd `00h 00 (KQ ጑P_ x`0   Y  (K< 0I`!R 0 ?L0 8Q0 1V0 *[0 # 00  VMd aJ(KȻ  L( ,4 \<p@( 0-LM@ Tk TE Th 'TV TF5Ta T2 +TL T9p( T1  TE  T/L@T$ T>  T%(T+ T  T TTK03^0P@0( |tld\TP0ԫp48p 0-LMP O@PK0 0( P0K0萤0 0A괠 M-L@MPPpK `@0P 0 .0 6$T @D 000 0R K$0. 0m%e  -LMp@8 4p 8PK0p w4KH @ i0K`e4 0Q R PR00 (K(KP 0`8 -\080  +\080  30D0 0pP  8 10Rp00C0d0.\ 80 @@ v @p@Tr R Pp 080 T  @ r R PR  R 080 T  "#T *8 *,& * `p& &d',0'8't  ` 0p(KwD 80080 T @ r R\R  R 080 T  "#T ND80 080 T@qQ ^Q Q 080 T!T@ %@ 080 ಐ |\ N 080 0Ip080   0 B : 0Q-LlM80 0 S F @@0 Ƞ ,P  4`  S @ @   D #gO  < ^-nb AS0N0\0 sb "eDf/HY C3HHbDQGbadD`OBd0`JOâd?cMb@ANsb eDnf00 3H 1C cE:bDL0 W0E0X0 Gh((HEE3AEhDObYn " jD0rgBd&oa"SAEC:hP0 d0@d4 qAaT pghc@c`DcY PR V L U0F ,T40 00 $<L 8 Xp@4(P \0H{-Y V U 8(K @ c < _|8  08 0(K@  ( 8 000(  긮0 , 0-L@bP00 .RS0*S 0Q.S0P@ -LM@@ 00 OK@ 0v.  00 $ -K0 -0L MP@( K(0`S`p Tw(00 K 4Px 0000 ,Kp|0S,0W0?o20#S0(0 h  -P@L M( K(0`S`p Tw(00 K Px 0000 D ,Kp=0S,0W0?o20#S0(0 P  -@ BLT"RMP 4 8 0 4`W ` P-YX +Y0- vP `"p<,00Is Ra0ISW0IA0IS70ITq \  S  R p0Y( TY @YA`80Q00S00lS& Q00 J4(K¥0 0R004  (K080 XQ0A P@`R A@PT@`R 0 0 0eꀤ b -@L`P00C0S vP0 `M SvP UYFP00C0Sp 0/ Sp RDF 0-LM@( Ҡ00 (0K 0 $  00s !R ! KpPK0 -@L`00C0S vP0 ` SvP UFP 0-L.00 R) @0S  0R0(S00020H04SAP00S 0R (@ 0S0  p  -LPPL` p@ p 0 KhIh  0 0 X  -L`M Pp 00p@ 0 00   >@$K #̠  -L|PxM p` 00Zp@ 0 p 00հ@$K # 0 00/ᔟ 0 00/t 0 0\P  -LX MT P`@ p0p 0 < K$  0 0瞵  -L|PxM p` 00p@ 0 p 00@$K d#ꐞ  -LPM `p 00p@ 0 `00  #@$K <#  -L,M( 00  ! K\ T0 P 00-L@0pP K0h£#0 (- 4  C꼜 4 -L0`P@S U P 0S .S 0@S \S 0 S@f0@fT@ -L M@`Pp 0?"P?0 R Q4. 0   c (KP  R@ 0W R .R  R R  R.R000 -P0L@`S z 00d0 00 -LM<@p8 `4 P*Z3*0 T.:S, 0@< 000 00 T- P0@^0 P  P0 P00800400(K <0 Pj(K<TLR -LP0AS0@`@Dx`p`A0 q@DP t8 0dP0pD -LMMK M$@DԟjK ,`FMK@D K@D K @ K@H00KAp0P0KL00 K0A0 wP= =K0C=K 0CP0S@P =KK,0CP =K 0C 00K8A B rPb Hx@P[+K=K,A0CH+K<A 0 H0dH+ 0P<>Pd 0Z-K=K8 B0 PP4=K =K80C 0CP(WH g-WW 3W2W*/Wb :0W  1W=KD 0CV%U%E0`"?C0 S -K=K8 B@ 0 P=K0 0C00R (K K @P=K0C R 0S .S 0S 0S=K 0C000S.S -K=K8 Bt 0 nPP=K 00=K80C0P\WP yWM \W W W0S KD;A+ 0c-K 00-K B=K,0C0-K8 B=K40C0%W a!WX #W"0SKD;AT+ 0cWa $7WD+0D;0D;@ : :J!P#D+ D+-K B000S-K=K8 B 0 PZW (WR-KK=K8 BAD 0  PIKD;AL* 0cI WWF*WD WA W7=K K 0C@K0A@C=KP=K80C Pp=K0Cp0 gP 0 P=KK0CAP 0 pRP\ 0 P=KD 0C00`S $) Q 09 d 0-K=K8 B0 P=KD[0C0S-K8 Bx00-K B8p00-K8 B00=K0C0Pe=K0CU0PU =K<0C "(0A A @D;  @&U=K @h-K8 B 0@PU0 -K K8 B@ 0 3P=K80C 00Px7-K< BU0 0B0#80Bڭ=K <0C0CD;0.0$ .0 0Uʭ=K<0C0CU-K=K8 Bh0 PTD;P=K0CD[0SH =K$0C0cG=KK,0Ct =K 0C 00K8A B P2)W A&W-0SD=K &0C 00a+ W* W0S]KD;A% 0cWMKD @D >-K=K8 B0 P0S%D T5Dd 0D -K=K8 BpP 0P=KK 0C KA@0P@C=K0Cp  0P0 gPP 0p PnW=K-K8 BK0 KA@0=K-K0C B0  BP-KD; B PcQUL@p @UD D;1 W2  0d =K 0P{D @D D D+L3D0@(  K @@-K=K8 B0 P[=KD 0CV%U%E0`"?C0 S -K=K8 B0 PB W? W@=KK 0C KA@0@C=KP=K80C Pp=K0Cp 0 nP#0 PVW0S KD;A! 0c0SKD;A! 0c WK-KA=K@8 B0 D PD;X!0c +W:0W+W0QSKD;A! 0ccW=KA0CP=K@p=K80CD U0 PD;a D Ut0 ]P꬗ hd[,xh8X$ȏ$PsHp̊Ho@L,m{Dlp`0| TPPdd`~0~|{{_yzzx\yWw0S?KD;A  0cs=K-K 0C< B0 00#80BjW@=K-K8 BK@=K0C KA@@P-K B0P  BPCL0 P;D D ^D;D YD HKD T 6$HKD;0D;X=K-K8 BKp=K0C KA@p-K B0  BTP ,0 PD *D;TB0D;@d 00 PD D;0D;0d  0 |PD PD D @D D 3Dd 0P@D 0 ]Pm=K-K8 BK0 KA@0=K 0C0 -K B  BP=KD0C0SO-K3< B00 0D;D+Z) P0S @p@T 0W4 =K<0Cd 0 -K=K8 B0 Pm@D+TPZ=K 0CD0SDd 40o -K=K8 BP 0PHD;d $ED @0W 0 P5D D XD0d DC 0 P!D+0D;@T -KU-K8 BPD;@T0D; d 0" 0 P'W KD;AL& 0c=K-K8 B00=K0C 0 -K BK KA @ B)PMKD  @D -K=K8 B0 oP0SD;O RWQFN RD@Gd 0@00 -K=K8 BPp 0JPD 0d D 0 9PD 0d D 0 (PD;D 0SSbP R-K B 0c`( y R$Wl0SD 8Dd 0Dv -K=K8 BP@ 0PO=K@0C 0\=Kd 0C0090Z -K=K8 B0 y0S@KD;AT) 0c7WQ W +-K=K8 B 0 P3W -K=K8 B 0 PD;@DKpW? YP0GSl := 0!+F !  # +F  +F "  " +F   # +F R! +F F! 0;F-K=K8 B0 qPDK@DK=K0C0Sy-K:< B00 0D;D+pWu P0Sl @【@Tf 0Y4 =K<0Cd 0 -K=K8 B0 :PD+;= 0!+F !  # +F  +F "  " +F FF F 0;F4,=0 1;F010 30;F000;F0FF2F0F0;F=0 !+F ;F;F!;F ;F;F ;F+FnPW=K@0CDK0Sz-K=K8 B0 F  .Ì F F   .Œ F Ì F\ F Œ F FPW5DKpW@DK2ꫭK J .@PTT ,~p=KP=K80Ce00Q 0P0PT0 xPKD;A. 0c>d @0 -K=K8 B0 ^PZ @D;p@D;Z0D; d 0 -K=K8 B0 @PKD;A/ 0cS/D;d O@0 -K=K8 B0 !P~D 0d D -K=K8 B0  Pj-KD; B0D; R-KN B-K@P-K8 BpD;0D;Yd 0f 0 PCꫭK J s@PTT (~p=KP=K80Ce00Q 0P&0PTW0 P0W* Dd =0' -K=K8 B0 PD@TD% -K B0 R-KP`, B04pB400 0 0 0H+H{D TD00cH  0 =K0C0S-K=K8 B @P0 fPsD @D D @MK4< @DD2 0D -K=K8 BPp 0EPK0A D YP -K=K8 BKpP@D0 D*PK0A D >P~ -K=K8 BP@D0  DPnK0A D %Pe -K=K8 BD@P 0D PT=K-K0C BK K@A0@P  BPAD fDT: D0D+d J -K=K8 B0 P%-K⫭K BD  J: ` O@PTT yp=KP80Ce=K0Q 00P0PT4=K 0PD PD D @D D @MK9 @DDP2 0D-K=K8 BpP 0rP=K-K0C BK KPA0@p  BPp 0H+DHKD; d @HK@8` 0DK-K=K8 B0 =PԗpЧ@D; 0D;-K B R D+P W -K=K8 B0 P{ p 0d @-K=K8 B0  PjpG@PD;K&A 0ceD-K=K8 B0 DPNWD =K0C0S -KK=K8 BA0 P;KD;AX& 0c;D WD; DpD+@QD;0D;P 6d 0p@ P1-K=K8 B0 P =K 0CTD /D;E0D;@d 0-K=K8 BpP 0PD D;0D;0d 0 |PD @4Dd 0D0 hP=K-K0C BK K@A0@p  BP-K⫭K BD  J: ` P@P1V tp=KP=K80Ce00Q 03P0PT0 'P=K-K8 BK0 KA@0=K 0C0 -K B  BPlD =K0C0S`V%U%E"?C0 S-K=K8 B0 PQ 0H+DHK-K=K8 B0 PD0 D@P HP 0H p lH P`0 PD RD0P D@P HP 0H p lH P0 fPD D0 D@YP H@PH 0  H  d PDPP0 P0 4PDTAڭ-K=K8 B0 &P6-K=K8 B 0 PwK0C<4 !0 (㖢@P& PP( (< 0@ PP" <$ 0 0PU`ᣦV? 0 @ 0 @d0S 0  ᐦ፦ 0  0  0 00S0  0@TɈ  1 0 0Ὲ 0  Ḉ 00S S}D43 |6$65 -LM`pለPP00 0  ` 0p @ገ(K` 0 p@P -LM@p`^PP 0 `00  @f K 00 RQp-L$M``@ P?0SI 0S0S0s S 04  0S 0  Kp 0`,K0 0( 0 0`,@ $ P @P00  KpR R 0/  Kp0 0  0,! - 1  -LLM|ğpP\ pP `0 0T 0P0 000  (`P 8` Ⴅ0 j`P @P @0K   L0 P úPR QP0@d S Sh 0 S S xP 0  R H H  pX@ P @  PhP H0[0Y R R R  U:(q P] 0gpPX@0P` h0dR 0NgX B\ AH   ZA: h Z<: L 0 0cL0 00圂L0 S): @j YL`  ` 0X0T 0ؤ֤  @io H0aS `.  r T*L`P㿤ὤ 0 T 0P00 0R5(KL  P$0P(    X H H X/L`p}PᓤT 00\H0 P H000屆P00p`pB@-  `$ p-LM@P`00ɠ 00[Kp$ -L M@ 9 K# 0-LM@P( ɠ 0 K0p#0 0p-L M@`V t@0@P00 000 9~`Kp`V00' #1!0@-M0 `P@ 0\% 0 0s0S 0pL WN0!000pL .\$T 00 0Ѝ W0 XS 0 0s0S 9\'0s0S p\ fB!R  P(Q,0 4  3?0"0@00' 2 -LŸ04MP` 0H0 000 Z PL@@PK @ :T  t H2TLP 0P0 00 K\P pT X P` AP C PU>b @TpW\P0@K L0T0:*$ L T0S& LQ c% R 0rR0d 0l/00H0 0 0RB(K"L0S PAPP :TU 0S L0X Q:P*4L 0p@:T`T0SL0pT0 .T`\PL00@KpWPLp Ś=AD% ( -L,MpP @8`K0t  ( $P030#PP |( 0R K A" @& P-Lß|M 0  0 00 000 PK  ᆄ 0B1T0  b,@KP!"T  P p  R 0S p u00 \0S  PR p u00 Y0S PY00P`0K8"圐 2K 0 @ 00S U@:00T[ U00 STF `VX*UT:00?0S S` 0S7l ?R30 fᜐ :P?  PUC 0S6* 0a \/:@ !|0>0/ 00 0R0(K| 0`pf1 #WP @Tu㜐 PU  0 u0} w0S*: !@d0S ! `$ 1 p-L0M @ PR0 0 ) ^0* KP\*`K \\ 1@K|0"@^ R KQSKQQ  R 0R Kp 0QKph??  -LeM,K`@P00SM hv(XW U U U 00`bv(K 0Q  Q 1X ˌs`P,KP8/0 QP 00P @ P 700  0 0 0*v(KDDLU K-KppPeK,K 0Y-K-K  %0`R  pZ0 < V?8`p 0`lRmK V00:) 6  0V0L0mK0c` 08/0 QP 00  P @ P Ġ00 0`S0 00 oRPj0Vg 0f0``u`G s . %= 0 R?Q < R? KP KP2$,KR0 0* KY Ks 0 Z^ <弐 { 0P8/0S Rfu` Q ` ?-Ks-KZ `bP @0Z J00弐0 00 ?u`-Kp pK-KP Q  08/0S R 弐``l%C0 pS -Lp,M @ \0P @``#PL PL0 t00 K80 H <0 W H0@00P> 0@UT  XB*H0 R0: \V X VH @h800@ TST'80S @@T<08 0Pu < 80 D0 UzD0 < Y@t0=P08S<  (K0D R LP RV  AX QVp S00 @ C Y \ V L00 S\  D@ PV0 S @8@VT =P 0S8  8LpV V 00S080|< @<0 Ct8A<0(K R R@@R V R@ T0@0@00SV @@AH Q  Q V O 0-@0LP0FGp 00100@@@ )0TS 00" 0 -L M@P0.S00K -L0K M@#pdK R ..P A@ S.S P0B P-R  .R0S/P0B P/0*S 0.S S/ R !0B]S.R 0.BoQ 0#\R00 !B]Q//]R0S! C//$0 0 / 0 00/  / 0(<0/ / , 8  0/0 R @R /AS0S01!// x4-L0M@0 d4@0<0 P48 040 Q PU 80T T*.0@0DP0Y@U{ P 5L\P  1E00 0p`"C!C:\ D9B7@?>32;:98-6543210/.-,+ )('&$#"!  QQP0@P0]Z㓎lr Qd7fwp<4匁v`挀0hP@ns0D10D0DQ)0@AQupW( cW0 C1 W  00Y1WP0?`<V `FPP0( (KI0Y@0P|8@@V V `f06""PP PP@dT@W`0`f &P80T T*00800c T*.0@0DF 0 < -L,M<0 080 `4@T0@ P $D0 0 H Qp, SF [Qa K;P edpQl A;Ph e1Qp` 5;P\ epWXVVp@0Qp80 0c0CG8VD8S0 V>@0 cR9<0S <00(K\Q .Q8  b B'8V$8 Q R.Q 8@ @0]:PD ph0 X0xS @~0@(K~0( (K|2D 000  0VW$ L /R4 ]R9\Y PP0 0K0 P0 ]RZL " 0VW\(@p~ 0 VWppp8A  @ R .R80 00WVJ \!  P0R 0 0WR V0@0cP<0S00  x H Y L "L nZL [ 0 CP  RbL ` b"\ PWV 0 -PQqL`p:*0@S0 R2 0p0P, U)P`   R00N |`00`h``RN` @0S0a}(00 ,R -LP3P#MRP3U `080  p@040 0`00  Q6 0@S S S }(00(KV40?S h040 0D00T00P@S< < 0P8 ^@V Ppu0pGSpjp40Sh4 -LMP K -L`S,M@PH 0<0 Z ` 0S `0S PXW p0S}P(00(K}P00(KH0Tp  4 pL` 0 P0 0 D` PU 40 `PS@euV pP00U00S <0D S!*80 80`80 V j Y 0- P? $ R``VD08 S|00|(000S 0L 0CR*0j SP0S 0P0 T0p00L0 @0 ,@00 SPP P  AB\ AL^ \ R0SY4 0D`R)4H P=Pb#=0]<` DZD`S 00P<`8 Q/!0S/P0\*R/\/00/ 0-PLP*0@S @R R R {0( 0QvP Q@0SP00P0Q  A-L# 0S  R: c0R B 0S  {0 {0( 0`0`00 -p@LTQ2 0#0W&0X"7 P@TQ0  WX`PT  0t{0 n{0( 000Q -L`@S 0RP@`V  P0Rp@P  A-L@`pTQT PdPWڀ1Q@"{(00{00{?00Q A-L# 0S  c0QA 0S  Q*z (00 z 00 --LM  K -LM@$Kp KTKR-0S0 \ R \00 -@ BLT"R M`4 0 4Pw P uP-Y? +Yo? o7`pPUP"  QBSP;c0Ip ^0aIPW0IAIP570IS2| VQ'SP 1!0oB0Y/ P @; Q (7p UPpg`Az0SD 0q@,,p( $1 000 #).&0@S+0a0000S 000 000 |000 00`0  (Ko(00T -LP`P0S p@p0SS 21C@P0S , pb <@ 0@ P T%<%$ -LlM`|0 XSx t 00R0#S @b300 0S_SP0S00 Fx ,K|ß 00  0P  PRp @.@P<3p 00 00 $300 V@g Qd  Q_ tP0Su tl 3/0 0p0pPWp@RP00Sat" 00C0T@(KLB@@@` 820\w `0S\ 0 RW 0S!,0K <#0@0d P @@h0Sd @ d 0,K 0@ sP 0S 0 PKxP |L cP 0 S@h0Sd @ d 0P> 0@0C0 ,0K <#0@0d -P@p 0!Rp0 P:, K<" d0 y \$} ##l|| "0| x","{ { { z pz G-rE?AEdDc l\d 0Sq w:Si J JBe 0^aEdDϠl B DgF0l@0f_fFFdIbI0CǢ eseD`?@PE1c0LpGf?@1c1c0Z0B0P0BTPNPN(@\dN0P; S@U@A@`P^0# 3cΠcS 0S :S 010@10@;P@:=0@0C 0Q- ?`@@TQPTP 0 /`PV 0R /0 0S 0 0S 0 0S0 0S0`/// -LM0 0K   @0 PU0@0 RLH?2c@Q ` e//G aS  RH0SH/b @R0`0 ??G0bQ00S0 J ? BA1c@Q ` //G aS  R0 ^0 Ϡ Bl RLl GbQ P >t@PT00(K JkGbQSv ʔhuoGqE`bdn\  G Baan$d!aTQm 0`SPm@V0 pG``E؀ؠ B/d@Ţb#b jNb \p `QPZ_oRPBAD @AT0dXp ` P0v@ @ ;S0 00 `q@Q㈀KĐKWV V02PlKLKѥ?Ϡ 0`0b 0RLKV,KlK0   ?OTj1DQ00=P 0-L 0N ^0N ^ A \?r0T 0\05r0 0 p-L M0@-SP +SP `K0 P( >00:S U00c0Kp;0 P  31C000:S<0 P 0 00 0-L0@JS( MS 00C S! m1 P 0/S <00  0 }P 0.S 0 sP 0.S 0 m1  fK0h0 [ -L M@P`@p0S@0  K -LŸPPM <2  08 0H2 000 0S0 0q#>K0C @2 8<2P 1"[R@} ^iX~ 0SC#>K0C Q0SU=M0@0` s,KQPbA,K !AT\@ KL0I L2  Z7 prFF. 02VV#01#0 0T S40QP  - 080 00P3 Yb \0 r t"|d \ 0^TK 4DP@RZE4 8Q! L0SKX0L04PX@0@=0TRX 40X PF̃Ld@p P0 P$0! S 00L0^TP0X40d V<g0 ^ d 400H V<R h A 0jKp80 Y 0^  `0r @" XP 0K @K P `PX KPW G4R@KPKpR4`8@KPH& P0Q8P ? jK40 \L@PFt0 Q ^hL4@"PF,u 0 R  ^00S T `H2㉐ b0@ T 00S0 q<0T 4R00S 000 S X`V:}p80 嘮 @0 P40 40@U P  R0;SR000FP0 @Qq TPE\  t zP R0SR0080>SL m-` `QC V0*@;@\0 S$!? 1)n@(KKR3@n00@pP(P^ 0K @S$K!? 1V:80 l& R0 l  R 0Cs"F,0"F,l  R  0SH0B0  RIL RF 0@ @P 00 :80 6S `50 V| hpG;K+JoR?40 ><0 P<0 V Uh jP$ P *i01S@ fP40`ST `F0 V=-0 0RP@Y`00@\80PA\ R000!, 0}VE=0 0p ^@pA `p00> BPFLh@ ˆF̌xPR -LM@ 0 d0 h 0l0  PP00h0`V <V 00F S+`FVh RQ0S0 C+Ch00cp0 p R l000t0  S R,R00;R00S `KP P0PSPU;S,S SpWd;:l&2-^  m ``P   F lP UP}dpp2F lF0F<`eh0Q0^PcWl9` hh bx& |& l&p&t&u&&&00+t VSS  0>SS>Si9d `PV|P blfh&hppfʄtf ufxf |ffffl0k 0d `(KdK0Ph0 0l0  Sh  0>SS 0>SS>S0bh p0 d0>C`0 "LT0K0 *P 0,S@0K0  P Qʄ 9` ,Kd ` p blWhex&pƃt uaE|l0#l0@ PW @pD‌ O/bd0{#bp` >OOPOrbR &P 0P@>0 5P1E㜠 0 0p x0 夐 |@ 700 'x0S| W`a  Ð %K! 0PRx|` = %K"x` PN X 0W@@ӈK PX0PSSd `` pΝ@@0d#aP`Pㅜ@3a,ΝSc!@@SW 0f g 0R0 hPPewX 0+%K!JPx W|@@0 =x . @ %K!5Px0|@S㜠p夐000|@x0圠p夐00gS000t0P@J| 0-@L@0S xK0h 㤄PP P@ @`@GP00 0  O O ؿ -`QLPV 0Slʅ 000 000h6l6p6t6u6h; @P 0:S;  kP5 `VVlpVLg`p`g@_&PT`Vڐp p 2Fn!V00>n!0d!0 SRj0V0Th??G0dS00SYPUbJ00#/ÂB#b@T^J00Ϡ#"Ll@ a`@`VV0 m!V00!K @0\dK4P\`pV07!0 @`PEpVU=dEd b#bn1@aBbQRnm10P'ZT@Dm1/\h T00(K1dQ00'TZ"0 H0 0$KNH0 KI//GE dmd ?cJjZcAaQUڔ 3cCcnS0TPcR@ BX [Um1Un1[UT0{DA$I"IPT"/vD0 LC1b1c0cJ%Ϡ!E""L3l@0w?CII0C0/A!b!b S0 B .0c.0c`p< 0c< 0cH0X 0 ?Ed"cBbR3cCco,"32C 0U Pc 0 S0P4  P$ 0 0<^pPV0KH0  B`P@'2hH܃K@@PYXHWVC 0C0C@UT N@UT\H dKb0dKH0 ^(^0 R`PpR8!d?OR00@-K " R000H0 80dKH0 4Q 0-Mp@L@0P0P U0S V`p, 7# 0#KKRP0Eg0 (K0PS( 1P 0#!X$K0X? PubX@ 0 0Q`p"2&>`p, X7#0#KU&:[bhv  0oP< l6F^ P80S2 VP0(KP 08 4K:P A X0?`pA0P UT`0efT 0 ``Rp$ 0VY`? d -LP@P`@I<Y00 P;> X -L^:l& 20Q -  2FK1 1 0Q Q q Q Q q 1 0( 0R$Kw`T 0   -L$M 00 Kԏ -0 - L(M 0 K萏 0--LM0 K0 0-L@`XS`00C`0S vPX0 X `XRp SvP UX P$ X0X 0`00C`0Sp X0X/p Sp RXꐎ  -000-0LM  Xa K  --L, M( 00  Xf Kȍ  -L`PWR@T@@ `5X0 d@@F/P@Z  %X 0 j  }RxR j\ --L M   K -- LM0 0  K 0-LM` KPt.PpP @P ! LP&?P ʘ0p@ 0$ , ( 0 0KK 0TKP_000 Lp 0-PL R@TCR0 -LP`@Z RT0U :T:0T:KhWCR -L KhJ:00 -sL@` !R ! 00 0S vP0cS0A` R 0 U00SOP0EOP P?OP 0 ^P 00 -LP`@T@1U zpP  e!o^p@]xpP  0 0w| -LL0KK 0C6 ` 0DZSU{be2z-Huu^|{y|S6 pv0sO @GK @Y>KD 0CD 5 ]^nKO `FV5.PFTAXA\AFYE @,p0 DCK&L u @PIP@0@&0@00070 0R(KFNJP 0F7f  \ :I Q) &6S1ӀK & & 0SR 0Y6[ Xl6 oKX A 0 0U YNKP @Dd06 o>Kv 0C v@Q# T  Q  R 6[pG0Y0 RT@P0 0ITV0G0  Gppɟf <0SA   Qs !Ҁ & 3   ?0f 7 6S06 6 Su &1Ѐ06 j.K7 BBSk>K00i.K B&D`V 6P0f7 v-0P6 6fS-06Kv @K 0CX0d&R  0SR  f P6f S< &め06 x05KQK 0RQ:6 0S.K B6 & 0&6 `6 R7 @6[  S& &  P@/[@,Z@)PP@ P@"[@P@f P3\Ÿf 4@@P@P@Z@ f    @6 S !06 @0*T 0D` Q0!@000D Q6 P@0D00!@䉐 0D Q$TK ܖ aTf  4P07 X05K6S06 6bS &1{06 iKj.K L B0BG 00B{^ `V 6S60f6 7 6s05K6S F006K6[ SR' { 0Sx \@x T @ ܂(  {z h D x  D 8 j@0D Q00!剐0@ Q$Py 6SO &16 06 6SV0c6 +06K@O@PL6[S@ 06K@EP@Bf Pf Pf P6t f S' S06 l6f S0Ds07 06 c ^Tf ( 06 EK0&K@& `& ' Y.K BV & 굆K0@7 60iK 7 P   760T6S$ 06 6S s60@60@6 =K0CPPh sS 6kK@0Sp6  Q p 5[S 60K0 KS6 p Q p R @iT.TDP&p @DT0SP6  Q[@D T pʰ3P@000 p Q p 6 W6 &0S  6 Q6 0  p6&@bTTڌ&`V p @DT0S`6  Q@D T p4P@00  bQZ76 aiKPB& piKP8& p7S6S'6P& W @bV@T ڌ6 0@S 6 pQ p T@d@T7TW& p @DTG0pS6  Q  iKhP7Q6 /0 p6 6&bXXڸV0PPpHX PR0&  QHX p$7\000 p Q piK 7 $P p 77R@P000& pV  tUi_>K p 0C& <  @6 p6 6!6S6PYNK&` @D0KP K@0p V {Up7 p@f PC0K 0C0 & S &1{06 7iK Lj.KS BB0BG { &7R16 `EiKpP& pV 7R`C0& 6 SP p~iKXP p606 Pw &\RnjkK:I` `0 p  `0V 7 V`F6 pG0C6 P60   Q  6@hTPPUڌPP   U@e@T%TڌP @DT0SP6  Qp@DT 7^   6 SVӥV w p 6S0!6 6S6 ',@K6 0Sp%d @ p6  Q p &6@bS@T ڌ6 0@S 6 pQ p 6T0dS@Sҟڄm&`V`p @DT0`S6  Q  piK~P wQd aiKmP pXiKdP pZiK ' [P p 'Q k60NS `T6[. & @ &  F `F }iK ' 7P p 'iK.P 6S !06 ,@K0p%dc& RW  &   R&EKR &KS =6  & 0SR0 0Y XYNK @Dd0 (2 >) 0bd@& b@ S &06 P6eS06 0 00 6&S R&0Kr6 0 & 0 Q0S60R00S 0[SNK@D O` dYA6S p6S1 &傑06 Y 6S6S@ CnK`F _KHJ@V v VvP @0  0@sVvk0P6 ` C>KL0C ࠖ aJ&jK  0p &0& 010@  \ &Q 6K&  pV 0&  0 uiK6P p& pp>P@000 p Q p7[`V`fB5K-0C+0S V5KG7_K @0`0ES000 0%K`C&0`7 R@&@F ?F 6 `6[& <66P&00S6 V p N&P= R000& p Q p 6S- '6  0 S6  pQe p 6@cTT҂ڨl&`V`p @DTu0`S6  QD  p6&S} R&0K6 0 & 0 6S &1 &  t &R ぁ & "s \{ &AQ6K & & XRy 06 6[l 6 @y R  & p<@ SJ &06 pg@  \w &Q 6K& pV 0&  0 mQs &6S1ӀK & & 0SR0  0Y X W YNK @Dd!.000 0a&d@0S  R 00Ac6 a000AM   S6&&06 o>K 0CȟSl &1{06 iKj.K L B0BG 00B{`BNKg @DfFD /C!b R100c`000aD A0`R_Kv0 @0A*D0^0@D0a0d( & `6 70f?6 iKP p606 60 6 & C>K0C ࠖ H jK0;p@ &0@00iKqP& p\ <0S.V 0 0iK]P& p 6 V 00iKLP $iK ' CP6[ p '06 6P@000  6p&0'6 60 7 h0K 6KS =6 6KS =6 iK P  /& &@6[F F G & >5P@000  6S &1 & & 3  0SQ0BV ?o2iKPZ6 pV iKPP S606 6K V gğZ MP0`TNژ406 06Kf406 iKP' pc /& &6[& '@& & ' 6xS-06K0Y6[ Xl 6 06 @ 8S`-06K06 0&Rb !& `@06 `x05Kp07  6\C S60&K6 0 0 q 6\x S60&K6 0 0 o I S &06 pG  \ 6&RKz & & 0SR007 0  &R 偁 & ȟ  \ 6&RK & & 0SR 0Y6[ Pl6 =0@6    R  & 6606 {06 D6606 Ѐ06 @/& &`6[F F & ̖ @d@0v cv6  V WQ{ p6w6&0 6 & 606 60 S6 o  `  (\(\ \ZVVQ06 N06 00606 60 6 & N606 606 606 606 006 006 9\ &6S1ӀKi & & 0SR^ 0Y6[ Xl6 0@6 Q &6S1ӀK & & 0SR00 iK$P pGR& & &6K 0  & 0 JR& & &6KE0  & 0 9&6 06 0& k6[@ ` 6 zM 0 && & Ѐ & 660Ѐ6 o>K 0C606 606 iKPI p& & & & 6&00R&ЀK & & & 0SR00 0Y X 6[l@ 6 W6&00R&Ѐ K&  & & & 0SR 0Y6[ Xl6 0@6  46606 {06 6606 {06 iK]P piKUP06 6[l 6 0 YNK @Dc0 6 0P0 9%K o>K 0C&6 06 0& BiK*P6 piK!P p_06 6[@l 6 S606 6Ko  V 606 60S6  6&S6 & @Kl06 6  XS ~& &  0Y P 6[l@ 6 6S606 6K06 0 06S6@&K$06 6  XSV R06S606 6K06 0  0& & & R& r& &  ȟ( 6&S6K & & 0SR 00T 0Y6[ P@lF 6 @   D66S6Ѐ0K6 06 M & & 0SRs 0Y6[ Xl 6 @ 6&00R&ЀK & & & 0SR00 0Y6[ Xl 6 @ &0@00&R @ؖ 6 j.K6 BC py &6R& &   g Su !0[6 3& & & R& 6&S6 & KR & & 0SR  0Y6[ Pl 6  @  {6[l@ 6 t0@6 o@0 D Rp```0 A R$Q] &RP `06 !& h606 60S6   S !06 6 0 6 0 6 0 6 j.K6 BC Np 6R0Y6[ Xl 6 YNK @DPd06 `6&0 &  6 & 6S 16 `@` M06 Y6[Xl6 " R R R| V 6j.K B0C6 p 6S60 6 & V V ]@V -L`D@pPQ=4@0  @O=H8 -L@P`p8=0 P9= -LkWM0 PJ/ fPy j00 8  (Ko01  0 (Koy01  0(Koo0 W:?C0C0Zp Z ppP`P9 0G 0 S  C S 0S  V #R   CS$B  V #RVX *CVR"0Z  Z p& @0DY@V F   CS(Kd{0 kG{&{ 8<@X:0 S@0cA.<3<  0c pG023T :g{+S6C0@0 P 0@VᨏXh T0SP0CN4@@6@dp@0PT0  0X0 P R000W00S R00@cpc cP LQ< X0S T/0PT0 \PP \"0PL0 dQU 0PL0 X0@ R0S} <0SyKQ0S0\0 1::S@p0\0 d0S? h ?aCoc?`(?yPD?3 B$|0X0 0h0 Y yP Y@@T VyX &2!{ t 0K k[S   k{'0k`0S {kJY[{{+S 5Cw XQ {;@K[0q{G{6+CF[5[;Gk3kJPK_Gk3kJTY {'k:[%k0qF{7{Z `0X0 Xgh  T 0PT0 $ h0S@00C0 hP0ST0PT0  \0S_ Tp@P    !@PPl[{[+S 5Cm{+CG{6{E[{J#K0@V0?0S= x1Y  0/1[@{kkK:E{000@{ Y{7{E{: T0D S s9Q@ `\ T  0 S00D0 0@(KX0SX0P@T0 P00fP0 0fL0 0d0 4kF{`F[?@?$@@>$|X0@ R0S%d0\0 U 0`S`P0@p0P0 T7PPg WL00PL0 _ `0SRYrX0S; @LPPQ V 0pp0jS0S \ L\ HP T0DZ  s9R@  LkT0So Y S@ c=0fS !kC2 !{k& !  {k&0Y{L T [%{[L`<T0S @\ @500@0D <0L0 T0 `@100L'T0S+ T"([L{;G{6+C@{;# :P@K000 {'[kF{7@{:@000Dk[3[JCk6k@0T D0S v0X0 wT<0I @d 0`` X0 0T\0 *X0ST02 WP X0S Q\0` S@  PP Xl P  Py @L`| p0 `Pi 0ST0 P p< @0<SP Q P 0\0 L 01 `0@{01[kkK:E{000@{ (;{'kkK:E{0000j@{s SYk0L0 T0 " @X:0000jSKU P @$@?$LP `FPP X0Sh0S@00C0 hL\2PP 0X0 =@00C0YT LpL \P P< @0< S.h $Y h0SoKFk&k[{[+S 5CI0  T\P10`0\P 0pT S``d0S Q iPP LP49W 1pT@pDT \P _\P  N@0T D0S S9RpT p``d9 T @\P T ; p``dT ,9RT 0``pd S hv<` <0S $@@H-M@ 0Ѝ QQ8088SQ R / S /P/Q R//P 0-L@00@ RP@0 0-L@PP00S0 0 R U00 @!8 -L@#]PP  ;q- Q< S 0C€0Q : Q SQ0 0Sn 0-L@00p- 0S PS 0C0P*P01*S0n-M ЍFF|~pqB1hpqpq1`F-;p@-@P` VP:p0-P@  P 0S RP0/OP 0?c0 3??oPP0/0/ -ML KP 0-0LM ?20@P ?$K@PBK0 呭0K0B 0 0 00/ T -LM 0KK #   p` K -- LM0 0 XC K -L0ßM, `p@PV`0 SQ @oB0@0 0R(K@衮0qh q 0SV``|2 0 Qw ``0V-@V 0 4S`R#4K0 p !-A  @Q dpP` Z& `P AV  R < QP 0 0 P PK 9=0 P T  |:V@ ?oVLKQ20SDT WY9:0V 0 4S`R{`0 `~S _X` `HQ:`0``Z~@f 3bC 0  0S SX0@Y 1 !W 3:@0A 0 J@E,  0 0 0-@LQ r   00 S!00000 PP    !9 @00 -LMP4K 0Kp4`0 f4 Q 0 @.5VR 0S SR  Q0SPB ِ 4P8 A Y80w0P R" 0 0 BA" 0 0SP Q00Pa0 V 0P   0P0 0 (K0S(PQoPIUPZ RQ  P 80 U 0U80OS0P bY4Q 40P80 9 8080 $80 i80 @ 80Y0  S 080 0800  2 Ta 00@uM o0 80M`0@q0Q R  B // 00-PL@RUB0@!S *S:P   `2 0 0 !S:  P -L-`M0 =0 0 @Xp; 0x` 0 t0 K0-S:,87654321+*)('&%$#"!   0x` 0 Q0x000S000 R   t `K(K00 x 0S 0S    0 C R P@!T  0PBځ!T 00Cx @00 C R S  p ERE  00 x`0x0 0+S -S  00 0x0 00 C Rx` .0Sx  x 00S 1 CR"x  0 Cx 00C P  x  00 B0C P`R^ P bx >00 WH 0h 0SK SQ ?o20 ZTg{@W`` V{ 9 0fk1[kF{k 5ZWX Xi%0gXʘ)0gc{dK 1 [ K0k {' {'{ Pup0K0  n R-I0C%S)'&%$|"!  \  0x` t 0 0XS xS x 00S S1  7l 0Rp  d Kh06 0"  ` 75R{dK   0kK  {'{ AP t  R \ p X^ T x 0 p 0C P P0x0 S p!0GSP1W W\pjW!сx0x0 x 0p0K0 `f`VV &0{01k{'{ `6 &PD%0 kh CAL4R*65\6h0 {0{'{ h0P$Sj&oF5`F6`h0  H5  00{  R   |KJ Pt k | p0jS`p` 0 p`0 | `p` 0j 0Q=0Q0 e`cV\t, |0`|` t 0 Sp K 00R0 0 0 @00X?ᠠ 0 00h0 ̐ ۟˟ P+ P    !H6t0 pP t0   !<6|pP0d0 PP U00`e0` PPc0 aS c0P`PU  X RPb`bbS ; P  P p. dQX pP 0S % P V  P X  P  `P 0SV@ P  @ 0R0P0S. 0030 S U e!00 00 H0| 0#pP00S00 KKH f PP Q e PXte 01X t Pt u 0S0 CQ0 Se|0 0C|0 0S| Tp00  b/o" R (J{9Hk{Zțʘ0S0@0 O   ?@?AV瞯<"0t 00 a%PL 0 0 UP @0S@@T%00 H0Sp pᰐ 堠̐0S p0 0 p0Rt p 00S S S# t0 t  00 R05 3* Q00 O  0c 030IWPt  0 CQ0S+ |0 0|0 0R00 tPt p0 0Cp0  B JHt00 @0 S00 | 0tS@ PU0@ q Rn @DPTT@DRPbp pᰐ 堠̐t0 | @Cp@ Pt h U   ͛Z{0S狸JH9> SX@0J00c0 狸00 00 4NjLZH>țHZ0 p pᰐ 0ᠠ̐0 20  xK000t0KP y0x` 0 t *PbtUPt p 0p |0  ep 00c0 ?$000 `f 0 0[01k{{ ` &2Sj`h  kh@AP$A&\%&h {{'{ 0`h SR*/B B`h    { 0Q 00 00 t0   :"006010 00  Rav@I0 Z00 00 0|0 Sft@0  00 HDtp0 0@ p0 o0  lK 00K00PM010 00  RJRt 0P 000ʛ Up 尐 pᨀ堠̐r 0S | t0S *0| |S:  0"R0!  0 B00|0 p |0 @cT ktVt p0 0dp0 X yp0K0 5 `F@ x0!PPst 0|0 00Up 尐 p!00̐0 0S-0S) p pᰐ 0㠠̐t0 00P00 p X!00 - 00#Z00St0 UCX  !R0S 0C000 dt 00 *00 0 倀 St0!  R0S000 ?p pᰐ 堠̐`x 0Cp 0|Pt 0|@@d@T|00|0 !00 q -L00 0  -RPLP0``@PB p0pap y )0S( 0 VR8 ha\*p R 80 VS8S 0W 1 pp PP    !1@p 3-LM< 0@000 00S 0 @ 2 180 080 <080A  AR 0AP0Q ` @4 \p# 0 QJ \4R\T#3PQ P`Q e<V TA0p\RT T0#03P0S 0` 1 c΁0V TB 0 X *  X*800Yd 08S (K P T@D 0`D@4  \0 \0\ XQ \0(K@0S 8@0  0c1300)LRoQ )\  pR R )R<0pp7 XRM \0JH00(K< 00n P -LM`< 00 4 <9)0p00S 0 00 0Q @00Q PWPU R  Q\ \PR pR P8 @ S0D0Y^L @0S40 0S S S7 40P@R``0 0'00U`  00UV< @d 0SD40@ 0 S 0 \P  \R Q8  e8 PRB pR@ YP50d0CSڣ0S`P 0@0 Z  00QUP  @0P0UG0UEYPj R 0U 0(KP 8  +R -R @ X  BPࠃ] BLP >  BLP@P8 b 8 C5@@ 00bC10BO40P`PJp408 0Rq48 0R|@bU 0S S S 7P0" (KQ W@ Sr S0S G0`000 400`< 06" b0 |0R@ 0R o0㩒"@ePp D@p 212 Q tPpp80080 qG PeP408 0 8 RG60" (K @ D<4@@W 40 0S] S^ Sq @00< 8`00SxWDpX )p@2 Pd1@8pc40080 d@``P 80p0d80 0@0 80S u0Sq RZ P  UQ# P PP  P00c00S pT` % 0WpPh!@ 8 w @00pUU!@ 0000S0S -4000CU"@m2P15!@"@e8 IEP P P / -`L9.(CP@Ϡpl\3 \"P T0p00 @ 0V@`c`V  0 BPp @T  0 B0eP V@ 0-LM@KPK  0`0c2KSK { BKZEBK k K0-0AC^ 0S R00A0  S@-A *@\ 0b0C00T00T0"S  13S /01\ *0CP  3R\:// 00 x 00s0QX0a00s0Q40A00s0Q/ Pȱt@-2PS A! 1 ^ pa31)`700^31 d B   S000e0eC1S00000^ 0^0000C1 0-L M !S*@T 0SR @K0@K0 ~@K@ 1-Lq`p0S2 V00AT !0S*00 0PV9N@T`P0S t0UhPV0!@ 0c!1S! $0A0=\ h$v 0-@PL0 RxPQh00AT `H0 0PAKhKhR \h0   0#1  0/sQ#8 #4 #2 #1 0   0/ -p`_L@   1#0 VP@0 0V1`@`<P    !Y,}py 88S00000P /// 0-@L P0@00 -LMP@`pU @Pp`0Y0P40 <  180 X01 385* Q0!00 ^< 51*P  0`p P@0J@@P\p`PY<Y 800C R  3RY404(K -0L@p<$A QPZ? @ PU  0P. p@p1`0S  yPP? 0S 41 1PU 0S 0C pP0`0SYP! 0q"  0 利0S x0ʠd0Š눩Z0S 80⺠ (0R0 \hl 0-顂`PL`@Tڃ0TpP X 0 0X0  i )  \2!R @@D@=@ \ @D@20 0S!0P*3 1\ ://// -LM0` P0bSH 0 \F*32P <:@0P00  E 0 @1`p@0  R0`RpT` `pZ @0`S`pZ `p  RL0<NS 00(K0@`Pq0P   (K0 -@!LPB`- P 0`0 T `61U05V0#311@KET* 0P BcTe cf 5310Q!21 PUV@KEUV+S -LMp`@"P TZT@U, FY(@ (K(0U  0 1C^@PEP`$K,K{P `(0, ,(0"30  (0 S0  U C^E50`PEPP0$K0S0/0 R / ?-PHALMP@FKt`P8 _pP20 S S/ Kĝp$ 0: SQP 0v``0P 0$, ( 0 0 Kl`H1O00 KA100<100 KD Lps 0-@L#00C0S0 P#0P00C0S0/x 0-L0rS+ wS% aS 1000Ϡ@0S fSČ xSˌ0S eSŌ +S0@S 0̠@ @0 -SL@6 #P00 PuP!U !$ 0S 3/PP೼000P @ P N00 `N00aay#0```0 PlN0P 0000 0-sL@ !R !P 0C000 0 S / 10-LQ@P00S: 0  R, 00P @ P /N00< Q00S; 0 $0 3/0:s00P    0@0000# 00 P0P48000V P00s0{! 00  @00 R -L Q0P:Q:0Q: Khe(/ -LA \S :S6 0@@ KhQO6 0@@ Kh/006 0@@ Kh|000 0 0000/0 -`0LSVMp00@ F$/oP"/$1 1 0(1P( VV(1 Sz R (Q R  0 0P 0$K0S+ \: P$(0Y  0S(0  S:0   PY$X(1s(Q0 0(QS 0S0 $1 !0$1  0 ^ (1 (q 00^" P R \00#0\0b0 n 0(/ 0 ,!$1 (Q0 !$1q0 PP[0P(Q 0S 0 0$!~ -L,ML  ` VD H0 8 1/`3/,(0 Q000  0P@0 @ 0P000S0 K< p ` aZA p WP#@TT)  80 SZpP6w&< 0 ZPC 00  P 0p PR`/WD00CS#@ 000(K 0 P@ 000(K 8 PD0S<-H0L  %V@ 0P00(K0  SP;(1 CW" @ 0  SPH0L  VP 0 0Q0H 0S 0a0@ !RS(q $1 (!0$1H0  1ZP 0-L@  S0 K0h.00,10 .00,1 0-LS@0 K0h-00,10R 0-L@ 1  0K0h-00,10-00,1P 0-L 0At 0@-00 -LM41@S0$Ka5 0@ 0  1娀K$3/0(K'K%K$1K  0#K"K  K1K 0KK1KK |Ph@ RT&K!KK 0KKK1K0KKK1K0KKK1K0 KJK K 1K K#"0 KK!1K 0K'1K&0K%1K$0K+1K*0K)0K(0K/0K.0K-0K0K,23KK71KK04KK65K9KK;:K>KK8?K=KKK< K pKK`KPKE`0DPGFp B`CP@ApS`P`P`pA/`Fp APM_`mU`> 0Q RP 0$K,O00,0 ,!) -L4!PPp@01S 1!0C1J1S0C1JPP1SMo@@P J1Sp JW0 ,pOoB,p,0p 0-PPL @hJ00Q 0-LP @41S0 P0P0100u, 0 -PL`GP@ Va0pGP V0'!!0VK,@`G,0@ -p⠇QLMMP` wG@P U0q1   *,0S W?Kp,PI,0P(K,0S,U006p$8p *  ,  (4 D0 0 1+@ +U K3PjDP V~ Ph0 S400S 10SRI@4p;(P31 D H  0$RP:H!72 0C ,0< 0(px0Q2Pp!V QU00qQ$$1P4Q9EPP/ $0t` ğp  $@ p  `(KWK ᵗP  0pD '0T V 0S 1A/' R"|R  pSx#0S0,\ p \^t !̠ Q0Q "RR$ #S(S4 0.,^8 0 $0!pQxQpRx("# R!pSx, "#'0$S00&!+(Q/ Q)*"30,R%pR$-S. #,1 0 S$2 D04p< 8'7p4W;Wt? 6p.|8p^x^9p:Rx"5" C @R=pR$AB ", S [ C [ C [ C ,K"$ [ ApX AP+ a50@R&00CS"  13/@0P(g01,P6 0 pDN! B2.!!HOPvj4RR  *00~*@P]z*0S JC00S 0\000 i* 0 0`*P]*`rY*0` Hpt -@(L`10p0fPV(p V؁ EP- (!1 !01 0P1!D0D0 ,0 U000,0,KoRꂑ CP   h)G ء 0-@ 1L3/,0( P000 0-L@Q 00 210) 0 -LfSM`) p0 )00(KX RD x0@@0 <0 80 40 00 T0 013"000 , KDKVP,KO00K  @ >R0-L4M@D @0 <0 0 80 40 2K 1,", , KDK/P,K(00 0-L@q{K0hp{R q0\/ R/0 00-L0@0S- 0 ,   0 P @P ,0 0$0 s0 00R 0   00  0c00.:0`J  -LM@P`ppP pK{P04 :CRo  S L   K; 0K ;  0K (0S  o1>8 n@0 >D0 KZ(Kp40/o?o0b! \# \' 0l8cԃK7 K A 00o?o c\ 0l8c7 3Zo 7 #K`s@`l8!7fj)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGOƿ08 0-L@ P 0 0000X / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOz 00//Q R U / R  //Q0 R 0 000/ 00/00/Q0@-P S@ Q ^@ 0SQ @00S@@@0Qp@-`$ S^P  @N@@TP \^ Q@TPpPPQPSP Q- S Q  R\ 0S0 S00 U /Q /Qp@-`P* S#  0C\P S @ Q@\ @ 0U0p@PT Pp0Qp@-@P`# ST   ST PQ@D^PPQ Pp0U0pS @Q@-@! S P0C S QP  0U00Q   U //q 0/00/   /// 00/R  -/R0  S Q 0 0 000/ 00/R SU/Q 0 S0  /0 /P00 0/-P 00 0S0s R 00/S U/  0  0/ 00/R0  S 0Q  0 00/ 00/  0U0/R 00/Q 0 //0 p-Lx0M@K P`0 0 00 l l00 ll 0RKpq 0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$0$ 0 R /  \ -LL0 H 0-L@0P p`7@` //////H // -Ldq,MPp`@T T@KZ( f01 0(@0T@ L KP0 5/(KA0S% 'pS# S0S S Sp0STWXl00\`00T0 0 @,00 00VVUUUUU/O/_/ 0P-LP DS4&  ஼t $- @ 0-L@@0T Q-L$ΟM 0 ` 000 000 x00 =00 =00 =00 =00 0%SSpp;S~ P0@p  0EZS kdSe$U=^2(k~}x0 0Tp0 ,K,K0ST5 p,KS00K R0 P @ LKp p 0ㇹ00  g 〹Q@ PPLK0@Pp0C c0  ATW `\ @T^ a @ W Vp5`2 ^ 0 V B5`2RP: V 502 5`2P** 0a 0 VA05`2Q 0Tp0 QT 0K Ό00 `0QQ0@0 0c @`0T `8    0  0,KR03T] K00  0ST@00Kx 0 b P 0 VL@5`2\W}~ V|*0@ Z@Pƅ` ` ^u0 a VL5`2\j0pH  n 000 E 0F T;ȣP 000 R 0 0PP 0WP 0 pP 0+pPlU 0P 0|ꀀP 0x ,0K  cpp p 000 Tu00 0Sn 00K@P 0N0 E0P000 E R0 DP 0? i g c@a  0 +[ P 0( p0S# T 0 0PD cp T `P0*UX 0 E R@ 1P@@0 E RO P 00T 000S xP 0xP p00K0  ".!  c cUQ ,0K Pca  0   V05 `2 000 R,K0,K r0T,K-pȣ-p",< Tpp p K Kp  RTD p   A 0Tp 0QTp m 00K0 V F 00 0R(K  0 c<K Tp0 K Kp 0ST pTrp 00K k 0Tpp00 -Q& 00K 0@000 0  j3@1  Q ?,K2 # Tpp Kz K RT p0 xPp 0 p 0 `p 10@ 7 T0 p0 Kb K0  RT pY@ 0T 0PT |p d_0Tp 0p QhTp0 K p p( P @ O K00p 0SDK÷T 0  ,,,,@t0 p 0-Lp`0@TZ tXP 0@DS XP8/t`pW  -L 0S S S 0R o 0R0`o -L@`pO0@@@P ᕞ(0( 0❛>P\  -`AML@MPp000 )0`$0 0R`/(KCK JEK  0 0I4-P Ytt 0 _P0+ 0X4 iX4 040Ki054K  -L0S0 S,QU) Y&p@` V 0`S00 P@ R \ \\0S ?P PU \ 0^1S30 ^@T0S S -LBM M@ P 08 @<$ 0_uP`D4 U0C~KPEpG00 &PU$:4 00NyP@V: yy84<$YP@jPD40 0R(KjX  -LTpPBM `M<4 8$ 0 @TP_0uP@ 00 7 0^4:0x0(S2 840?s0U @40 0R-(KUPE& CKH@V: y~y<4 084 tP PU:4 00xP840x0(S8  -LϟmM M  ϟ6 & 06 000  PU0 !R  R  `   ?$@X@00& FN P 0 & p N R R1 ( 00 P0Uup ```0SQS 0Sʰ00 9 SV 0S P 㔖& 0& ,.  & < & Udv?6 06 06 60S'1S$ &3t6 0S# S006 -1 & &021ATc KgnKg^KH}K`FPE*06  0P  4/P NF<&N R  & R f0P@ leV\ .0 P 6& P0 & U&6  & 0& & S 6SB6S^ < 0 x660 0R*(K60S6 A06S60Y&S6& 6  FPP PPP60s 0;F T6S6 PiKAeNK  ?0 @D =KpD 0C6 0C6 P`06 i>K0C P^ cK NSD V N fnK `F  :06 !c^K0PE 00FP00p d@P T6 0R 0`1 06 S66 6@CT0LiK6@l #Ϡ @ 6 C)l$"(cP, R0S N\6t6 0S06 BA,  02䑚 `Y`F C^Kc>KPE0C p6 0V  * PPu? 6 p   Vv2Pp & 100& 0P䑚Y C^KPE b6v` Š6160SAT 6CCNK0@D 0 04t*P0& X$x7  PXP0 0 R  ?L:   & &P `1 ) 6 QK  0 0 GP0`1  6 0 006@CKu`H Q! P P` U60S P p C^K PE0D6 cP0S  p 5" H@X@0J 0 R  K1 0106 0S- 006 4  @X0 c.K0 BV&   P !8c6P0 Y  <4 X00& 0  3@X< (06 V06  0 L6S<06  &0  0  0AQS 805 0 @6 *F M= 0  `1S{   aP0 S6 6 6& 6 f1Sc &36 60Sq S006 @2p06 06 ,206 $206 P1h 6 bPb0&0FaP101eNK6 @DcKPD Hs`Hu]K PE& `60Prc^K0PE6 0 `0D  T`0D `r DR `P 0@6   6TK6SH 06  6 yuWw0zw 0 D6 `&  h4p0 d l 4 L p  l@, T`0D `r DR `P06 | q B06 &R  gr R  0T `r DR  R,#{`Pʤ6 0R 0`1 k  (10X`0W0    JZ6 X㰀  10X0{0xF  & E`!!,! RA `!  1&@x&X0  \ I0&R  ATU g^KpPE*`& 0tPp4/PF$C`V A B0+0CSj 3f 9  2 @X03066  3(XP0" 0 R  Ik06 d3 xX0PcNKe.K@D B0T6 jaP~P o1011S1{0  4 @X< (06 V40L uX 0x 6 0H06 06 606 w +0+0CSe 3a  HM0 Ѝ/ /M C0@-@$ @0 S13e86<0@0Ѝ/M0@-A $ R0^n  R Cn00@ Ѝ/M  R0 R0Ѝ/0 0bSЍ/ 0-L$PK M@_`PK04K^`P, ?K00K0 0-@L0M-  Ѝ/M0-Mb@AD Ea 0Ѝ/ 1-LqAM Mp@ 0<4 000 PP$ \\PP CNK`1`K+0R=P 04[S ! 8$ 00@ 00@ 0S<40 0R)(K`cP840 @S 0S0S 00@ @dJ @ @pb @곯  | -L@CM(ß M$ 38 0PC~K@4 `0"D  00 H$ 00.; 0p  0  PC10<4 0$0D0S `0dPM0 D R6 !8!1 0 !QS000 0 @6` ; P0 <00;     P048$ ~r8$ ` PD<rrD40 0RD(K` 0Q Q1 Q* YrH$* S R8* S S00 Q@ 0S< 004 0900P6 ) 0,6 p^>K 0C6 K 0CόqWŸ8@ P0 %`xqx|sA v   f V`0S= <&R&`0`H H@SD ` .S`0SPPU00V0S .`F⳧V00U0S 0 7P !  JD60 0Q00H(KCNKᴨP.ሧP `Z< 0 C0SQ Y< 4 !0x3!|3p4DQ PD@P0Qb4P  j@F u<6 2  Hs@- P27$ \ hLHX\XLh\d\P@X0 -L(M1 P@7΃`LWV T' 000 K pQxp h0 000<0KUPT 0000 K08xA-P P00R00S0@p` ` 0@PR^Î P pP` ` (0 $00-@L0LP \ -L,0KQM#T P! HQ U P1`0P`1  @0d X \! PP T P bpP dP PPhPe XP0S^ X1SI0PT1 0d1 @T \Q `d XAPU &0@QU #T QKP V`e *HP 10H1 P1 `P 0 00(KP!0`0 aQ*T!\\1  V:\Q0WX ,K1`bP0X1 0\1 X1H"S P10xP1`Q 0 P 0H1 X1Sh P d!T! 0PS  :X0` X S:`ap 0 SK  0p W`c:0pX! 0p0V:  X1 `cTX1@T1QKC0@p W @   V`i *bHPjP1 0 f0 T`0 /^P1 ` 0 (XQV00 , 00-L@P0q000l 00/DK 0S Y 0 0  0-@LP0R0000  0-@LP 0  0 0-LM0@KP   P0 P ,aPP  0 K0P  0  p1 l0h!-LM`TQ Pp0 RpGS, `Sqp5 K A@لP! 0ӄP 0S@0S0@ĄP0  `K|0x t  KX0T H `ꨱ   T ܵ@0 -0LPU# 7U#P7UP!q@@0``c~0P $000v P E0`1$ (`P 02~P< p7-Lh,Md' `G0@<0 Q 870  $7 ǟ0 8 $GP(@6 040 PI0S&1 `V `Va !Q & 0H6S 0S1!Q' 000SM SDL&00 00( 0CQl VQ Q \ B:Pd(K80a0VU-ڰ0e%(p10@PK]_djv{0S 00(<00 0 4 p {4 0(04 QPe`0 ( P(0P ( P PT\\$X4 @ 0 0D H0 upp @(04 00 (04 0 (030@0 ( b@0(0# (0Q3 0(03 0(0x3 0(0d3 0(0P3 0(0<38#0 (03 0@0 ( !@0(0xRP0 Sv*"` S(P0(0 0 0S e00|20(0T4ǜ\ \ QS 8W,b` R *``P(Bp)  (0PCa` R! PS(P0(0000P$p fp0HP p 0fH D0 R0C  @0(00(  0(T PL<xx<$  tDx4T p`L$((!$1G-0 M X3* 0@ @ 0o<0000?0_^S  00S :P 000P X0SYЍ40 0 $0 0 TXD00 , 0$-L1똥 4 -L@@`V 0 CQ𨝈PaP `F iP8P 0`0, 0-L@  0S ^0^ P PQ1 T0@0 D   $  0T0  0-@PL0T  0S  T0SK0h,*K0h&D@-P0t @0 00Q,0@0AP@, @10$000h  -L@`$PD 0(0 `0S 1S0 $00 0P -L`0P@P PP 00 - @L0P@S  P 00 !   $  D``$p0S `ء : *- L0DMH ( R p*p0 @ `*H\ _L L* P @Dp 0,0 P $*oP4P   < 8  00^O0S8p < P4P :P 000 P:P040S9U<9i0)`X P 8 ,< 4 T D0 @Lc04890 QP  8014S P @0ȟ0  R   SȘȈ QFLKJ+IE ( Q `80$ R P80, R @80 R 1S ( p7 Hp0p@0 00$000NL0 G<@@0TP,0p0G70  P'< T0p=(K @0\G0@ q0c0C\0 ,0S$0  q ,00PV*@@ @S M(@Te0bS P60Pz@00D0 H(K(K(KA(K(K(K(K@0@Pb `DPHp4&0 00  & 00PU:H B50@(K@00(K%H $ L%H X , KE@$`PJ 01Ghob` @P ApRq, R$ AQP%dP  h` P    PP p00 AQ6Q``<4  0 T 4 0  1 q, @T hZ<$  @p@pm$ 0p0C?dPh` Qp1z#Z" P 1! O `  WB $失p$剃P= 01h#  pQ $uP 0S%$ $0 ͂P  0q1`0 `0  R  Q \0Xp<TpK@00D0 0,rp$ 1qb0PP@0P\0PP.10< /0S00 P0@P ^ό000@Pp! /:P( @0P0D0 H10 P81< 0 (18 0 Ip, 0 1W0pX0<Tp@00D0 x $PHL7 |pH(`, x|lp\ -@PPLP  Q 0 ^ p `pq^0`0@0@0 0   $  蠕  -L@p@p`VPP -U01 PEP1S8 0 0 0! $ 00<Ĕ Q -L`pAPPQU0@P 0 p``PPpP(P,P0}h -`L@PP U0N  P  0000P   ZW( 0-L@K0h0/* 00$/800,/$0 00/ᘒ 0 00/x 00/p* 00$/00,/000/000/ -L``PU @P pvq7@P<0< 0 ($,` ) s/ L-LDM@0 < 0 0 $ K( 4) p4 0-L@n0`00K0hp 0-L@Q 500 2 20 0 -PPsLM@p 0߼p T 0KP- P       傶PP 0` 2+ "Z &= " 29 O0 000 QP`  Y =00:@ቺZ  K2P@(K 2R<" 2 2: 2KvLP%K0A 2< 21 10 01 x100P 0 R00 0  T 0 2 13/p0S 2: 2EP 2 @0 2 001N00@l000-00صPP ` 02 2WP|$  X -L M@`pPQ 6000ESR7PNM$:JB"P?o2R0S  EPH (0$P (p0 2 PL 0  K 2 + R0 2 , 0 K0PU "U00(0 $P"PU00(0 $PPU:0  K13/p013/P0"U00R0S  0 -LM@`pPQ 00U30PU/ 2U 2 0 K13/PE  `P 0p  2 P  0 K0K t0 0 0 -LM1`S8:Qr,P W( &*@,K@T 偭pT  ^ 0 P $K0 p PXBQ$KpX 2< 2$KP P 0-LM`8 Xr40K2<0 5:*Q̡P@9p@ W ZJ!P` zP* ̑1Pc0P U40 80S 2< 2(K0< Pl4 0P P 80S(K04 K P (K -LM1pS8:b, V( B R$*T&*H,K RU  R00U00SR 0 [ PV U`"B$K 2< 2$K$K0P 1 -L Mr RWb-*PA24K2*U4 #0S 00Q S@ `0 0  PY Up 2< 2(K`@(K(K -pL`ᴁ@P08v` a6V`F!x0v` ! \ Q`0 A   c R Bq \~ S2A0C2p -LPi0P ` @P   -`PL@Q 00T T(0 2S $AP$00C$0@000Q 2Q@AP 2@:0 2@ -L4M@`PQ 00 Vx 2+ R (K 6 0 0+ 2 L`K@  DpKP0K$D0 +?40  0 08/P8 1a\W:A Z$:0i⊠s011 " 2 "0 2H0 0 0RF(K GR   j 0@1 2Y* p zD Kcp D8 K@ 4 @`K8 < 0 ᇶP202%X  -L$M@pP`Q 00 2   R _1Q喽0" c!24 00 00 40 VG UDCW@?E=0PU8 U 2 Z \* 2<,0 (0 E,0K80 PS U08  2 V04 KEP0VP V$P 0   T0 K0  K0PU U0(0 $P0PUP`P,  ( 13/p0 Kz0P "1! g,"-AF=OFF|h,2F:I;HL:h $fhpC O!(~h+hh'1F,H*K+K9F+J@i , FF`9FF(jj#F "IHL Fkh;k`+(FFT iF `>  ]b@ 7 !6g -AFF F`FHH(F I0F^PFHH9h"(F18 HH F@F;hFZ:`@# F(F@?+F;++O0 HHo ( $0  -0L< d ( $0Z  -0L( 8 80 0$Q/$$0S/ K D-<<00 R/( 0S/ xK 0--AF hFF#x۱/! F D M)ha Fr0khBF1F8FAG5#FJIHy,\ppFh FHI \GLGJ)F0FrCHl(.b($ B(7AK"Fh4be(Of()#bt(n(Os(#`u(v(#ca#c``ca`#,4c`#ca#a!(H6&IF&H 8$KLh,4"# !## jF#0#00I @hKJh:Zh*hi [i(F(FH(ipRu@(hppiw-O$Fh FFFI &FF\%KO J)F8FCHf(,L( ( H(EVFO R(X("P(;VFFu(r(h(o(/w+*&FvKhO #OqI hB:U" -ђpEђx ; `gKh/ ~и`I  ''.'Gt'TU#6PF FxRFOI F0LI"F j%9F"0F,F&EInJ8FJF(`кP0; +?R#Օ}}"QF8F$ `\W1F&F&Hn $ `\J1FF Hb0MX (FhF!FFG(+ H&hI 0F'8`R@(iԈQl{l|-OFhFI \JI#NMFĂĢ3` `+``9FJ FnAMa(O7N(+H(!L(H+`#`'P(!R(?3`l(,f(JI#i(4 `#(r(#v(#p(+00#+``J`#+`003```# `0xJxJ`wK,qKh{3h qI0#+hh+mI (##3hs0C+hc#Ch+#Z]K <` fZK`bYK@BZ$ YFHF^oZFRI^HFHD`/F O,/*Z `hB BIhS`#J$0h#=H;H0+`h+6J,o)L#h+5,W(0W( -I .pCO2/@6%J&I pCO@,#O T_->(F (3"h\/)FRL @ H $ 4 , <  i-b( 8 lD 0 *FPF(ЫF4F(𪁴P0;+ `j%j\b)FFH!jHv+fI_h#kFDo\Hl ù+/!HFH  FI  ,j  0/+H"!FQ/'9K`oY`4KOq4J.9Bq%HF(0TTpCOn#J*I`8F[/!(Khk#Jh;`+Ph #K@?#J!F H(JУm Hh C!jH4%(F<3h+ЁQΉN .T< zlD Њۊ3h+?TQFKh+?Z(WJ!jH,P%N*hI (Fp3hC+h+ŭKh+,W(3h#h+?ȭ##, L -OFh FdI [tJ!F(F0ЗI,KNh@8L`j%F Kbccb "cF r(bbjI FL FKh*#j_ԆI LH`j(#bKccb10@!OrcO@cF @(b @ k@aOOr[hF`jG#jC#bbjkH+BjkI fN0FN fK@siV^i0(`! `^KgBB(0F0D(`(Рi0D `(+hk`#hc` #C #C#0CO kickiAC#j DkiG0@N@@Id1F?Hr?I ?O&>I "=K>HOR^````hZ `+0 3K##C #C EE ժi !hh<YFhh6kiih[jjG NFOy(y^Y0rj<Rixp - wl YX ] a e h qj~H3jѳk"jj#GPqjsH0w#C IE@E#C #PC0 #C  #C #PC0Y # #n"##!#!C A 2 ihFpjh+iDk`8KhG6K7JhB 4JB3JB0#-MBB҂!hh:###%MCY Ъi!(h&#)hDj#i`g#C j-K(FkiG0h+ I(FkjhG0 I l e! q~P -OFɰhFI [L|JAF8FNBi(2a(G(O"P(rcbg(h(l#ca#m(k(l(a#`n(t(Y#`#caOCa#caOca##b#caO##a#h jIP +xhI fn+kxo+5##(FO c`,!  `FpOJF `XI7O `,!(FL8FkJ+P  J+w|NIFNH (i+sj 3j IIsj#@Kj FIFK!hPFBI X%0# O@xC<#8I 3 T(<" (( h.X-$ hpCO# h @]C)DȹhCSY"J!h"H,D5(F)(K*F!hH!hH%.FD B. F6RBFRh -ˑp:gi0ڒl@( -O %M B@N @^Ci+4УhBHch#Ho# HoYH#H j3b+PѫibгOгoJKhj(FFuKcsKXczKzK+c #kc kiwK+c#vI(chK[jsjoгoIbKoHkjk :lH+kFjK+jiHhHk# #a#KA #JKB[j+VKOqUJj/TK@QJSHh#BB 1F8F"CFYFFPFFF9F0F #BB 1F8F#FFF 9F0F#BB 1F8F#FFF 9F0Fg w #C # #@!##[H4BFgKFH h F&Ӛ 0]ڔUMoHF icijJ hdJh _Jkj#BE AFLKFFFF j@F?"icij#BE AF,#FFF j@Fgw,#pFBE AFpF #FF F j@F #3#gRF[F)H #C # #@!##[F I H+j# #c RKVF !#2F;F@![2F;FH H 3 I/ba7MLQS-Ah( hDLKH!FKH8F4<p#`$H>Hr81+:J F2K:Ih9KhD< +7Hv6J#`4K"`K W/K"FhFb#g tOO&KH9FHF@F[K81+> ^ċ ip@(@ d6eA@ 0   lhpL ! fp H 8JKIhHJIHOH9FR (E K81 J8FKIhL  !pċ F hF/!(FE(F[IFZM'#YJ1F F0gWKh*bV#Qh 0)F (Fh(+L(# F(KoaIJ1F FCCK%P(f(=#/aa`s(i(n( 0v(w(,`#k`o``#a+a/`ah0J)Yah]i-$=$- @&Iьi a`**R$Iyh"V 3Bh:W"P{iF(F PpC OB#`iF(F *FI pCO?FWB")FC Fred Ri7lF-OFhF[I Z h#C&FUJ9F(F"Cm(p()#F(LK LIhF@XFHF~FKhW#0S&yD=O) ++T'F;I8FN9I PF6I F8FBO;\ F +2FF 0(+&UO,>h F (pBO|#`!F+/# 01F F 01F F (۹1F(h 0)h HO@FR@(Ԉil-OFMhFSI ZRL'RJ1F(F\Ci(v( f(#``#``g`GK- G>K??Ia iFT' (pCO-ahV([ @BT'PFoFT'  ,I2 -AFh FJ!FK(F`iF 8#iF # FiF 8#iF # :iF 8#iF # ,iF 8#iF # HKL!"a````K#` K *(  "( ( F(sJh e +  (   F( +  (   F( +  (   F( +  $(ڳ  F(ګ  (}(!EH \EN(0` CJh FAKhf0?HbF(x=K*F:L F DB=/+%1KF` 0I 7*F!FV,J{3+H`/#{U)I |sh;+n#Kh"I Fsh3 K"Z` #0p?!I?!?!PQ7xq?!ߕ?!@!!!½pFhFI Z$J1F(F,CL(P($KhB3D!FX8F L7(L .Rii-OFLhF%DI ZT'ga`JQF@FC(f( R(!P(+`W(d(%ѥar(i(#e`av(x(ea#ac`%beb'Khi+@ہ"zI O FP-7!(F8PB/!(FHEx/*O9*x.*jx.*Ѫx bH ##aKFS/C,*  ]FFZ&0+x(FPK`FiF[h;( &&!!.F!cj Aci A@"@FNFFIOO 8FjF(𨀵P0; +M3LLLE LLikj+hj,jZ4I"FF Di3kj+?++FP0+3+5+S.hj ZtYFF$Hi+Ѫmi(j,(")F8F#+*ѥi+Ѫmi(j(i i (i+݀h+30@!Ryi Qh#i @!io(ii+vh+?^ph?+?Xjh+@PbhZI 8F i)FVH##aX[-iF(F cj+N>h+8h?+4h+C Z)FFAH pCOѢi2)F;H#3aiJpC`O(F `OjF)F(Fd(O(F h+(F FiF(F(i3)FH##ah+ h?+h+#j+?}/z(F4u i)j H##a#j#0+?(j##` 'lQ-AFh F&I 'Z"$J!F(FCp(O KhBO;%DF ' ( !h%HT(/&h/!0F0Cx+3x # 0F h(1FH#C(FRRilpʰ ! KI(`Oܿ"`ZHK0 #d(YKh+++" zK"`yK`"yK`#wKhwK`qKh++πlK60+ɀlKh+ĀgKhKjK"`iKh˱hL hCh;C`+"hhY`hZ` "`Hp++$\K ` ~PK"`PK`PTFKn0+/hx-+ MH#NKH#I+#9K6 :(+ [0#>K"`/K@,7. <B B r lBѻ F $B F \B*H(x+#KhKh`$ M&U$1F4,! K0+ Kh+ KhsDB!RlTB!G!G!J!|@!|B!LB!HB!dlPB!M!-CFЁ$hlkI Y{jK`0B/gIV#p8FvF8FE"bJ1F(FBa8($ZN!0h n(2h VI"$$SKTIh b(OI(LI JI N(HHGI D(EH, hS@*hh#x320[ FFF!F "&I F0a#!F He3; (IKI (HR nRi@(liBt @ht@t@ugthh Z >-OFhFZI YjMz$FFFxh`oSBSA+`KOJ9F0F C+P(&H(L((+яKhf(R(##h( v(#O F#O FO FFK.  &&кtI &F&&O2 ``,: W( :!F.!Fh Fd0FKW(@#x#+UI F` SI FL0W(   F 0"FJI  `"1FXFBF&@Id#"!F8F*8F\F(RдP0; +8R#Q_`j&jYt1F&F%H$K`j&jYh1FFHKKhhiG8+!jH&+ jhI 0FR(M!@(iB4M!Q`|{l-GmFF]LNFa]L1a`G1]1`a`1]@C1`0`H.HFxNqhIHFB0h6JFIci+1ڟH`K"!&IRF tK"`J9F(FFCҀA86(ȀS -Q)5AI})#P#1#11v#1#1PIPFAMIPF(V@@XVS#!20K##1C11<##16h3`2##6B?, #F%,I hAB@BB(I 'J@AX ``i JEѐi\ ѲiEђ!EXCBCA#J`##111C@ ,8M!,O!0o!PV+4o!@(6K1+&&Kh-!"..|.W#JO!!Oc_ڝJ1ds VPpCO#11+Iv-D8F#1c -98FHBKJOaK(F22BF2~H}IDF(Oq(F qJxI FwKuI FvMhb F.F ## n8h#+" fH` /BF aL " ]H2\I(F"FXXI WIWJFrCF FYe(F(E(" z+NJI2F 2;HCOr!9HD FF F$8Fn2 `?:H9Hkh;k`++HF+hZ*`x F (0 sh;s`+"H~+hZ*`x$ N,Q2 0 -J8F0# KOR 0#KOR 9F H8M!i8o!=ߕlXM!0o!pIJ|Q8?IXhp-18FbI"Y*FXF2FE/("! ""Y* r%")Fl,<F OI"F %WF%5B GIXF B0@EIFFBHAIF(F\FBH$JU#BHD0F b#s#2#0K(@ K*@0+@ ~K*@0rN+@/@Z(03a2+ rK*@ *@ *@p/@|!2+@@C0iBF^h(`$AFh+@\H V[Kh0XKh0VITKh0QKhDKFX`F+?LI H[(yFI J 2  0+?l7K0+?j:H *?i0+d5Hsi3d3Ht~r/b#<:F#=!<0?SF(?LF!<0>0i (=pCOK""1H8K7,!N+l111i8!2@(1122@2]2Hw!28!"0i `0KHit%XFHcOrHf2+FI"F |0!D!($I 8KhF I 0'='T "1FT ] TH2FPF T |FGEGF8F,!0!I$!@(JiJJK-OF F ` 8# # ,JN#I$`'FJ3pFK袑F ```J)FXFBFc+[U+F+lP+B+@(a+#I @F'CV;KlOT&lO ܸLиa2KCFLsܸmwиz>#(M:'K(&M4B?1"K@B FF( M& KNHh3x#P5+7Km ( KxKx[ ػ!v0!Ȼ!d!e!xf!@(g!i3xP5#L (2x ,јP5 + + #*F #` SF(ф6FPJPI2F"hPF0MI#hk;"SCZ8)F*FCJFI,F FY F?F&0Fd09J=I FB 6J:I >0FI1J7I h#6K@1-J9)F FG"! ,0I F.I F8 -K@A,J!x*(" 'I Fh0%H$I FF~ ( KOq J H(F Fh3SB*FF I F=0I adԾ)EKiP?`*ui m I HIAH@\8(!8 L I F( F4,(F I$ FI"(F5 F8@:0!$eU8 L I F F4(F I FI(F F8@L!yq-G(eHdH(cH!bH 6(8йB/ع! .\H0F!ZH "YKXIYJYK( FXIXH "\0 SH!IH 8 :NH MK"MN !MH$ 'O 3`O jO #"!FH%^#"!BHW"F!@HRO3"!# ## # #"F "F H"F B F(F  # "!C4-  0&h=%K0h]`G ^wvGQ҆8A)!-O%KFFF,FO6 J9FHFBl(xR(xg(F(@ r(u(Dm(@5#iKIh&4x#+Vf`h " 0 x+F " xF+~KIh F(wKzIhTx#+ ( " 0p x+ " d x+dKgIhO y#vdKh 1`M+h ,h&4khB!F>蠹!FXH2TKUH,TOSH$ 6 4(MX?+G PFW#pFo sHx xc)p)b)CDCT:*O  3I CT#.I .hù  Eq#" `3h C* x+йUѺR0Kh WKZh#B7  3P@(#Ԉ:i!l\p0pA _FX  OIx h310YLILIh O F-4#HF B=GFF AI-mOO !F(FF !F8FX(I2h+3I:F -(FBFKF!F8F>+8F8;#KEBE#pO *0УB!F8F8F#!F8FBFKF!F8F ( Js2F8F^0 9F H(FOO 5ul-O$OĢ FIJF&FF J)FCNo((a(A(@O NFd(f(@ D$u(.r(t(v()w(@$&#0 x+ DЀI pFD4030vK (y(-(@.RFF(J=ikI(FDPiI(F>(hI(F:(AFhS(cIh(=h`I(F&Hxh` zh\IjEOa*FqZFqVI#h #Fzhh(&0Fi! F@GI R AF(D0 (D6B J@E QU*F 0U*  HU*FhU*NF8U* )I  G0nFHhI0F#`(7F &5[ZF(@F&F(7i I8Fp I8FH I8F~ U* IP+i'F`l]hl@(!7heI8FT퐹U* 0@F ( GhhOa:FqZF(?#BF(F #FU* OaqZF(?uFIU*(DIEHVDOiAF0FBF0h+>I2F `1FOb P/! PE U(F0(DB<9r#!+p PCF0)J(F)I (F(O$ &I(Fv0(F0F0D##`!hML̂KJ)FF# @3 # JF9F0F$CB84(>8<<<>I<5<<<<QZ<<<h<<<<A<<<<<<<IY<<<hw<<# qIPF"oK oIPF(lImHlK"`kK"`\Kh2"#"#fH##"!h cK'#O2#`H##Or!h]K`CB?vMKZIhq#h+`n#"#VH##"!h>K`_#oB#OH#"#!hh`P#O2#IH#OR#!h`@#oB#BH#"#!h`1#oB#;H##"!h8K#O2#6H#"#!h(aKh۱PFUh0 320Y)IRF LhPFvoB#!H##"!hjKX` !!!@(PV$!p(!! !-Pg,!=u#oB#H##"!hK`#oB#H##"!h K'#c"#H##"!h|K`z#oB#|H##"!hyK yKh[#xJxI hY wI8Y\tIPFT#aRqIPFLaKoKoJpIynIPF>iCkIPF6 iCa1RFfI."! h& (&bKbIh!O2oC_H#OC"!h[KPFUX0 320ZRFRIh PFv :!PF H /!PFDGI60 FI1#kbDKELh(Kh+$AKh2*Jh*""`x"!8(8civ.v Kh+p## i+.IYXC@,H\(JSax#8biIh0&IZh5 K[iZUT"H NI0!lk!!!a/||B@(t!i! !Er. x"!V"!@FhKh+EЍN3hOs3`KOh#C@V(FCF@1hOL#hC#@!*s!@(FGF*FvIV0*FsI#h+ 4FO4*FOaYF(*FjI <FOa `[eJOc( F[_J`IfVj0XpCOXJZISKh+C!THRQJTIJ!0FMJPIA"KIOHOr Kh SC3D@Kh+BFKF)FKm(f(Ovi(b(@̀OR#H##Ob)hKs(v(n(@#oB#~H##")h{Ke#" (hwK x uI'*вrK"`h3zdK"`uO2#kH##Or)hgK`CB?cYKeIh 0"#bH##")hOR#\H##Ob)hLK>oB#TH##")hQK`/#"#)hMHBKX`" O2oCHH#OC")hEK+h2J 4x+@IOO =Khh3#K"`/ "!"!HFT%@#M`#KhOr`+hS'K@!#*s!!@ FC"FII0"FIA+h+O5F"@(o p!Pk"d""I"lt"MiNOcAF F2F[2ڨJI0+h+CBF9F0F2FI! hFI2F8F"1FH t6 <% "HJQFf(jOr4QF8F JI8 8F( O5 "}HF0zJIJh3`~I !>*#CpJxISwIjz(vKjJvI hL nOsN;#:hz4P:h#>*dK A #*s_I!>r*#BB WIhk9h2hph#3(F0@JK LI##"FxQiOr(F0!FCH6O[ԱYF F =IZF Z;hh+BFKF!F4HZF#yE(FyQFBFFB(I ,iyPFdK$F*N44+POQF!Ey,Oc5p! F"-D` 4"`ZQFOPK!EyOS4$*K$$&KhCF@F FIF#?h$ 9FFO!Ey 9FOP !Eyv`*F FkB(F h?Up!""-O%- FF*F! &LS`fBtڡI*F! \(\1F0њH0їI <'H퍋LFO6=FJQF@FBwC84(nL=*5:SXJ]aY1CC"zx (gKgIh*@1Cc1I9C@10I $3FS}XF/(F FV9(FpI(F/DDd%|F8 SNgIF )F FbId0њF8@Sh[NTKh: "!PHSI2FWI[h "!+MHS?2FSI OHS95+F2FPI SZOI2F STMJNINHS#JJ#JIJHS!Fr! n! j! f! b! ^! 08I !O004h+1H&  !O00h+ &H 7 /$H8F)F F$ H8L!hFK?F(FSI"FF DH#enidlHwRGJNu(-OFMF]ݽH|N3F(FHrK`J`}h+x-+k`F8(F0F! W+=F&O- F0 `(Ѐ074 ?b("I@A9h)FH  *x  & ,.40XFW;D;+GFEx{EEu4EEEEEEEE"#`"#`"#`"K`9&,!&=4!& !&,& &&4&(!&(&i&d$&B&R &03%e"K"KJeE%EU%UEEEEE5Eu%uEe  "   "   "   " x  d0 Fh "  RtJh3`X  Z FM#+ ++ + fL!&+%+cL@!(+ *+`L !`L! _L! _L!^L!^L!!\JPNh C`OKh 3h3# C#3hGK"`"F@#c` `90FMKh 1F F*? 1F BKh#BJBICH# 8( J?II L3hx'?G7' F:F@/Kh+h+xsiJhZ a  h0Ih $xg+0-Khk,I,J Fh)H x'H lh+) XhF H (F wFH ~   L4!&&(!& &pA,&Pb$6C V-OFhF$nL R>IF k(>d(+D(,b(a0 6J9F0FEM9f(h(!Or(O'n(!p(F06x( z(!v(=@6#$6#(6#,6#46#686<6D6H6Kh.$&B4&*<&"<&,&ByJ8&"{H 4tJq<Y0uKvJvH) FFW#@O^pI FBXmK! a###x++&FfK*eJ`cxh320Y@񬀽t<"^KdPC#YA@h 2  0F:({2x,rx2pEHrF FO 8pEaL`A`6`+``"xd!40,0:"JClrra<090;3Dra "xcx0:0;3D+d3 Fsa#x !40<31;3a#x !40<0;3`#x !40<0;3`#x !0F0cxL0;3s`DJ? *8!&HHiIRJ!IAI'&uEIH"&@(#da(qګI l(IШIL@NGDO Oh0+7>FF٦B6FW0FNDH8h( #3p#sp9KOb1 Fp#xB4BK "%"%HL#CФ`VFHH HPQhyK1!oF(fCFqHQ (oH0F^ "!kHR?#Op!Bq 4OOgHB#BA_L @]L8Bw4 #"#HEq0F9F 6HF4Ov'T +T#Bw OT 4T#C<&4KJh*l=Jh*h-a?Jh "2`+ZAK$O(p`@K`@F>I N6h^#"F!F % FD 3IF(  0I00K`#.JF FBFP+x+9F (FZ F --9FX = zKh0 JK`-і VH)&*&*&(&*&@(*&L)&*&*&D)&i(&(&V?Il(&*&hp-CFFuIFZ(JsLF1FrJHF|A a( t(2#i+@рlKh#a%jKgOh  hV (< FBFXIYHBFXIVHMLOOUJ1FHFKM0BzA89("',16;>@CEJMPSZ_coci+f#Pci+a#Kci+\#Fci+W#Aci+R#@#(#a##`#`8h##b&`ciSOsci+##i 8hI a(#cbciOsca|li| Kh(:@3#@ӱ ],& @(iB]]p]^bl,+j+khfKh+,,`IHFBP_IHF>(]IHF8(,5,M,DМ,~,@hV' 5, ,,@,@i##*jih Z"-дowi#*jih ImV'@ h!F(d"F:I TV' (Y^kj+? F9V' eM" 0-HHK?(H4=OBF%H F&*!H Ӳ " C3#Fhj  iI FHI F (AFH AFH ,&B]bll$^>^Q^a^Wl\x^^FO F&J!F(FC R(f(O#`& KhBO;%D xT01F (%(F,&`i-GmLI QhJ#IH`J#``IJ` `K#`K$JO1 Oe`KO`K`K`K`K`#`J;p`J`J`!J`J`J!JH`J`J`J`J`J`J`J`J`J`JpFpF*F8FB? Qd2F|IF FzK`zHyK`yJ`yHzFHwIZK"`tI F VK`VK`pI FUK"`mI F(LJ#`LJ`!FhH@$fIF(DK"`CK`bI FzBK"`_H6^K`x,J[K`;L#h;YKhxXH%`WH 0VIXd $SKAPKPJ`PK`B@K%`$!K`#$FF CLObH!ho? $hQ=I"FF je&R\&7e &y&e&a&a&e&a&a&y&[&&D`&&t&&h&̟&ğ&&&&a&(&&ܟ&a&&&`&ߕρ)o׮BblׁE& Np؟&&hp@(Q]sK"pBFCF𨁦4D+ZR#5J MqK M M MM M M M ML MyK M M M M M M M M M M M MI MK M7L MIL ML M M M M M M M M M MK M MK;JKK MK M M M MKKKK L=LCLLL MLhH`gJ#`gJ"fK fJhC`eJh3dK"`K"bK"bK"aKaKh`KaI`(7^J_KRK"`"OKWKh[KUK "hXK(`x+?MKTIhKK "hPK(`x+?DKLIh "JK?Kh"HK "GI FJ9K4`$hFIFPFPx1K=Hh:F$4," Fe00 #$K"`$KhF##.J`.J`L hr+K(`"h*I*K`)Kh?)(Ha N'HHY F!K#Hh2F"I紟&Sy&a&&8&a&e&e&a&a&@(t&Wup& & &a&&a&]a&&&&@(hpԂH#F"$OhKhRK`K`KK` "!F.K!F(FXxPK:h (hPKbF*FIL#JH#``f x `0:PFPHF(ЂM+h3 j x(` h|K`}L#x yKh Ob F2o sK? hP!FFtHqK"pObpI FLohKh#lHeK` jN^ "iIjLF "hI(F2gH*FFfHl0F"FF0FbNc0F"FF0F_NZ0F"FF0F[NQ0F"FF0FIWHVJFVHAVHUJFUH9UH"FTLFTH0(F !F !FNL  !F!F  II +@ހ:FFBKh(F"!  |:!h"`h8F!2H F(0I /I @!h F(T[%FFP&i@`&П&&p&&<&:[&a&e&XPenfRp\nonznn|g6*AnE\&&)qFObԀ+OF0F (N[h # #03` 0;h+x B -")F Fa;h3;h+K"` I `KIh+í!HTI  I  mX&a&a&a&&&)q&-CFhFDrK`K`fK`K`XI8K9F F"`E, b%N I c0(9( v(ѓJh3`9FJ FA 08 #5`yhHH(>H$=I I@F, (K" h1 '*H 0;0+H@+hZ*` Kh+O3#@utx&Ip&-O]FFIF|0K"`L܂I(Fp(I(Fl(џK"`V(ܠ1+08J1F8FCd(Ol(c(`c``JIJIHI*FH KhBуKh`O8Fh+x-+kx,FO hF!FRFr \F FF౻hh+ F `F0D0:F(fH)FeH pCO!FbH\O@Wh+ Ft[H!FpK`zOb!F(Fz(F 0B QF(PF@ 0+8"0F8(0!F@ÀBH#"0F#. 0+{h 0C.0F,(@{hOr@!(F(FF B?)F)HuO 0;.0F#FQF0F0F"H^PFHT#3?. 0(F!FHp&IQpiQXgЛ *@!(FAFNH)F| zQF JH)F#BB #F FBH0F(FV Fjp=HlF FrBF!F8Hhk0Oa5Jz#Fo zp20D 0Or@!zHCFz%H$H%T)F0F0Fd 0{(F^0H FH!FXFR?+IKh/{h+Į!FH0F6 0ujpp&y-AD h ONH;`#3`Fx #3`I,K"` O8` s#}$`0F 3BF-/*sI,#0$pKpJ(FF]",+hx-*+* [xKUk!I(/E()`a(O /e(ZMK(h0&)hFRGIXFYFPF&n(2i(l(#F1I Fxx+/,I L'4C'7Y( X0Y( 5"HZ0>0F0I4XF0IEPF0I ,}h-9(Fzh HLJ+F(F!F F""FI @(Vi]]so78l-OðK"" $N`*K!JM` K@pK`K`K`K`K`!F@rL0`T#FF #"AFcPFCJKZFAmV([N(M6(b?(U4(O T(EIP( #%%eCc #k(( g()j(f(тKhbp(n(K'Fq(x({K'FktKhbctK'# EqK'%e### #"cCZH%O (F;k; F0@ bee#<FF>tFP #"cC$&dFSF! F=k( #"cCHJ 3hB@倶(@T5HhO+L@Hb 3B1F F=# FFX!>.F(FSF! F=/)?a%@ +H63 FZnnCN@5$H& FnnJ!Hjo)o FMt1 #2 CC))1 #:B2-(D:¢Ӣ `@(/'?i#4ABB ##"BBR### CE@:'#J @@C?BE##2C%"h%(F<( :-)F ##`HtОJKFK+! FKJ^ K+!J FT #B2 ##"cC rLHn0ьIH:: 0 IH4"KI:Y0сIH(3:g0|IH #!]F@C|XF;=0ǁzO:hE  XF;Dl l#@``n(΁;hX#:F! F_HeKhE+"X#(FZn:F<`hB `Z```+xc(F(D<6+O O O "l8Fk9V)[8FO4F0$ O8FMl0dB1)T)=0!C@2#C5KhX#8w03 8n03+H:BFQF(F8F(F8,%H:cI$H[h+I!H:/ FO F7FH:9FHF(O/;+@UR|WuR^lz diǣ /C/ h+qH:l4h+ШH:i(FH/)/@%//\IFHd':)#"eT#K`!(FD FO&0Ձ?IFH:K(F ##2C3@H0 th+ЉJIH:!@H0 bh+ЄJIH: FOF`B|I~H"F~H:/; ##2C !(F80pItH:tH: A@F #2#COO jKkOhX#pC gJrFPfK9FsFeH F;u0VIaHFcm+ #!CBr ##FZJ:"mbm F;jf'DIRH#mO nS':'0j#7jmBmIHS :nh#j)[h窹 #"AHSC@JAKFG ##CR #CJ2#C3 nh[hSj*03.#"#O X xO X Q[J PZK[HFG F8M(7*s 0!CRI!:H1F F= F:nKMhf3jC`"#!:2vh3:AIAH:q,F$ 708I:H:`''h[Zhh `A`hF `:>1F =G = %40K"790^ : 8 G7:C# @C"CH::X #"C F F[hB ?(F] I e)  ^ 0 0-0LQ0@| p00\@aalK0h0 ,0 010,|f / 0-LlM @TPKTT @0 % ),, @0!K04>>0@-S#* ` @ pP 0Q R 0 PpQ ` @T V000p\$00P00433x3 0-L@KM,PTP 0:K08d  - LMQ K 0K #Hp 0 S ,0 0  K t_$X` /$/'/y*/*/*/&*/%*/*/:*/*/*/*/*/%*/*/_*/\*/;}*/bz*/w*/t*/cq*/n*/k*/9h*/e*/b*/_*/8\*/Y*/V*/S*/P*/ M*/J*/G*/0D*/QA*/>*/);*/{8*/|5*/#2*//*/),*/=)*/&*/#*/" */*/*/*/////*/ */<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4*/=*/*/d*/(*/e*/*/*/ */f*/~*/{*/x*/2u*/Kr*/$  0j*/ +/ja*/O^*/[*/hX*/iU*/R*/vO*/L*/I*/F*Q/A*/>*/;*/ 8*/5*/!2*//*/,*/)*/&*/I#*/ */*/1/ *//7*/>*/ */6 */*///*/@-@ᕓ@*/xGFfxGF@xGFxGFB3xGFxGFxGFxGFyxGF~xGFxGFmxGF?-xGFxGFxGF-xGFHxGFU4xGFxGF9xGF:xGFOxGF)RxGFxGFJxGF/xGFW3xGFxGF3xGFDxGFxGF xGF xGF'xGF_xGF6xGF^/xGFŽxGFیxGFxGFxGFm6xGFW6xGF7xGFxGFxGFڬxGFxGFxGF~xGF^xGF2xGFxGFxGFxGFԝxGF]xGFxGFxGF^xGFxGFxGF_xGFExGF?>xGFxGF{xGFIyxGFxGF.xGFyxGFcxGFq3xGF\xGFxGFxGFxGF ExGFKxGFps_strings missing NULL Obj_Entry pointer in GOT Corrupt Obj_Entry pointer in GOT Dynamic linker version mismatch L*H}cEIĆdž]۹]nMˆ%҆ݺцݺmkՆۆџiuiPt[ta vt%2]>J P ZAYH$H$h'g'-GJ8p?TA@yB?GF7eFQQo]V]V]VZZ_]I_byqIdgQk\ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosgptifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory (3f%@aR1@@k8Bo@@u{Y m@@=Jm@@unblock and -DNO_CONV?z{zЀĀz z\zoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file& no previous commandunexpected end-of-fileinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sInvalid type in GNU longlink %dFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ...  dd*E;ZOd~# _^F<>?PATH= nt.f}dsuc ml rp 4n( v0̭ b   EOF reading here (<<) documentEMQUZ_cgkpu:y~}-+?=8B*/4"9?zeNA@Mk@k@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'L!0aK!1i(L!1oL!8yK!0Y<K!0dL!0K!0PL!0n 0 N#πҌpW,J nd$R ?I:  MtJn@eC [ !eW*M"wr%&               5!576h&!`mv=7 B}f77 ki  t 997fgs~w9~ɘEAtvzmn}7Cٌ +F){ T%falias %s=alias: %s not found arithmetic: unexpected '%c' (%#x) in expressionarithmetic: ++ operator unsupportedarithmetic: -- operator unsupportedarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ')'expecting primaryexpecting ':'expecting end of expressiongetcwd() failed: %sOLDPWDHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumenterror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failedusing redirections: do Node type = %d do subshell done subshell Cannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)DoneSignal %d (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sYou have stopped jobs. ${LINENO${#LINENO${#${(($(...)"(...)>|>>>&<&<> && || ! | &if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT.profile/etc/profileENVOut of spacestunalloc p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: EOF in backquote substitutionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Illegal eof marker for << redirectionBad function nameBad for loop variable2nd "!" unexpected%d: Here document (<<%s) expected but not present-o promptcmds not set: thenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncdirectnosigpipecloexecEXITEXIT trap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PScPS1-xnpxefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range%s: bad number!=closing paren expectedargument expectedmissing ]unexpected operatoreqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreadonlyreturnshifttrapbgchdirletfcinputrcgetoptshashjobidfdflagssetvarumaskunaliasulimittestwordexpPPID20160401 BUILD:20240428101703Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'missing format character%s: invalid directiveprint failed  GT Ps s  pk:o566k* Qkړ%Y z~#3#3233# @@kjmu}3 B@I;P:Vs]d ,C$+C1C$0CW8BKQ@Y@ a @ &% @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.q - : X t   U    @ @ @ @ @' @0 @5 @: @A @P  @F @L @U @] @  d i o v ~             @ @           & . 3 : A K Q  W ^ f m t  % | ( , 1 >9 > D J P W  ^ b I Bh Bn H{@          B: ?   I       B   6          % * 1 : B J P T [ o e n u ~                ( , 1 >9 > D J P W  ^ b I Bh Bn H{@          B: ?   I       B ( , 1 >9 > D J P W  ^ b I Bh Bn H{@          B: ?   I       B changing %s byteorder to %sreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk usage:%s %s %s %s %s: unknown machine typeDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown archgetlabelusesmbr() failed%s: not be or leAB:CDFIM:NRWef:ilmrtvwunknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbarm64evbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn26acorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] 3Usage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s successfully scanned %s. forceWedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:unhandled type %d QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMAND: %sdrvctl-errorget-properties: %sdrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': select neither dict nor array with '%s' u,.6J6]6s66666 O7 n7 7 7 7777828E88888889 39!G#G$C9&G1G2K93G4G5g96G8r99x999:9;9<9=9@9A :BG:Cs:D:E:F:G:H:J:L:M ;N;O ;P0;QB;RW;Sq;Tz;U;V;W;\;a;c;d<e@<fT<gg<hg<ig<pn<qGsGtGu<vGw<x<<<<=!=6=E=W=x===== >!>;>Y>k>>>>>>>??8?8?8?X?x?? q???????GGGG?@$@=@0BT@g@t@@@@@@@@A%A%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]G`tq``tH{@          B: ?   I       B returning to single-user after filesystem check -ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %srqInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directorysize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for todo listNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  YYYX        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledDIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkINTERNAL ERROR: expandfile() failed to allocate a new block bad filesize %llu to expandfileusage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-)ș6?hriH{k,>R`0H`|4Ⱥ!H{@          B: ?   I       B u,.6J6]6s66666 O7 n7 7 7 7777828E88888889 39!G#G$C9&G1G2K93G4G5g96G8r99x999:9;9<9=9@9A :BG:Cs:D:E:F:G:H:J:L:M ;N;O ;P0;QB;RW;Sq;Tz;U;V;W;\;a;c;d<e@<fT<gg<hg<ig<pn<qGsGtGu<vGw<x<<<<=!=6=E=W=x===== >!>;>Y>k>>>>>>>??8?8?8?X?x?? q???????GGGG?@$@=@0BT@g@t@@@@@@@@A%A;|nQn- q+|nQn- q+|nQn- q+ɨҨ|nQn- q+|nQn- q+=rGy=iG};Mt?'2mWC 3KOO=HyD<#*=(S]3Dh&go\ M}--чH -чHBZIчH`tөIчHqIчH-2IчH@ a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerdestroy[-rf]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize-i index [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:i:l-a attribute -i index (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %lsUnknown %#x[partition not found?]Type: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:lua%5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrts7:=@feU0mlm0BPAB!* 0Ir0xw0ׯ2ׯq* 0B0> 9uݺsetifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapsrzi8yi0Pn0ʲ(tEKr0{!0 @  0&@/8=)ZBH N@Mhinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst׮  ׮`@׮W/media_statusmedia_constructorXfkXfXX Xpaddr_match-)settunnelA0$Pprint_link_addressessetvlanifsetvlan6<;<RSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#xTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sVLAN_MTUVLAN_HWTAGGINGJUMBO_MTU ec_capabilities=%s ec_enabled=%s NONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x>af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstrbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@WdlNolsxl@lll~ X  @+<Ja@ffsG`tq``t%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup'blunal l we@") bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.'blunal l k@kwke@l@~mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload'blunal l k@kwkl@$Ne@dsoftdep'blunal l e@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s'blunal l k@kwe@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s'blunal l we@&+5 ;@DKSY^b ~o@h @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %sw'blunal l e@~usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o g,f G[{ 4Yy'Lq%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()6GC?6;737/+'usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Checksum error %o, inode %llu file %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGCCVCoCCCCD/DODoDDDDE=E]EEEUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtudfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanLW9\W!hWrW!~WW!CW!~WW!WW!WWmWWX!!X&Xa, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_url~~sendrequestrecvrequestR ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPASVPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbvbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)usage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D'L0`040S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ica`Z'M3  i'``vO'`Rb'`RW'``l^'``k_'`axQ'a$auP'1a7ej`':aR`'CaRa'MaRc'Va^axM'kaZ'rayaZ'aRL]'a`tc'acawN'aaHM'aac'aa'a`|S'aa{T' bbwR'-b7ezU'6bRU'?bRV'Ib`d'UbRe'`bnbX'b7ef'bR g'bR h'djdjH{@          B: ?   I       B hw.disknames@2IчH`tZIчHq IчHK=rGy=iG}o3Dh&oSFH0eCΨ SFU0eC -чH-IчHB-чH (s*K>;y Hah!IdontNeedEFI      !"#$%&  Zl'[l'] l'^l'/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfWhat kind of system do you have?Raspberry PIOtherrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 8.2_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-8.2_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-8.2_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-8.2_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-8.2_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-8.2_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.AddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sCreate new image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named %s) seems to exist on %s. Do you want to use that?If you booted from a floppy, you may now remove the disk. Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-8.2_STABLEftp prefix/evbarm/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/evbarm/8.2_STABLE/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%cdisklabel -w -r%s -f /tmp/disktab %s '%s' -i /sbin/newfs -V2 -O2 /dev/r%s/sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbrdevice %s %s (%s@%s)%s (%s, %s)%s (%s, %s %s)gpt -qr header %sCannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0adk:no_partwindows,hfs/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-ADI_BRHkern-INTEGRATORkern-IQ80310kern-IQ80321kern-MINI2440kern-TEAMASA_NPWRkern-TS7200kern-RPIkern-KUROBOX_PROgamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%scCan't open %s Can't read disklabel on %s. %s/netbsd.bin/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgin/usr/pkg/bin/pkgin -y install %ss,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %seject -t disk /dev/%sdraidctlvnconfigcgdconfig-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedgesmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.old/etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d) %*s (%s)Extended partition, LBAFreeBSD/386BSDDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld /bootdisk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'***************************************************************************************************************************************************************************************************************************************R usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipesetvarcontrol_handle_datacontrol_writeonedhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1 jjdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbҖcZdլeef٬gh9ijcaklʲmnOopq]urstuZvw`xzHy'A-B:CDAEFKGUHNIJ_KfL/MoNuO~PQM>STUVWXZ~1ʭ4ӭ6ά|~ܭ}%#*28naxlߪGPêX`jw!Ůծldefault_configread_configrt_descrt_headclear0rt_disposert_new0rt_setifrt_newrt_freert_findrt_kfreert_addrt_recvrtrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initmake_varappend_configeh make_envXhȲѲBܲscript_runreason0123456789abcdefdhcp_envoptionLs̴%Rl۵/Stж@m);V|&:Pnȹ޹ȹ/Jeκ޺κ>&κWuӻ5^;ݼif_copysaif_opensockets_osif_routeif_ifa )arp_tryfreearp_readarp_probe1arp_announce1arp_openarp_probearp_announcearp_new5( HPHHPbpf_arp( PEP HEHH@DCH``Pget_leaseread_leaselog_dhcp dhcp_bindFXj dhcp_openbpfdhcp_informdhcp_handledhcpdhcp_readpacketdhcp_readudpdhcp_expiredhcp_lastleasedhcp_start1dhcp_initdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_sendadvertisementipv6nd_expireraipv6nd_handledataipv6nd_handleraipv6nd_advertiseipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1U^iry  '3Adhcp6_checkstatusokdhcp6_validateleasedhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrebinddhcp6_listendhcp6_writeleasedhcp6_recvifdhcp6_startrequestdhcp6_recv '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_envdhcp6_dump%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version7.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 7.2.2 %s Compiled in features: INET ARP INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-7.2.2 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: is a NET/ROM pseudo interfacepicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type %.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %sIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argument%s: IA_PD not compiled inunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactive(null) rejectcmd != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.c%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsifp != NULLrt->rt_ifp->ctx != NULLrts != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL%s_%sTESTSTATIC6ROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid= - %s %s: executing `%s' %sRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbin%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s%s_%s=/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtdst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_USELOOPBACK%s: SIOCGIFALIASnet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6%s: ARP probing %s (%d of %d), next in %0.1f seconds%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: probing for %s%s: ARP announcement of %s cancelled%s: hardware address %s claims %s%s: DAD detected %s/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: waiting for DAD on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: dhcp_read_lease_fd%s: %s: truncated lease%s: extending lease until DaD failure or DHCP%s: extending leaseNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %s0.0.0.0/0MS %s: using %sClassless Static Routesip_addresssubnet_cidrnetwork_numberserver_name%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: waiting for 3rd party to configure IP address3RDPARTY%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s not found%s: if_sendrawFAIL%s: dhcp_makeudppacket%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: cannot add IP address in test mode%s: DAD completed for %s%s: op (%d) is not BOOTREPLY%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is for hwaddr %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: checksum failure from %s%s: invalid UDP packet from %s%s: server %s is not destination%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired%s: timed out contacting a DHCP server, using last lease%s: dhcp_openudp%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %sDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s broadcast %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsip6_address%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: sending NA for %s%s: waiting for Router Advertisement DAD to complete%s: %s is reachable again%s: %s is unreachable, expiring itrtpref: impossible RA flag %x%s: %s: router expired%s: expired address %sIPv6 ICMP packet too short from %s%s: IPv6 NA too short from %sinvalid hoplimit(%d) in NA from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)IPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: reject RA (no option %s) from %sdhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s_nd%zuaddr%zu%s: delaying Router Solicitation for LL address%s: no IPv6 Routers available%s: sending Router Solicitation%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: DHCPv6 DAD completed%s: ignoring unicast option as not masterbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s: dropping DHCPv6 due to no valid routers%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~bufox ~Biً a/@r/etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid*0- ).+(/, '!% #34 !#$:./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmta.m.pmp.m.dstmidnightmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagoyearmonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed Inkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist